# PaCkAgE DaTaStReAm less 1 1275 # end of header 070701000732e9000081a40000000000000000000000014cad6ba0000000fe000000b500010002ffffffffffffffff0000000d00000000less/pkginfoPKG=less NAME=less 436 i86pc Solaris 10 VERSION=436 PSTAMP=7th October 2010 VENDOR=Mark Nudelman EMAIL=http://www.greenwoodsoftware.com/less/index.html DESC=Less pager ARCH=i386 CATEGORY=utility CLASSES=none BASEDIR=/ ISTATES=S s 1 2 3 RSTATES=S s 1 2 3 070701000732e8000081a40000000000000000000000014cad6ba0000002f1000000b500010002ffffffffffffffff0000000c00000000less/pkgmap: 1 1275 1 d none /usr ? ? ? 1 d none /usr/local ? ? ? 1 d none /usr/local/bin 0755 root root 1 f none /usr/local/bin/less 0755 root root 505948 8693 1286433595 1 f none /usr/local/bin/lessecho 0755 root root 17480 55683 1286433595 1 f none /usr/local/bin/lesskey 0755 root root 27684 11125 1286433595 1 d none /usr/local/share 0755 root root 1 d none /usr/local/share/man 0755 root root 1 d none /usr/local/share/man/man1 0755 root root 1 f none /usr/local/share/man/man1/less.1 0644 root root 64758 39463 1286433595 1 f none /usr/local/share/man/man1/lessecho.1 0644 root root 1225 37295 1286433595 1 f none /usr/local/share/man/man1/lesskey.1 0644 root root 9624 25944 1286433595 1 i checkinstall 790 2504 1286433696 1 i pkginfo 254 19872 1286433696 07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!070701000732e9000081a40000000000000000000000014cad6ba0000000fe000000b500010002ffffffffffffffff0000000800000000pkginfoPKG=less NAME=less 436 i86pc Solaris 10 VERSION=436 PSTAMP=7th October 2010 VENDOR=Mark Nudelman EMAIL=http://www.greenwoodsoftware.com/less/index.html DESC=Less pager ARCH=i386 CATEGORY=utility CLASSES=none BASEDIR=/ ISTATES=S s 1 2 3 RSTATES=S s 1 2 3 070701000732e8000081a40000000000000000000000014cad6ba0000002f1000000b500010002ffffffffffffffff0000000700000000pkgmap: 1 1275 1 d none /usr ? ? ? 1 d none /usr/local ? ? ? 1 d none /usr/local/bin 0755 root root 1 f none /usr/local/bin/less 0755 root root 505948 8693 1286433595 1 f none /usr/local/bin/lessecho 0755 root root 17480 55683 1286433595 1 f none /usr/local/bin/lesskey 0755 root root 27684 11125 1286433595 1 d none /usr/local/share 0755 root root 1 d none /usr/local/share/man 0755 root root 1 d none /usr/local/share/man/man1 0755 root root 1 f none /usr/local/share/man/man1/less.1 0644 root root 64758 39463 1286433595 1 f none /usr/local/share/man/man1/lessecho.1 0644 root root 1225 37295 1286433595 1 f none /usr/local/share/man/man1/lesskey.1 0644 root root 9624 25944 1286433595 1 i checkinstall 790 2504 1286433696 1 i pkginfo 254 19872 1286433696 070701000732f7000041ed0000000000000000000000024cad6ba000000000000000b500010002ffffffffffffffff0000000800000000install070701000732f8000081ed0000000000000000000000014cad6ba000000316000000b500010002ffffffffffffffff0000001500000000install/checkinstall#!/bin/sh # expected_bits="64" expected_release="5.10" expected_platform="i386" # release=`uname -r` platform=`uname -p` bits=`isainfo -b` # if [ ${platform} != ${expected_platform} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_platform} architecture\n" echo "\tAborting installation.\n\n\n" exit 1 fi if [ ${release} != ${expected_release} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_release} machine\n" echo "\tAborting installation.\n\n\n" exit 1 fi #if [ ${bits} != ${expected_bits} ]; then # echo "\n\n\n\tThis package must be installed on a ${expected_bits} bit machine\n" # echo "\tYour machine is running a ${bits} bit O.S. currently\n" # echo "\tAborting installation.\n\n\n" # exit 1 #fi exit 0 070701000732ea000041ed0000000000000000000000034cad6ba000000000000000b500010002ffffffffffffffff0000000500000000root070701000732eb000041ed0000000000000000000000034cad6ba000000000000000b500010002ffffffffffffffff0000000900000000root/usr070701000732ec000041ed0000000000000000000000044cad6ba000000000000000b500010002ffffffffffffffff0000000f00000000root/usr/local070701000732f1000041ed0000000000000000000000034cad6ba000000000000000b500010002ffffffffffffffff0000001500000000root/usr/local/share070701000732f2000041ed0000000000000000000000034cad6ba000000000000000b500010002ffffffffffffffff0000001900000000root/usr/local/share/man070701000732f3000041ed0000000000000000000000024cad6ba000000000000000b500010002ffffffffffffffff0000001e00000000root/usr/local/share/man/man1070701000732f4000081a40000000000000000000000014cad6b3b0000fcf6000000b500010002ffffffffffffffff0000002500000000root/usr/local/share/man/man1/less.1.TH LESS 1 "Version 436: 07 Jul 2009" .SH NAME less \- opposite of more .SH SYNOPSIS .B "less \-?" .br .B "less \-\-help" .br .B "less \-V" .br .B "less \-\-version" .br .B "less [\-[+]aBcCdeEfFgGiIJKLmMnNqQrRsSuUVwWX~]" .br .B " [\-b \fIspace\fP] [\-h \fIlines\fP] [\-j \fIline\fP] [\-k \fIkeyfile\fP]" .br .B " [\-{oO} \fIlogfile\fP] [\-p \fIpattern\fP] [\-P \fIprompt\fP] [\-t \fItag\fP]" .br .B " [\-T \fItagsfile\fP] [\-x \fItab\fP,...] [\-y \fIlines\fP] [\-[z] \fIlines\fP]" .br .B " [\-# \fIshift\fP] [+[+]\fIcmd\fP] [\-\-] [\fIfilename\fP]..." .br (See the OPTIONS section for alternate option syntax with long option names.) .SH DESCRIPTION .I Less is a program similar to .I more (1), but which allows backward movement in the file as well as forward movement. Also, .I less does not have to read the entire input file before starting, so with large input files it starts up faster than text editors like .I vi (1). .I Less uses termcap (or terminfo on some systems), so it can run on a variety of terminals. There is even limited support for hardcopy terminals. (On a hardcopy terminal, lines which should be printed at the top of the screen are prefixed with a caret.) .PP Commands are based on both .I more and .I vi. Commands may be preceded by a decimal number, called N in the descriptions below. The number is used by some commands, as indicated. .SH COMMANDS In the following descriptions, ^X means control-X. ESC stands for the ESCAPE key; for example ESC-v means the two character sequence "ESCAPE", then "v". .IP "h or H" Help: display a summary of these commands. If you forget all the other commands, remember this one. .IP "SPACE or ^V or f or ^F" Scroll forward N lines, default one window (see option \-z below). If N is more than the screen size, only the final screenful is displayed. Warning: some systems use ^V as a special literalization character. .IP "z" Like SPACE, but if N is specified, it becomes the new window size. .IP "ESC-SPACE" Like SPACE, but scrolls a full screenful, even if it reaches end-of-file in the process. .IP "RETURN or ^N or e or ^E or j or ^J" Scroll forward N lines, default 1. The entire N lines are displayed, even if N is more than the screen size. .IP "d or ^D" Scroll forward N lines, default one half of the screen size. If N is specified, it becomes the new default for subsequent d and u commands. .IP "b or ^B or ESC-v" Scroll backward N lines, default one window (see option \-z below). If N is more than the screen size, only the final screenful is displayed. .IP "w" Like ESC-v, but if N is specified, it becomes the new window size. .IP "y or ^Y or ^P or k or ^K" Scroll backward N lines, default 1. The entire N lines are displayed, even if N is more than the screen size. Warning: some systems use ^Y as a special job control character. .IP "u or ^U" Scroll backward N lines, default one half of the screen size. If N is specified, it becomes the new default for subsequent d and u commands. .IP "ESC-) or RIGHTARROW" Scroll horizontally right N characters, default half the screen width (see the \-# option). If a number N is specified, it becomes the default for future RIGHTARROW and LEFTARROW commands. While the text is scrolled, it acts as though the \-S option (chop lines) were in effect. .IP "ESC-( or LEFTARROW" Scroll horizontally left N characters, default half the screen width (see the \-# option). If a number N is specified, it becomes the default for future RIGHTARROW and LEFTARROW commands. .IP "r or ^R or ^L" Repaint the screen. .IP R Repaint the screen, discarding any buffered input. Useful if the file is changing while it is being viewed. .IP "F" Scroll forward, and keep trying to read when the end of file is reached. Normally this command would be used when already at the end of the file. It is a way to monitor the tail of a file which is growing while it is being viewed. (The behavior is similar to the "tail \-f" command.) .IP "g or < or ESC-<" Go to line N in the file, default 1 (beginning of file). (Warning: this may be slow if N is large.) .IP "G or > or ESC->" Go to line N in the file, default the end of the file. (Warning: this may be slow if N is large, or if N is not specified and standard input, rather than a file, is being read.) .IP "p or %" Go to a position N percent into the file. N should be between 0 and 100, and may contain a decimal point. .IP "P" Go to the line containing byte offset N in the file. .IP "{" If a left curly bracket appears in the top line displayed on the screen, the { command will go to the matching right curly bracket. The matching right curly bracket is positioned on the bottom line of the screen. If there is more than one left curly bracket on the top line, a number N may be used to specify the N-th bracket on the line. .IP "}" If a right curly bracket appears in the bottom line displayed on the screen, the } command will go to the matching left curly bracket. The matching left curly bracket is positioned on the top line of the screen. If there is more than one right curly bracket on the top line, a number N may be used to specify the N-th bracket on the line. .IP "(" Like {, but applies to parentheses rather than curly brackets. .IP ")" Like }, but applies to parentheses rather than curly brackets. .IP "[" Like {, but applies to square brackets rather than curly brackets. .IP "]" Like }, but applies to square brackets rather than curly brackets. .IP "ESC-^F" Followed by two characters, acts like {, but uses the two characters as open and close brackets, respectively. For example, "ESC ^F < >" could be used to go forward to the > which matches the < in the top displayed line. .IP "ESC-^B" Followed by two characters, acts like }, but uses the two characters as open and close brackets, respectively. For example, "ESC ^B < >" could be used to go backward to the < which matches the > in the bottom displayed line. .IP m Followed by any lowercase letter, marks the current position with that letter. .IP "'" (Single quote.) Followed by any lowercase letter, returns to the position which was previously marked with that letter. Followed by another single quote, returns to the position at which the last "large" movement command was executed. Followed by a ^ or $, jumps to the beginning or end of the file respectively. Marks are preserved when a new file is examined, so the ' command can be used to switch between input files. .IP "^X^X" Same as single quote. .IP /pattern Search forward in the file for the N-th line containing the pattern. N defaults to 1. The pattern is a regular expression, as recognized by the regular expression library supplied by your system. The search starts at the second line displayed (but see the \-a and \-j options, which change this). .sp Certain characters are special if entered at the beginning of the pattern; they modify the type of search rather than become part of the pattern: .RS .IP "^N or !" Search for lines which do NOT match the pattern. .IP "^E or *" Search multiple files. That is, if the search reaches the END of the current file without finding a match, the search continues in the next file in the command line list. .IP "^F or @" Begin the search at the first line of the FIRST file in the command line list, regardless of what is currently displayed on the screen or the settings of the \-a or \-j options. .IP "^K" Highlight any text which matches the pattern on the current screen, but don't move to the first match (KEEP current position). .IP "^R" Don't interpret regular expression metacharacters; that is, do a simple textual comparison. .RE .IP ?pattern Search backward in the file for the N-th line containing the pattern. The search starts at the line immediately before the top line displayed. .sp Certain characters are special as in the / command: .RS .IP "^N or !" Search for lines which do NOT match the pattern. .IP "^E or *" Search multiple files. That is, if the search reaches the beginning of the current file without finding a match, the search continues in the previous file in the command line list. .IP "^F or @" Begin the search at the last line of the last file in the command line list, regardless of what is currently displayed on the screen or the settings of the \-a or \-j options. .IP "^K" As in forward searches. .IP "^R" As in forward searches. .RE .IP "ESC-/pattern" Same as "/*". .IP "ESC-?pattern" Same as "?*". .IP n Repeat previous search, for N-th line containing the last pattern. If the previous search was modified by ^N, the search is made for the N-th line NOT containing the pattern. If the previous search was modified by ^E, the search continues in the next (or previous) file if not satisfied in the current file. If the previous search was modified by ^R, the search is done without using regular expressions. There is no effect if the previous search was modified by ^F or ^K. .IP N Repeat previous search, but in the reverse direction. .IP "ESC-n" Repeat previous search, but crossing file boundaries. The effect is as if the previous search were modified by *. .IP "ESC-N" Repeat previous search, but in the reverse direction and crossing file boundaries. .IP "ESC-u" Undo search highlighting. Turn off highlighting of strings matching the current search pattern. If highlighting is already off because of a previous ESC-u command, turn highlighting back on. Any search command will also turn highlighting back on. (Highlighting can also be disabled by toggling the \-G option; in that case search commands do not turn highlighting back on.) .IP "&pattern" Display only lines which match the pattern; lines which do not match the pattern are not displayed. If pattern is empty (if you type & immediately followed by ENTER), any filtering is turned off, and all lines are displayed. While filtering is in effect, an ampersand is displayed at the beginning of the prompt, as a reminder that some lines in the file may be hidden. .sp Certain characters are special as in the / command: .RS .IP "^N or !" Display only lines which do NOT match the pattern. .IP "^R" Don't interpret regular expression metacharacters; that is, do a simple textual comparison. .RE .IP ":e [filename]" Examine a new file. If the filename is missing, the "current" file (see the :n and :p commands below) from the list of files in the command line is re-examined. A percent sign (%) in the filename is replaced by the name of the current file. A pound sign (#) is replaced by the name of the previously examined file. However, two consecutive percent signs are simply replaced with a single percent sign. This allows you to enter a filename that contains a percent sign in the name. Similarly, two consecutive pound signs are replaced with a single pound sign. The filename is inserted into the command line list of files so that it can be seen by subsequent :n and :p commands. If the filename consists of several files, they are all inserted into the list of files and the first one is examined. If the filename contains one or more spaces, the entire filename should be enclosed in double quotes (also see the \-" option). .IP "^X^V or E" Same as :e. Warning: some systems use ^V as a special literalization character. On such systems, you may not be able to use ^V. .IP ":n" Examine the next file (from the list of files given in the command line). If a number N is specified, the N-th next file is examined. .IP ":p" Examine the previous file in the command line list. If a number N is specified, the N-th previous file is examined. .IP ":x" Examine the first file in the command line list. If a number N is specified, the N-th file in the list is examined. .IP ":d" Remove the current file from the list of files. .IP "t" Go to the next tag, if there were more than one matches for the current tag. See the \-t option for more details about tags. .IP "T" Go to the previous tag, if there were more than one matches for the current tag. .IP "= or ^G or :f" Prints some information about the file being viewed, including its name and the line number and byte offset of the bottom line being displayed. If possible, it also prints the length of the file, the number of lines in the file and the percent of the file above the last displayed line. .IP \- Followed by one of the command line option letters (see OPTIONS below), this will change the setting of that option and print a message describing the new setting. If a ^P (CONTROL-P) is entered immediately after the dash, the setting of the option is changed but no message is printed. If the option letter has a numeric value (such as \-b or \-h), or a string value (such as \-P or \-t), a new value may be entered after the option letter. If no new value is entered, a message describing the current setting is printed and nothing is changed. .IP \-\- Like the \- command, but takes a long option name (see OPTIONS below) rather than a single option letter. You must press RETURN after typing the option name. A ^P immediately after the second dash suppresses printing of a message describing the new setting, as in the \- command. .IP \-+ Followed by one of the command line option letters this will reset the option to its default setting and print a message describing the new setting. (The "\-+\fIX\fP" command does the same thing as "\-+\fIX\fP" on the command line.) This does not work for string-valued options. .IP \-\-+ Like the \-+ command, but takes a long option name rather than a single option letter. .IP \-! Followed by one of the command line option letters, this will reset the option to the "opposite" of its default setting and print a message describing the new setting. This does not work for numeric or string-valued options. .IP \-\-! Like the \-! command, but takes a long option name rather than a single option letter. .IP _ (Underscore.) Followed by one of the command line option letters, this will print a message describing the current setting of that option. The setting of the option is not changed. .IP __ (Double underscore.) Like the _ (underscore) command, but takes a long option name rather than a single option letter. You must press RETURN after typing the option name. .IP +cmd Causes the specified cmd to be executed each time a new file is examined. For example, +G causes .I less to initially display each file starting at the end rather than the beginning. .IP V Prints the version number of .I less being run. .IP "q or Q or :q or :Q or ZZ" Exits .I less. .PP The following four commands may or may not be valid, depending on your particular installation. .PP .IP v Invokes an editor to edit the current file being viewed. The editor is taken from the environment variable VISUAL if defined, or EDITOR if VISUAL is not defined, or defaults to "vi" if neither VISUAL nor EDITOR is defined. See also the discussion of LESSEDIT under the section on PROMPTS below. .IP "! shell-command" Invokes a shell to run the shell-command given. A percent sign (%) in the command is replaced by the name of the current file. A pound sign (#) is replaced by the name of the previously examined file. "!!" repeats the last shell command. "!" with no shell command simply invokes a shell. On Unix systems, the shell is taken from the environment variable SHELL, or defaults to "sh". On MS-DOS and OS/2 systems, the shell is the normal command processor. .IP "| shell-command" represents any mark letter. Pipes a section of the input file to the given shell command. The section of the file to be piped is between the first line on the current screen and the position marked by the letter. may also be ^ or $ to indicate beginning or end of file respectively. If is . or newline, the current screen is piped. .IP "s filename" Save the input to a file. This only works if the input is a pipe, not an ordinary file. .PP .SH OPTIONS Command line options are described below. Most options may be changed while .I less is running, via the "\-" command. .PP Most options may be given in one of two forms: either a dash followed by a single letter, or two dashes followed by a long option name. A long option name may be abbreviated as long as the abbreviation is unambiguous. For example, \-\-quit-at-eof may be abbreviated \-\-quit, but not --qui, since both \-\-quit-at-eof and \-\-quiet begin with \-\-qui. Some long option names are in uppercase, such as \-\-QUIT-AT-EOF, as distinct from \-\-quit-at-eof. Such option names need only have their first letter capitalized; the remainder of the name may be in either case. For example, \-\-Quit-at-eof is equivalent to \-\-QUIT-AT-EOF. .PP Options are also taken from the environment variable "LESS". For example, to avoid typing "less \-options ..." each time .I less is invoked, you might tell .I csh: .sp setenv LESS "-options" .sp or if you use .I sh: .sp LESS="-options"; export LESS .sp On MS-DOS, you don't need the quotes, but you should replace any percent signs in the options string by double percent signs. .sp The environment variable is parsed before the command line, so command line options override the LESS environment variable. If an option appears in the LESS variable, it can be reset to its default value on the command line by beginning the command line option with "\-+". .sp For options like \-P or \-D which take a following string, a dollar sign ($) must be used to signal the end of the string. For example, to set two \-D options on MS-DOS, you must have a dollar sign between them, like this: .sp LESS="-Dn9.1$-Ds4.1" .sp .IP "\-? or \-\-help" This option displays a summary of the commands accepted by .I less (the same as the h command). (Depending on how your shell interprets the question mark, it may be necessary to quote the question mark, thus: "\-\e?".) .IP "\-a or \-\-search-skip-screen" Causes searches to start after the last line displayed on the screen, thus skipping all lines displayed on the screen. By default, searches start at the second line on the screen (or after the last found line; see the \-j option). .IP "\-b\fIn\fP or \-\-buffers=\fIn\fP" Specifies the amount of buffer space .I less will use for each file, in units of kilobytes (1024 bytes). By default 64K of buffer space is used for each file (unless the file is a pipe; see the \-B option). The \-b option specifies instead that \fIn\fP kilobytes of buffer space should be used for each file. If \fIn\fP is \-1, buffer space is unlimited; that is, the entire file can be read into memory. .IP "\-B or \-\-auto-buffers" By default, when data is read from a pipe, buffers are allocated automatically as needed. If a large amount of data is read from the pipe, this can cause a large amount of memory to be allocated. The \-B option disables this automatic allocation of buffers for pipes, so that only 64K (or the amount of space specified by the \-b option) is used for the pipe. Warning: use of \-B can result in erroneous display, since only the most recently viewed part of the piped data is kept in memory; any earlier data is lost. .IP "\-c or \-\-clear-screen" Causes full screen repaints to be painted from the top line down. By default, full screen repaints are done by scrolling from the bottom of the screen. .IP "\-C or \-\-CLEAR-SCREEN" Same as \-c, for compatibility with older versions of .I less. .IP "\-d or \-\-dumb" The \-d option suppresses the error message normally displayed if the terminal is dumb; that is, lacks some important capability, such as the ability to clear the screen or scroll backward. The \-d option does not otherwise change the behavior of .I less on a dumb terminal. .IP "\-D\fBx\fP\fIcolor\fP or \-\-color=\fBx\fP\fIcolor\fP" [MS-DOS only] Sets the color of the text displayed. \fBx\fP is a single character which selects the type of text whose color is being set: n=normal, s=standout, d=bold, u=underlined, k=blink. \fIcolor\fP is a pair of numbers separated by a period. The first number selects the foreground color and the second selects the background color of the text. A single number \fIN\fP is the same as \fIN.M\fP, where \fIM\fP is the normal background color. .IP "\-e or \-\-quit-at-eof" Causes .I less to automatically exit the second time it reaches end-of-file. By default, the only way to exit .I less is via the "q" command. .IP "\-E or \-\-QUIT-AT-EOF" Causes .I less to automatically exit the first time it reaches end-of-file. .IP "\-f or \-\-force" Forces non-regular files to be opened. (A non-regular file is a directory or a device special file.) Also suppresses the warning message when a binary file is opened. By default, .I less will refuse to open non-regular files. Note that some operating systems will not allow directories to be read, even if \-f is set. .IP "\-F or \-\-quit-if-one-screen" Causes .I less to automatically exit if the entire file can be displayed on the first screen. .IP "\-g or \-\-hilite-search" Normally, .I less will highlight ALL strings which match the last search command. The \-g option changes this behavior to highlight only the particular string which was found by the last search command. This can cause .I less to run somewhat faster than the default. .IP "\-G or \-\-HILITE-SEARCH" The \-G option suppresses all highlighting of strings found by search commands. .IP "\-h\fIn\fP or \-\-max-back-scroll=\fIn\fP" Specifies a maximum number of lines to scroll backward. If it is necessary to scroll backward more than \fIn\fP lines, the screen is repainted in a forward direction instead. (If the terminal does not have the ability to scroll backward, \-h0 is implied.) .IP "\-i or \-\-ignore-case" Causes searches to ignore case; that is, uppercase and lowercase are considered identical. This option is ignored if any uppercase letters appear in the search pattern; in other words, if a pattern contains uppercase letters, then that search does not ignore case. .IP "\-I or \-\-IGNORE-CASE" Like \-i, but searches ignore case even if the pattern contains uppercase letters. .IP "\-j\fIn\fP or \-\-jump-target=\fIn\fP" Specifies a line on the screen where the "target" line is to be positioned. The target line is the line specified by any command to search for a pattern, jump to a line number, jump to a file percentage or jump to a tag. The screen line may be specified by a number: the top line on the screen is 1, the next is 2, and so on. The number may be negative to specify a line relative to the bottom of the screen: the bottom line on the screen is \-1, the second to the bottom is \-2, and so on. Alternately, the screen line may be specified as a fraction of the height of the screen, starting with a decimal point: .5 is in the middle of the screen, .3 is three tenths down from the first line, and so on. If the line is specified as a fraction, the actual line number is recalculated if the terminal window is resized, so that the target line remains at the specified fraction of the screen height. If any form of the \-j option is used, forward searches begin at the line immediately after the target line, and backward searches begin at the target line. For example, if "\-j4" is used, the target line is the fourth line on the screen, so forward searches begin at the fifth line on the screen. .IP "\-J or \-\-status-column" Displays a status column at the left edge of the screen. The status column shows the lines that matched the current search. The status column is also used if the \-w or \-W option is in effect. .IP "\-k\fIfilename\fP or \-\-lesskey-file=\fIfilename\fP" Causes .I less to open and interpret the named file as a .I lesskey (1) file. Multiple \-k options may be specified. If the LESSKEY or LESSKEY_SYSTEM environment variable is set, or if a lesskey file is found in a standard place (see KEY BINDINGS), it is also used as a .I lesskey file. .IP "\-K or \-\-quit-on-intr" Causes .I less to exit immediately when an interrupt character (usually ^C) is typed. Normally, an interrupt character causes .I less to stop whatever it is doing and return to its command prompt. Note that use of this option makes it impossible to return to the command prompt from the "F" command. .IP "\-L or \-\-no-lessopen" Ignore the LESSOPEN environment variable (see the INPUT PREPROCESSOR section below). This option can be set from within \fIless\fP, but it will apply only to files opened subsequently, not to the file which is currently open. .IP "\-m or \-\-long-prompt" Causes .I less to prompt verbosely (like \fImore\fP), with the percent into the file. By default, .I less prompts with a colon. .IP "\-M or \-\-LONG-PROMPT" Causes .I less to prompt even more verbosely than .I more. .IP "\-n or \-\-line-numbers" Suppresses line numbers. The default (to use line numbers) may cause .I less to run more slowly in some cases, especially with a very large input file. Suppressing line numbers with the \-n option will avoid this problem. Using line numbers means: the line number will be displayed in the verbose prompt and in the = command, and the v command will pass the current line number to the editor (see also the discussion of LESSEDIT in PROMPTS below). .IP "\-N or \-\-LINE-NUMBERS" Causes a line number to be displayed at the beginning of each line in the display. .IP "\-o\fIfilename\fP or \-\-log-file=\fIfilename\fP" Causes .I less to copy its input to the named file as it is being viewed. This applies only when the input file is a pipe, not an ordinary file. If the file already exists, .I less will ask for confirmation before overwriting it. .IP "\-O\fIfilename\fP or \-\-LOG-FILE=\fIfilename\fP" The \-O option is like \-o, but it will overwrite an existing file without asking for confirmation. .sp If no log file has been specified, the \-o and \-O options can be used from within .I less to specify a log file. Without a file name, they will simply report the name of the log file. The "s" command is equivalent to specifying \-o from within .I less. .IP "\-p\fIpattern\fP or \-\-pattern=\fIpattern\fP" The \-p option on the command line is equivalent to specifying +/\fIpattern\fP; that is, it tells .I less to start at the first occurrence of \fIpattern\fP in the file. .IP "\-P\fIprompt\fP or \-\-prompt=\fIprompt\fP" Provides a way to tailor the three prompt styles to your own preference. This option would normally be put in the LESS environment variable, rather than being typed in with each .I less command. Such an option must either be the last option in the LESS variable, or be terminated by a dollar sign. -Ps followed by a string changes the default (short) prompt to that string. -Pm changes the medium (\-m) prompt. -PM changes the long (\-M) prompt. -Ph changes the prompt for the help screen. -P= changes the message printed by the = command. -Pw changes the message printed while waiting for data (in the F command). All prompt strings consist of a sequence of letters and special escape sequences. See the section on PROMPTS for more details. .IP "\-q or \-\-quiet or \-\-silent" Causes moderately "quiet" operation: the terminal bell is not rung if an attempt is made to scroll past the end of the file or before the beginning of the file. If the terminal has a "visual bell", it is used instead. The bell will be rung on certain other errors, such as typing an invalid character. The default is to ring the terminal bell in all such cases. .IP "\-Q or \-\-QUIET or \-\-SILENT" Causes totally "quiet" operation: the terminal bell is never rung. .IP "\-r or \-\-raw-control-chars" Causes "raw" control characters to be displayed. The default is to display control characters using the caret notation; for example, a control-A (octal 001) is displayed as "^A". Warning: when the \-r option is used, .I less cannot keep track of the actual appearance of the screen (since this depends on how the screen responds to each type of control character). Thus, various display problems may result, such as long lines being split in the wrong place. .IP "\-R or \-\-RAW-CONTROL-CHARS" Like \-r, but only ANSI "color" escape sequences are output in "raw" form. Unlike \-r, the screen appearance is maintained correctly in most cases. ANSI "color" escape sequences are sequences of the form: .sp ESC [ ... m .sp where the "..." is zero or more color specification characters For the purpose of keeping track of screen appearance, ANSI color escape sequences are assumed to not move the cursor. You can make .I less think that characters other than "m" can end ANSI color escape sequences by setting the environment variable LESSANSIENDCHARS to the list of characters which can end a color escape sequence. And you can make .I less think that characters other than the standard ones may appear between the ESC and the m by setting the environment variable LESSANSIMIDCHARS to the list of characters which can appear. .IP "\-s or \-\-squeeze-blank-lines" Causes consecutive blank lines to be squeezed into a single blank line. This is useful when viewing .I nroff output. .IP "\-S or \-\-chop-long-lines" Causes lines longer than the screen width to be chopped rather than folded. That is, the portion of a long line that does not fit in the screen width is not shown. The default is to fold long lines; that is, display the remainder on the next line. .IP "\-t\fItag\fP or \-\-tag=\fItag\fP" The \-t option, followed immediately by a TAG, will edit the file containing that tag. For this to work, tag information must be available; for example, there may be a file in the current directory called "tags", which was previously built by .I ctags (1) or an equivalent command. If the environment variable LESSGLOBALTAGS is set, it is taken to be the name of a command compatible with .I global (1), and that command is executed to find the tag. (See http://www.gnu.org/software/global/global.html). The \-t option may also be specified from within .I less (using the \- command) as a way of examining a new file. The command ":t" is equivalent to specifying \-t from within .I less. .IP "\-T\fItagsfile\fP or \-\-tag-file=\fItagsfile\fP" Specifies a tags file to be used instead of "tags". .IP "\-u or \-\-underline-special" Causes backspaces and carriage returns to be treated as printable characters; that is, they are sent to the terminal when they appear in the input. .IP "\-U or \-\-UNDERLINE-SPECIAL" Causes backspaces, tabs and carriage returns to be treated as control characters; that is, they are handled as specified by the \-r option. .sp By default, if neither \-u nor \-U is given, backspaces which appear adjacent to an underscore character are treated specially: the underlined text is displayed using the terminal's hardware underlining capability. Also, backspaces which appear between two identical characters are treated specially: the overstruck text is printed using the terminal's hardware boldface capability. Other backspaces are deleted, along with the preceding character. Carriage returns immediately followed by a newline are deleted. other carriage returns are handled as specified by the \-r option. Text which is overstruck or underlined can be searched for if neither \-u nor \-U is in effect. .IP "\-V or \-\-version" Displays the version number of .I less. .IP "\-w or \-\-hilite-unread" Temporarily highlights the first "new" line after a forward movement of a full page. The first "new" line is the line immediately following the line previously at the bottom of the screen. Also highlights the target line after a g or p command. The highlight is removed at the next command which causes movement. The entire line is highlighted, unless the \-J option is in effect, in which case only the status column is highlighted. .IP "\-W or \-\-HILITE-UNREAD" Like \-w, but temporarily highlights the first new line after any forward movement command larger than one line. .IP "\-x\fIn\fP,... or \-\-tabs=\fIn\fP,..." Sets tab stops. If only one \fIn\fP is specified, tab stops are set at multiples of \fIn\fP. If multiple values separated by commas are specified, tab stops are set at those positions, and then continue with the same spacing as the last two. For example, \fI-x9,17\fP will set tabs at positions 9, 17, 25, 33, etc. The default for \fIn\fP is 8. .IP "\-X or \-\-no-init" Disables sending the termcap initialization and deinitialization strings to the terminal. This is sometimes desirable if the deinitialization string does something unnecessary, like clearing the screen. .IP "\-y\fIn\fP or \-\-max-forw-scroll=\fIn\fP" Specifies a maximum number of lines to scroll forward. If it is necessary to scroll forward more than \fIn\fP lines, the screen is repainted instead. The \-c or \-C option may be used to repaint from the top of the screen if desired. By default, any forward movement causes scrolling. .IP "\-[z]\fIn\fP or \-\-window=\fIn\fP" Changes the default scrolling window size to \fIn\fP lines. The default is one screenful. The z and w commands can also be used to change the window size. The "z" may be omitted for compatibility with some versions of .I more. If the number .I n is negative, it indicates .I n lines less than the current screen size. For example, if the screen is 24 lines, \fI\-z-4\fP sets the scrolling window to 20 lines. If the screen is resized to 40 lines, the scrolling window automatically changes to 36 lines. .IP "\-\fI\(dqcc\fP\ or\ \-\-quotes=\fIcc\fP" Changes the filename quoting character. This may be necessary if you are trying to name a file which contains both spaces and quote characters. Followed by a single character, this changes the quote character to that character. Filenames containing a space should then be surrounded by that character rather than by double quotes. Followed by two characters, changes the open quote to the first character, and the close quote to the second character. Filenames containing a space should then be preceded by the open quote character and followed by the close quote character. Note that even after the quote characters are changed, this option remains \-" (a dash followed by a double quote). .IP "\-~ or \-\-tilde" Normally lines after end of file are displayed as a single tilde (~). This option causes lines after end of file to be displayed as blank lines. .IP "\-# or \-\-shift" Specifies the default number of positions to scroll horizontally in the RIGHTARROW and LEFTARROW commands. If the number specified is zero, it sets the default number of positions to one half of the screen width. Alternately, the number may be specified as a fraction of the width of the screen, starting with a decimal point: .5 is half of the screen width, .3 is three tenths of the screen width, and so on. If the number is specified as a fraction, the actual number of scroll positions is recalculated if the terminal window is resized, so that the actual scroll remains at the specified fraction of the screen width. .IP "\-\-no-keypad" Disables sending the keypad initialization and deinitialization strings to the terminal. This is sometimes useful if the keypad strings make the numeric keypad behave in an undesirable manner. .IP "\-\-follow-name" Normally, if the input file is renamed while an F command is executing, .I less will continue to display the contents of the original file despite its name change. If \-\-follow-name is specified, during an F command .I less will periodically attempt to reopen the file by name. If the reopen succeeds and the file is a different file from the original (which means that a new file has been created with the same name as the original (now renamed) file), .I less will display the contents of that new file. .IP \-\- A command line argument of "\-\-" marks the end of option arguments. Any arguments following this are interpreted as filenames. This can be useful when viewing a file whose name begins with a "\-" or "+". .IP + If a command line option begins with \fB+\fP, the remainder of that option is taken to be an initial command to .I less. For example, +G tells .I less to start at the end of the file rather than the beginning, and +/xyz tells it to start at the first occurrence of "xyz" in the file. As a special case, + acts like +g; that is, it starts the display at the specified line number (however, see the caveat under the "g" command above). If the option starts with ++, the initial command applies to every file being viewed, not just the first one. The + command described previously may also be used to set (or change) an initial command for every file. .SH "LINE EDITING" When entering command line at the bottom of the screen (for example, a filename for the :e command, or the pattern for a search command), certain keys can be used to manipulate the command line. Most commands have an alternate form in [ brackets ] which can be used if a key does not exist on a particular keyboard. (Note that the forms beginning with ESC do not work in some MS-DOS and Windows systems because ESC is the line erase character.) Any of these special keys may be entered literally by preceding it with the "literal" character, either ^V or ^A. A backslash itself may also be entered literally by entering two backslashes. .IP "LEFTARROW [ ESC-h ]" Move the cursor one space to the left. .IP "RIGHTARROW [ ESC-l ]" Move the cursor one space to the right. .IP "^LEFTARROW [ ESC-b or ESC-LEFTARROW ]" (That is, CONTROL and LEFTARROW simultaneously.) Move the cursor one word to the left. .IP "^RIGHTARROW [ ESC-w or ESC-RIGHTARROW ]" (That is, CONTROL and RIGHTARROW simultaneously.) Move the cursor one word to the right. .IP "HOME [ ESC-0 ]" Move the cursor to the beginning of the line. .IP "END [ ESC-$ ]" Move the cursor to the end of the line. .IP "BACKSPACE" Delete the character to the left of the cursor, or cancel the command if the command line is empty. .IP "DELETE or [ ESC-x ]" Delete the character under the cursor. .IP "^BACKSPACE [ ESC-BACKSPACE ]" (That is, CONTROL and BACKSPACE simultaneously.) Delete the word to the left of the cursor. .IP "^DELETE [ ESC-X or ESC-DELETE ]" (That is, CONTROL and DELETE simultaneously.) Delete the word under the cursor. .IP "UPARROW [ ESC-k ]" Retrieve the previous command line. .IP "DOWNARROW [ ESC-j ]" Retrieve the next command line. .IP "TAB" Complete the partial filename to the left of the cursor. If it matches more than one filename, the first match is entered into the command line. Repeated TABs will cycle thru the other matching filenames. If the completed filename is a directory, a "/" is appended to the filename. (On MS-DOS systems, a "\e" is appended.) The environment variable LESSSEPARATOR can be used to specify a different character to append to a directory name. .IP "BACKTAB [ ESC-TAB ]" Like, TAB, but cycles in the reverse direction thru the matching filenames. .IP "^L" Complete the partial filename to the left of the cursor. If it matches more than one filename, all matches are entered into the command line (if they fit). .IP "^U (Unix and OS/2) or ESC (MS-DOS)" Delete the entire command line, or cancel the command if the command line is empty. If you have changed your line-kill character in Unix to something other than ^U, that character is used instead of ^U. .SH "KEY BINDINGS" You may define your own .I less commands by using the program .I lesskey (1) to create a lesskey file. This file specifies a set of command keys and an action associated with each key. You may also use .I lesskey to change the line-editing keys (see LINE EDITING), and to set environment variables. If the environment variable LESSKEY is set, .I less uses that as the name of the lesskey file. Otherwise, .I less looks in a standard place for the lesskey file: On Unix systems, .I less looks for a lesskey file called "$HOME/.less". On MS-DOS and Windows systems, .I less looks for a lesskey file called "$HOME/_less", and if it is not found there, then looks for a lesskey file called "_less" in any directory specified in the PATH environment variable. On OS/2 systems, .I less looks for a lesskey file called "$HOME/less.ini", and if it is not found, then looks for a lesskey file called "less.ini" in any directory specified in the INIT environment variable, and if it not found there, then looks for a lesskey file called "less.ini" in any directory specified in the PATH environment variable. See the .I lesskey manual page for more details. .P A system-wide lesskey file may also be set up to provide key bindings. If a key is defined in both a local lesskey file and in the system-wide file, key bindings in the local file take precedence over those in the system-wide file. If the environment variable LESSKEY_SYSTEM is set, .I less uses that as the name of the system-wide lesskey file. Otherwise, .I less looks in a standard place for the system-wide lesskey file: On Unix systems, the system-wide lesskey file is /usr/local/etc/sysless. (However, if .I less was built with a different sysconf directory than /usr/local/etc, that directory is where the sysless file is found.) On MS-DOS and Windows systems, the system-wide lesskey file is c:\e_sysless. On OS/2 systems, the system-wide lesskey file is c:\esysless.ini. .SH "INPUT PREPROCESSOR" You may define an "input preprocessor" for .I less. Before .I less opens a file, it first gives your input preprocessor a chance to modify the way the contents of the file are displayed. An input preprocessor is simply an executable program (or shell script), which writes the contents of the file to a different file, called the replacement file. The contents of the replacement file are then displayed in place of the contents of the original file. However, it will appear to the user as if the original file is opened; that is, .I less will display the original filename as the name of the current file. .PP An input preprocessor receives one command line argument, the original filename, as entered by the user. It should create the replacement file, and when finished, print the name of the replacement file to its standard output. If the input preprocessor does not output a replacement filename, .I less uses the original file, as normal. The input preprocessor is not called when viewing standard input. To set up an input preprocessor, set the LESSOPEN environment variable to a command line which will invoke your input preprocessor. This command line should include one occurrence of the string "%s", which will be replaced by the filename when the input preprocessor command is invoked. .PP When .I less closes a file opened in such a way, it will call another program, called the input postprocessor, which may perform any desired clean-up action (such as deleting the replacement file created by LESSOPEN). This program receives two command line arguments, the original filename as entered by the user, and the name of the replacement file. To set up an input postprocessor, set the LESSCLOSE environment variable to a command line which will invoke your input postprocessor. It may include two occurrences of the string "%s"; the first is replaced with the original name of the file and the second with the name of the replacement file, which was output by LESSOPEN. .PP For example, on many Unix systems, these two scripts will allow you to keep files in compressed format, but still let .I less view them directly: .PP lessopen.sh: .br #! /bin/sh .br case "$1" in .br *.Z) uncompress -\c $1 >/tmp/less.$$ 2>/dev/null .br if [ \-s /tmp/less.$$ ]; then .br echo /tmp/less.$$ .br else .br rm \-f /tmp/less.$$ .br fi .br ;; .br esac .PP lessclose.sh: .br #! /bin/sh .br rm $2 .PP To use these scripts, put them both where they can be executed and set LESSOPEN="lessopen.sh\ %s", and LESSCLOSE="lessclose.sh\ %s\ %s". More complex LESSOPEN and LESSCLOSE scripts may be written to accept other types of compressed files, and so on. .PP It is also possible to set up an input preprocessor to pipe the file data directly to .I less, rather than putting the data into a replacement file. This avoids the need to decompress the entire file before starting to view it. An input preprocessor that works this way is called an input pipe. An input pipe, instead of writing the name of a replacement file on its standard output, writes the entire contents of the replacement file on its standard output. If the input pipe does not write any characters on its standard output, then there is no replacement file and .I less uses the original file, as normal. To use an input pipe, make the first character in the LESSOPEN environment variable a vertical bar (|) to signify that the input preprocessor is an input pipe. .PP For example, on many Unix systems, this script will work like the previous example scripts: .PP lesspipe.sh: .br #! /bin/sh .br case "$1" in .br *.Z) uncompress \-c $1 2>/dev/null .br ;; .br esac .br .PP To use this script, put it where it can be executed and set LESSOPEN="|lesspipe.sh %s". When an input pipe is used, a LESSCLOSE postprocessor can be used, but it is usually not necessary since there is no replacement file to clean up. In this case, the replacement file name passed to the LESSCLOSE postprocessor is "\-". .PP For compatibility with previous versions of .I less, the input preprocessor or pipe is not used if .I less is viewing standard input. However, if the first character of LESSOPEN is a dash (\-), the input preprocessor is used on standard input as well as other files. In this case, the dash is not considered to be part of the preprocessor command. If standard input is being viewed, the input preprocessor is passed a file name consisting of a single dash. Similarly, if the first two characters of LESSOPEN are vertical bar and dash (|\-), the input pipe is used on standard input as well as other files. Again, in this case the dash is not considered to be part of the input pipe command. .SH "NATIONAL CHARACTER SETS" There are three types of characters in the input file: .IP "normal characters" can be displayed directly to the screen. .IP "control characters" should not be displayed directly, but are expected to be found in ordinary text files (such as backspace and tab). .IP "binary characters" should not be displayed directly and are not expected to be found in text files. .PP A "character set" is simply a description of which characters are to be considered normal, control, and binary. The LESSCHARSET environment variable may be used to select a character set. Possible values for LESSCHARSET are: .IP ascii BS, TAB, NL, CR, and formfeed are control characters, all chars with values between 32 and 126 are normal, and all others are binary. .IP iso8859 Selects an ISO 8859 character set. This is the same as ASCII, except characters between 160 and 255 are treated as normal characters. .IP latin1 Same as iso8859. .IP latin9 Same as iso8859. .IP dos Selects a character set appropriate for MS-DOS. .IP ebcdic Selects an EBCDIC character set. .IP IBM-1047 Selects an EBCDIC character set used by OS/390 Unix Services. This is the EBCDIC analogue of latin1. You get similar results by setting either LESSCHARSET=IBM-1047 or LC_CTYPE=en_US in your environment. .IP koi8-r Selects a Russian character set. .IP next Selects a character set appropriate for NeXT computers. .IP utf-8 Selects the UTF-8 encoding of the ISO 10646 character set. UTF-8 is special in that it supports multi-byte characters in the input file. It is the only character set that supports multi-byte characters. .IP windows Selects a character set appropriate for Microsoft Windows (cp 1251). .PP In rare cases, it may be desired to tailor .I less to use a character set other than the ones definable by LESSCHARSET. In this case, the environment variable LESSCHARDEF can be used to define a character set. It should be set to a string where each character in the string represents one character in the character set. The character "." is used for a normal character, "c" for control, and "b" for binary. A decimal number may be used for repetition. For example, "bccc4b." would mean character 0 is binary, 1, 2 and 3 are control, 4, 5, 6 and 7 are binary, and 8 is normal. All characters after the last are taken to be the same as the last, so characters 9 through 255 would be normal. (This is an example, and does not necessarily represent any real character set.) .PP This table shows the value of LESSCHARDEF which is equivalent to each of the possible values for LESSCHARSET: .sp ascii\ 8bcccbcc18b95.b .br dos\ \ \ 8bcccbcc12bc5b95.b. .br ebcdic 5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b .br \ \ \ \ \ \ 9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b. .br IBM-1047 4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc .br \ \ \ \ \ \ 191.b .br iso8859 8bcccbcc18b95.33b. .br koi8-r 8bcccbcc18b95.b128. .br latin1 8bcccbcc18b95.33b. .br next\ \ 8bcccbcc18b95.bb125.bb .PP If neither LESSCHARSET nor LESSCHARDEF is set, but any of the strings "UTF-8", "UTF8", "utf-8" or "utf8" is found in the LC_ALL, LC_TYPE or LANG environment variables, then the default character set is utf-8. .PP If that string is not found, but your system supports the .I setlocale interface, .I less will use setlocale to determine the character set. setlocale is controlled by setting the LANG or LC_CTYPE environment variables. .PP Finally, if the .I setlocale interface is also not available, the default character set is latin1. .PP Control and binary characters are displayed in standout (reverse video). Each such character is displayed in caret notation if possible (e.g. ^A for control-A). Caret notation is used only if inverting the 0100 bit results in a normal printable character. Otherwise, the character is displayed as a hex number in angle brackets. This format can be changed by setting the LESSBINFMT environment variable. LESSBINFMT may begin with a "*" and one character to select the display attribute: "*k" is blinking, "*d" is bold, "*u" is underlined, "*s" is standout, and "*n" is normal. If LESSBINFMT does not begin with a "*", normal attribute is assumed. The remainder of LESSBINFMT is a string which may include one printf-style escape sequence (a % followed by x, X, o, d, etc.). For example, if LESSBINFMT is "*u[%x]", binary characters are displayed in underlined hexadecimal surrounded by brackets. The default if no LESSBINFMT is specified is "*s<%X>". The default if no LESSBINFMT is specified is "*s<%02X>". Warning: the result of expanding the character via LESSBINFMT must be less than 31 characters. .PP When the character set is utf-8, the LESSUTFBINFMT environment variable acts similarly to LESSBINFMT but it applies to Unicode code points that were successfully decoded but are unsuitable for display (e.g., unassigned code points). Its default value is "". Note that LESSUTFBINFMT and LESSBINFMT share their display attribute setting ("*x") so specifying one will affect both; LESSUTFBINFMT is read after LESSBINFMT so its setting, if any, will have priority. Problematic octets in a UTF-8 file (octets of a truncated sequence, octets of a complete but non-shortest form sequence, illegal octets, and stray trailing octets) are displayed individually using LESSBINFMT so as to facilitate diagnostic of how the UTF-8 file is ill-formed. .SH "PROMPTS" The \-P option allows you to tailor the prompt to your preference. The string given to the \-P option replaces the specified prompt string. Certain characters in the string are interpreted specially. The prompt mechanism is rather complicated to provide flexibility, but the ordinary user need not understand the details of constructing personalized prompt strings. .sp A percent sign followed by a single character is expanded according to what the following character is: .IP "%b\fIX\fP" Replaced by the byte offset into the current input file. The b is followed by a single character (shown as \fIX\fP above) which specifies the line whose byte offset is to be used. If the character is a "t", the byte offset of the top line in the display is used, an "m" means use the middle line, a "b" means use the bottom line, a "B" means use the line just after the bottom line, and a "j" means use the "target" line, as specified by the \-j option. .IP "%B" Replaced by the size of the current input file. .IP "%c" Replaced by the column number of the text appearing in the first column of the screen. .IP "%d\fIX\fP" Replaced by the page number of a line in the input file. The line to be used is determined by the \fIX\fP, as with the %b option. .IP "%D" Replaced by the number of pages in the input file, or equivalently, the page number of the last line in the input file. .IP "%E" Replaced by the name of the editor (from the VISUAL environment variable, or the EDITOR environment variable if VISUAL is not defined). See the discussion of the LESSEDIT feature below. .IP "%f" Replaced by the name of the current input file. .IP "%i" Replaced by the index of the current file in the list of input files. .IP "%l\fIX\fP" Replaced by the line number of a line in the input file. The line to be used is determined by the \fIX\fP, as with the %b option. .IP "%L" Replaced by the line number of the last line in the input file. .IP "%m" Replaced by the total number of input files. .IP "%p\fIX\fP" Replaced by the percent into the current input file, based on byte offsets. The line used is determined by the \fIX\fP as with the %b option. .IP "%P\fIX\fP" Replaced by the percent into the current input file, based on line numbers. The line used is determined by the \fIX\fP as with the %b option. .IP "%s" Same as %B. .IP "%t" Causes any trailing spaces to be removed. Usually used at the end of the string, but may appear anywhere. .IP "%x" Replaced by the name of the next input file in the list. .PP If any item is unknown (for example, the file size if input is a pipe), a question mark is printed instead. .PP The format of the prompt string can be changed depending on certain conditions. A question mark followed by a single character acts like an "IF": depending on the following character, a condition is evaluated. If the condition is true, any characters following the question mark and condition character, up to a period, are included in the prompt. If the condition is false, such characters are not included. A colon appearing between the question mark and the period can be used to establish an "ELSE": any characters between the colon and the period are included in the string if and only if the IF condition is false. Condition characters (which follow a question mark) may be: .IP "?a" True if any characters have been included in the prompt so far. .IP "?b\fIX\fP" True if the byte offset of the specified line is known. .IP "?B" True if the size of current input file is known. .IP "?c" True if the text is horizontally shifted (%c is not zero). .IP "?d\fIX\fP" True if the page number of the specified line is known. .IP "?e" True if at end-of-file. .IP "?f" True if there is an input filename (that is, if input is not a pipe). .IP "?l\fIX\fP" True if the line number of the specified line is known. .IP "?L" True if the line number of the last line in the file is known. .IP "?m" True if there is more than one input file. .IP "?n" True if this is the first prompt in a new input file. .IP "?p\fIX\fP" True if the percent into the current input file, based on byte offsets, of the specified line is known. .IP "?P\fIX\fP" True if the percent into the current input file, based on line numbers, of the specified line is known. .IP "?s" Same as "?B". .IP "?x" True if there is a next input file (that is, if the current input file is not the last one). .PP Any characters other than the special ones (question mark, colon, period, percent, and backslash) become literally part of the prompt. Any of the special characters may be included in the prompt literally by preceding it with a backslash. .PP Some examples: .sp ?f%f:Standard input. .sp This prompt prints the filename, if known; otherwise the string "Standard input". .sp ?f%f .?ltLine %lt:?pt%pt\e%:?btByte %bt:-... .sp This prompt would print the filename, if known. The filename is followed by the line number, if known, otherwise the percent if known, otherwise the byte offset if known. Otherwise, a dash is printed. Notice how each question mark has a matching period, and how the % after the %pt is included literally by escaping it with a backslash. .sp ?n?f%f\ .?m(file\ %i\ of\ %m)\ ..?e(END)\ ?x-\ Next\e:\ %x..%t .sp This prints the filename if this is the first prompt in a file, followed by the "file N of N" message if there is more than one input file. Then, if we are at end-of-file, the string "(END)" is printed followed by the name of the next file, if there is one. Finally, any trailing spaces are truncated. This is the default prompt. For reference, here are the defaults for the other two prompts (\-m and \-M respectively). Each is broken into two lines here for readability only. .nf .sp ?n?f%f\ .?m(file\ %i\ of\ %m)\ ..?e(END)\ ?x-\ Next\e:\ %x.: ?pB%pB\e%:byte\ %bB?s/%s...%t .sp ?f%f\ .?n?m(file\ %i\ of\ %m)\ ..?ltlines\ %lt-%lb?L/%L.\ : byte\ %bB?s/%s.\ .?e(END)\ ?x-\ Next\e:\ %x.:?pB%pB\e%..%t .sp .fi And here is the default message produced by the = command: .nf .sp ?f%f\ .?m(file\ %i\ of\ %m)\ .?ltlines\ %lt-%lb?L/%L.\ . byte\ %bB?s/%s.\ ?e(END)\ :?pB%pB\e%..%t .fi .PP The prompt expansion features are also used for another purpose: if an environment variable LESSEDIT is defined, it is used as the command to be executed when the v command is invoked. The LESSEDIT string is expanded in the same way as the prompt strings. The default value for LESSEDIT is: .nf .sp %E\ ?lm+%lm.\ %f .sp .fi Note that this expands to the editor name, followed by a + and the line number, followed by the file name. If your editor does not accept the "+linenumber" syntax, or has other differences in invocation syntax, the LESSEDIT variable can be changed to modify this default. .SH SECURITY When the environment variable LESSSECURE is set to 1, .I less runs in a "secure" mode. This means these features are disabled: .RS .IP "!" the shell command .IP "|" the pipe command .IP ":e" the examine command. .IP "v" the editing command .IP "s \-o" log files .IP "\-k" use of lesskey files .IP "\-t" use of tags files .IP " " metacharacters in filenames, such as * .IP " " filename completion (TAB, ^L) .RE .PP Less can also be compiled to be permanently in "secure" mode. .SH "COMPATIBILITY WITH MORE" If the environment variable LESS_IS_MORE is set to 1, or if the program is invoked via a file link named "more", .I less behaves (mostly) in conformance with the POSIX "more" command specification. In this mode, less behaves differently in these ways: .PP The \-e option works differently. If the \-e option is not set, .I less behaves as if the \-E option were set. If the \-e option is set, .I less behaves as if the \-e and \-F options were set. .PP The \-m option works differently. If the \-m option is not set, the medium prompt is used, and it is prefixed with the string "--More--". If the \-m option is set, the short prompt is used. .PP The \-n option acts like the \-z option. The normal behavior of the \-n option is unavailable in this mode. .PP The parameter to the \-p option is taken to be a .I less command rather than a search pattern. .PP The LESS environment variable is ignored, and the MORE environment variable is used in its place. .SH "ENVIRONMENT VARIABLES" Environment variables may be specified either in the system environment as usual, or in a .I lesskey (1) file. If environment variables are defined in more than one place, variables defined in a local lesskey file take precedence over variables defined in the system environment, which take precedence over variables defined in the system-wide lesskey file. .IP COLUMNS Sets the number of columns on the screen. Takes precedence over the number of columns specified by the TERM variable. (But if you have a windowing system which supports TIOCGWINSZ or WIOCGETD, the window system's idea of the screen size takes precedence over the LINES and COLUMNS environment variables.) .IP EDITOR The name of the editor (used for the v command). .IP HOME Name of the user's home directory (used to find a lesskey file on Unix and OS/2 systems). .IP "HOMEDRIVE, HOMEPATH" Concatenation of the HOMEDRIVE and HOMEPATH environment variables is the name of the user's home directory if the HOME variable is not set (only in the Windows version). .IP INIT Name of the user's init directory (used to find a lesskey file on OS/2 systems). .IP LANG Language for determining the character set. .IP LC_CTYPE Language for determining the character set. .IP LESS Options which are passed to .I less automatically. .IP LESSANSIENDCHARS Characters which may end an ANSI color escape sequence (default "m"). .IP LESSANSIMIDCHARS Characters which may appear between the ESC character and the end character in an ANSI color escape sequence (default "0123456789;[?!"'#%()*+\ ". .IP LESSBINFMT Format for displaying non-printable, non-control characters. .IP LESSCHARDEF Defines a character set. .IP LESSCHARSET Selects a predefined character set. .IP LESSCLOSE Command line to invoke the (optional) input-postprocessor. .IP LESSECHO Name of the lessecho program (default "lessecho"). The lessecho program is needed to expand metacharacters, such as * and ?, in filenames on Unix systems. .IP LESSEDIT Editor prototype string (used for the v command). See discussion under PROMPTS. .IP LESSGLOBALTAGS Name of the command used by the \-t option to find global tags. Normally should be set to "global" if your system has the .I global (1) command. If not set, global tags are not used. .IP LESSHISTFILE Name of the history file used to remember search commands and shell commands between invocations of .I less. If set to "\-" or "/dev/null", a history file is not used. The default is "$HOME/.lesshst" on Unix systems, "$HOME/_lesshst" on DOS and Windows systems, or "$HOME/lesshst.ini" or "$INIT/lesshst.ini" on OS/2 systems. .IP LESSHISTSIZE The maximum number of commands to save in the history file. The default is 100. .IP LESSKEY Name of the default lesskey(1) file. .IP LESSKEY_SYSTEM Name of the default system-wide lesskey(1) file. .IP LESSMETACHARS List of characters which are considered "metacharacters" by the shell. .IP LESSMETAESCAPE Prefix which less will add before each metacharacter in a command sent to the shell. If LESSMETAESCAPE is an empty string, commands containing metacharacters will not be passed to the shell. .IP LESSOPEN Command line to invoke the (optional) input-preprocessor. .IP LESSSECURE Runs less in "secure" mode. See discussion under SECURITY. .IP LESSSEPARATOR String to be appended to a directory name in filename completion. .IP LESSUTFBINFMT Format for displaying non-printable Unicode code points. .IP LESS_IS_MORE Emulate the .I more (1) command. .IP LINES Sets the number of lines on the screen. Takes precedence over the number of lines specified by the TERM variable. (But if you have a windowing system which supports TIOCGWINSZ or WIOCGETD, the window system's idea of the screen size takes precedence over the LINES and COLUMNS environment variables.) .IP PATH User's search path (used to find a lesskey file on MS-DOS and OS/2 systems). .IP SHELL The shell used to execute the ! command, as well as to expand filenames. .IP TERM The type of terminal on which .I less is being run. .IP VISUAL The name of the editor (used for the v command). .SH "SEE ALSO" lesskey(1) .SH COPYRIGHT Copyright (C) 1984-2009 Mark Nudelman .PP less is part of the GNU project and is free software. You can redistribute it and/or modify it under the terms of either (1) the GNU General Public License as published by the Free Software Foundation; or (2) the Less License. See the file README in the less distribution for more details regarding redistribution. You should have received a copy of the GNU General Public License along with the source for less; see the file COPYING. If not, write to the Free Software Foundation, 59 Temple Place, Suite 330, Boston, MA 02111-1307, USA. You should also have received a copy of the Less License; see the file LICENSE. .PP less is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. .SH AUTHOR .PP Mark Nudelman .br See http://www.greenwoodsoftware.com/less/bugs.html for the latest list of known bugs in less. .br Send bug reports or comments to the above address or to .br bug-less@gnu.org. .br For more information, see the less homepage at .br http://www.greenwoodsoftware.com/less. 070701000732f6000081a40000000000000000000000014cad6b3b00002598000000b500010002ffffffffffffffff0000002800000000root/usr/local/share/man/man1/lesskey.1.TH LESSKEY 1 "Version 436: 07 Jul 2009" .SH NAME lesskey \- specify key bindings for less .SH SYNOPSIS .B "lesskey [-o output] [--] [input]" .br .B "lesskey [--output=output] [--] [input]" .br .B "lesskey -V" .br .B "lesskey --version" .SH DESCRIPTION .I Lesskey is used to specify a set of key bindings to be used by .I less. The input file is a text file which describes the key bindings, If the input file is "-", standard input is read. If no input file is specified, a standard filename is used as the name of the input file, which depends on the system being used: On Unix systems, $HOME/.lesskey is used; on MS-DOS systems, $HOME/_lesskey is used; and on OS/2 systems $HOME/lesskey.ini is used, or $INIT/lesskey.ini if $HOME is undefined. The output file is a binary file which is used by .I less. If no output file is specified, and the environment variable LESSKEY is set, the value of LESSKEY is used as the name of the output file. Otherwise, a standard filename is used as the name of the output file, which depends on the system being used: On Unix and OS-9 systems, $HOME/.less is used; on MS-DOS systems, $HOME/_less is used; and on OS/2 systems, $HOME/less.ini is used, or $INIT/less.ini if $HOME is undefined. If the output file already exists, .I lesskey will overwrite it. .PP The -V or --version option causes .I lesskey to print its version number and immediately exit. If -V or --version is present, other options and arguments are ignored. .PP The input file consists of one or more .I sections. Each section starts with a line that identifies the type of section. Possible sections are: .IP #command Defines new command keys. .IP #line-edit Defines new line-editing keys. .IP #env Defines environment variables. .PP Blank lines and lines which start with a pound sign (#) are ignored, except for the special section header lines. .SH "COMMAND SECTION" The command section begins with the line .sp #command .sp If the command section is the first section in the file, this line may be omitted. The command section consists of lines of the form: .sp \fIstring\fP \fIaction\fP [extra-string] .sp Whitespace is any sequence of one or more spaces and/or tabs. The \fIstring\fP is the command key(s) which invoke the action. The \fIstring\fP may be a single command key, or a sequence of up to 15 keys. The \fIaction\fP is the name of the less action, from the list below. The characters in the \fIstring\fP may appear literally, or be prefixed by a caret to indicate a control key. A backslash followed by one to three octal digits may be used to specify a character by its octal value. A backslash followed by certain characters specifies input characters as follows: .IP \eb BACKSPACE .IP \ee ESCAPE .IP \en NEWLINE .IP \er RETURN .IP \et TAB .IP \eku UP ARROW .IP \ekd DOWN ARROW .IP \ekr RIGHT ARROW .IP \ekl LEFT ARROW .IP \ekU PAGE UP .IP \ekD PAGE DOWN .IP \ekh HOME .IP \eke END .IP \ekx DELETE .PP A backslash followed by any other character indicates that character is to be taken literally. Characters which must be preceded by backslash include caret, space, tab and the backslash itself. .PP An action may be followed by an "extra" string. When such a command is entered while running .I less, the action is performed, and then the extra string is parsed, just as if it were typed in to .I less. This feature can be used in certain cases to extend the functionality of a command. For example, see the "{" and ":t" commands in the example below. The extra string has a special meaning for the "quit" action: when .I less quits, first character of the extra string is used as its exit status. .SH EXAMPLE The following input file describes the set of default command keys used by less: .sp .nf #command \er forw-line \en forw-line e forw-line j forw-line \ekd forw-line ^E forw-line ^N forw-line k back-line y back-line ^Y back-line ^K back-line ^P back-line J forw-line-force K back-line-force Y back-line-force d forw-scroll ^D forw-scroll u back-scroll ^U back-scroll \e40 forw-screen f forw-screen ^F forw-screen ^V forw-screen \ekD forw-screen b back-screen ^B back-screen \eev back-screen \ekU back-screen z forw-window w back-window \ee\e40 forw-screen-force F forw-forever R repaint-flush r repaint ^R repaint ^L repaint \eeu undo-hilite g goto-line \ekh goto-line < goto-line \ee< goto-line p percent % percent \ee[ left-scroll \ee] right-scroll \ee( left-scroll \ee) right-scroll { forw-bracket {} } back-bracket {} ( forw-bracket () ) back-bracket () [ forw-bracket [] ] back-bracket [] \ee^F forw-bracket \ee^B back-bracket G goto-end \ee> goto-end > goto-end \eke goto-end = status ^G status :f status / forw-search ? back-search \ee/ forw-search * \ee? back-search * n repeat-search \een repeat-search-all N reverse-search \eeN reverse-search-all & filter m set-mark ' goto-mark ^X^X goto-mark E examine :e examine ^X^V examine :n next-file :p prev-file t next-tag T prev-tag :x index-file :d remove-file - toggle-option :t toggle-option t s toggle-option o _ display-option | pipe v visual ! shell + firstcmd H help h help V version 0 digit 1 digit 2 digit 3 digit 4 digit 5 digit 6 digit 7 digit 8 digit 9 digit q quit Q quit :q quit :Q quit ZZ quit .fi .sp .SH PRECEDENCE Commands specified by .I lesskey take precedence over the default commands. A default command key may be disabled by including it in the input file with the action "invalid". Alternatively, a key may be defined to do nothing by using the action "noaction". "noaction" is similar to "invalid", but .I less will give an error beep for an "invalid" command, but not for a "noaction" command. In addition, ALL default commands may be disabled by adding this control line to the input file: .sp #stop .sp This will cause all default commands to be ignored. The #stop line should be the last line in that section of the file. .PP Be aware that #stop can be dangerous. Since all default commands are disabled, you must provide sufficient commands before the #stop line to enable all necessary actions. For example, failure to provide a "quit" command can lead to frustration. .SH "LINE EDITING SECTION" The line-editing section begins with the line: .sp #line-edit .sp This section specifies new key bindings for the line editing commands, in a manner similar to the way key bindings for ordinary commands are specified in the #command section. The line-editing section consists of a list of keys and actions, one per line as in the example below. .SH EXAMPLE The following input file describes the set of default line-editing keys used by less: .sp .nf #line-edit \et forw-complete \e17 back-complete \ee\et back-complete ^L expand ^V literal ^A literal \eel right \ekr right \eeh left \ekl left \eeb word-left \ee\ekl word-left \eew word-right \ee\ekr word-right \eei insert \eex delete \ekx delete \eeX word-delete \eekx word-delete \ee\eb word-backspace \ee0 home \ekh home \ee$ end \eke end \eek up \eku up \eej down .fi .sp .SH "LESS ENVIRONMENT VARIABLES" The environment variable section begins with the line .sp #env .sp Following this line is a list of environment variable assignments. Each line consists of an environment variable name, an equals sign (=) and the value to be assigned to the environment variable. White space before and after the equals sign is ignored. Variables assigned in this way are visible only to .I less. If a variable is specified in the system environment and also in a lesskey file, the value in the lesskey file takes precedence. Although the lesskey file can be used to override variables set in the environment, the main purpose of assigning variables in the lesskey file is simply to have all .I less configuration information stored in one file. .SH EXAMPLE The following input file sets the -i option whenever .I less is run, and specifies the character set to be "latin1": .sp .nf #env LESS = -i LESSCHARSET = latin1 .fi .sp .SH "SEE ALSO" less(1) .SH WARNINGS It is not possible to specify special keys, such as uparrow, in a keyboard-independent manner. The only way to specify such keys is to specify the escape sequence which a particular keyboard sends when such a key is pressed. .PP On MS-DOS and OS/2 systems, certain keys send a sequence of characters which start with a NUL character (0). This NUL character should be represented as \e340 in a lesskey file. .SH COPYRIGHT Copyright (C) 2000-2009 Mark Nudelman .PP lesskey is part of the GNU project and is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2, or (at your option) any later version. .PP lesskey is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. .PP You should have received a copy of the GNU General Public License along with lesskey; see the file COPYING. If not, write to the Free Software Foundation, 59 Temple Place, Suite 330, Boston, MA 02111-1307, USA. .SH AUTHOR .PP Mark Nudelman .br Send bug reports or comments to the above address or to bug-less@gnu.org. 070701000732f5000081a40000000000000000000000014cad6b3b000004c9000000b500010002ffffffffffffffff0000002900000000root/usr/local/share/man/man1/lessecho.1.TH LESSECHO 1 "Version 436: 07 Jul 2009" .SH NAME lessecho \- expand metacharacters .SH SYNOPSIS .B lessecho .I "[-ox] [-cx] [-pn] [-dn] [-mx] [-nn] [-ex] [-a] file ..." .SH "DESCRIPTION" .I lessecho is a program that simply echos its arguments on standard output. But any argument containing spaces is enclosed in quotes. .SH OPTIONS A summary of options is included below. .TP .B \-ox Specifies "x" to be the open quote character. .TP .B \-cx Specifies "x" to be the close quote character. .TP .B \-pn Specifies "n" to be the open quote character, as an integer. .TP .B \-dn Specifies "n" to be the close quote character, as an integer. .TP .B \-mx Specifies "x" to be a metachar. .TP .B \-nn Specifies "n" to be a metachar, as an integer. .TP .B \-ex Specifies "x" to be the escape char for metachars. .TP .B \-fn Specifies "n" to be the escape char for metachars, as an integer. .TP .B \-a Specifies that all arguments are to be quoted. The default is that only arguments containing spaces are quoted. .SH "SEE ALSO" less(1) .SH AUTHOR This manual page was written by Thomas Schoepf , for the Debian GNU/Linux system (but may be used by others). .PP Send bug reports or comments to bug-less@gnu.org. 070701000732ed000041ed0000000000000000000000024cad6ba000000000000000b500010002ffffffffffffffff0000001300000000root/usr/local/bin070701000732ee000081ed0000000000000000000000014cad6b3b0007b85c000000b500010002ffffffffffffffff0000001800000000root/usr/local/bin/lessELFo4 4 ("!44oTTTT8$@VVV/usr/lib/ld.so.1  $%&(*./0234678:;<=>?@ACDEFHJKMNPRTUVWXZ\^`abcdfghikmnprstuvy{|~     #&(*+,./12345789:=@CEGHKMORUWY[]^_afgjknoqsuvyz{|}   "$&'()*,-1345679:<=@ACEFJMNQRSTUVX\]`befghikmnopqtuvwxyz}~ !"#')+,-159BGILOQSY[]_ejloqwxz} !"$%')-06;<>?ABDFIJLNPQSTVXZ\`bcdehilmprtwx~   !#%+./028;>?BDGHIKLOPWYZ[^_acdjlrs{|$ W Pl148tR0 ^ ip s}$ k`D 0 ; PV P j =| n0" - !  #AXx\AN g8p(A p$ n` v  ppȣ n y}3mR@0`po"x@1 m`p(xpmx  W+xF0@s Pt}h0r ~mPxD^ym`  #4 %w@kF PC XlWb| j x|}`l2P / x9s& GqR@wf pHw}wXg @ }  qܧ 1f9R}l0pP XlW!` $  o-n2=`WIд PJ ^xwylP/ x Dw~  `Pd V  * 8@Yr+ W62ThW+ Pm0l *   `M ) C 2 | 8 @R P/ _ (d 6L m p  y  8  W  l `7  r k } Q$  )  7 `M C Wr  w   T  n C w @ `q Q y 4 4pE `L pWZ pB m ` u    ;  PP 0n x ` 1M  k PI  W Lm4  A Vt I i P 0 W 4 i l u  } ~ m m m  p W hp pb R w B  Ğ8 I B  I mR R \ е g E o lt W T $  '   p w }.6" X bH @dpYwu`wWp Њ/ 0o57 W  $ n4'PN # X1z >W GkP}p pD @ Vt np  Hx 7 T lp x?ԣ \d@F x4lw@mH `r b ` @0 xp ol o@ȪLwg ro yЪv xo- Wh+lH ̪Q w,"y<wW\q}}  w   0m`. x\PC '2u> 7` B0B \wx B 0P  j " hI l(P . pkl nx<}V@N atypB& @ xd t - F m@ x}P~  PnD27P0s Vq0n<a  p q)` YWH @'D W }&0xA"0 O,8 ZPd c0| m`Y yn~0) xW! hx@kP> p p%,W-`. <EЛ Q06 XԪ- ` sm{ ow4mpvH H1;m xW.p98v OnW5 ^hepw}% Ю  0 0  kW0C P7 "# ,wHP $ Tp< YXnoF `N U Y  Pko@}m}`x/HyMتUl]$ g# rdW kp  pC HP5 kC  н W:}T x ] hLs  8W To}x8 p1 $1 *`o08xLwhplnxu% { a }0k`> 3 n }0 { 1 & p F < a `m8! % + o3Y;\lW ]w) y!tl~ZV pV  #  $ IЛ/ `kܪj  + qx m  Yp{ %ا+ k4 ?$ _s i xw ` }PwPx@xPM E N @ox  mvS  !)(3:~ Y@l_hx~Pm@^ ] WPI E O M wPodpn <0   @ , `>T K< @nC y0 J 8A ke (Ī B px  2 \ } }  ! !w;!xWG!Ph R!`!v m0 m!l!Z@!tp!y ! cd !o ^ }!o"/ *"}H"mR"PAX _" g""0Q "$""n"T"("# "|p"p "0B= ## u #< )#P$ 3#wO#`nS# x;0+ n#lt#Pq #`e #Q E #ж #l #Xw#к #L# #9 ##  m#$xx'$6$ yX$ln ^$f k$,$̞($0$A $4$0$l %}  %P} (%HmB%z O%kl%` y%x%q%Ly(%hwx0 forw_promptstep_char_xmknod.XAKgoyL6sWrMk2N.s_proto.XAKgoyL5sWrMEeN.fractioninit_promptclr_filterpipe_data.XAKgoyL5sWrMUXN.sc_u_outedit_firsttcsetattrbinary_charcat_fileprevtagpr_expand__fpstartch_seekbackward__filbufedit_prevchg_caselesspercent_posbo_e_width__ctype.XAKgoyL5sWrM0hN.curr_altpipe.XAKgoyL6sWrM0wN.y_optnameprev_ifile.XAKgoyL6sWrMElN.anchorseekableshell_quote__flsbufclear_eolcleantagsclose_getchr.XAKgoyL6sWrMkpN.last_overstrike.XAKgoyL6sWrMU3N.search_infosigprocmaskdispversion.XAKgoyL5sWrMUXN.sc_lower_left.XAKgoyL5sWrMUcN.in_completionsize_helpdata_get_exit_frame_monitorwait_messageclosequote.XAKgoyL6sWrMElN.ifiles.XAKgoyL6sWrM0wN.T__optnamewscrollfclose.XAKgoyL6sWrM0wN.oldbot_optnameget_quit_at_eofsc_height.XAKgoyL5sWrM0ZN.ch_ungotchar.XAKgoyL6sWrM0wN.q_optnamedel_ifile.XAKgoyL5sWrMUXN.sc_padat_promptcmd_addhistfprintfknow_dumb.XAKgoyL6sWrM0yN.intr_to_abort.XAKgoyL5sWrMUbN.ubin_tabletwiddleiswupper.XAKgoyL5sWrMEeN.optflag.XAKgoyL5sWrMUcN.cpch_forw_getget_meta_escape.XAKgoyL6sWrM0wN.i_optnamefsyncget_wcharopenedhold_ifilech_tell.XAKgoyL6sWrMkpN.currquietprchar.XAKgoyL6sWrM0wN.follow_optname.XAKgoyL5sWrMUXN.sc_e_keypadlseek64.XAKgoyL6sWrMk2N.h_protocurr_ino.XAKgoyL6sWrM04N.curseqch_getflagssigs.XAKgoyL6sWrM0wN.S__optnameforw_raw_lineplusoptionjump_sline_fractionopt_quote.XAKgoyL6sWrM0wN.a_optname.XAKgoyL5sWrMUXN.sc_return.XAKgoyL6sWrMk2N.mp.XAKgoyL6sWrM0wN.n_optnamecharsetspositionintread.XAKgoyL5sWrMUXN.sc_backspaceless_is_moreignaw.XAKgoyL6sWrMk2N.M_proto.XAKgoyL6sWrMUvN.pendopt.XAKgoyL5sWrMUXN.sc_clear.XBKgoyL6sWrMkjN.forw.first_timeget_scrpos.XAKgoyL6sWrMUqN.loopcount__rem64_environ.XAKgoyL6sWrMkpN.overstrikecurrlineis_composing_charis_utf8_well_formedfd0.XAKgoyL6sWrM0yN.obufget_timebl_e_widthany_displaypostoainit_textlist.XAKgoyL6sWrM0wN.f_optnamenl_langinforepaintadd_lnumshift_count_fraction.XBKgoyL5sWrMUbN.prchar.bufcmd_charwerase_char.XAKgoyL6sWrM0sN.markstagsearchunmarkempty_screen.XAKgoyL6sWrMk2N.messageback_textlistautobuf.XAKgoyL6sWrMkpN.lmargin.XAKgoyL5sWrMUcN.cmd_colcalc_jump_sline__environ_lock.XAKgoyL6sWrMU3N.prep_startpos.XAKgoyL6sWrMk2N.e_protosave_curr_ifilebin_file.XAKgoyL5sWrMkgN.cmdtabletgotofcompletereedit_ifilecvt_alloc_chposset_open_fini.XAKgoyL5sWrMUcN.tk_tlistlglobis_ansi_endfilesizeuse_logfile.XAKgoyL6sWrMkpN.pendpostop_scrollch_closenamelogfileul_s_widthtgetenteof_displayed.XAKgoyL5sWrMUcN.cmdbufch_flushsprintf.XAKgoyL5sWrMUXN.sc_b_injump_locso_e_widtherrno_messageset_attnpos.XAKgoyL5sWrMUXN.init_done.XAKgoyL5sWrMUXN.sc_home.XAKgoyL5sWrMEeN.bottompos.XAKgoyL6sWrMkpN.pendc_etextpr_stringstrerrorset_filestateclr_linenumputbsch_initjump_line_loc.XAKgoyL6sWrM04N.taglistclose_altfileno_back_scroll.XAKgoyL5sWrMEeN.save_hshiftstart_attnpossingle_char_optionlesskeyinit_optionpercentageunsave_ifilejump_backtoggle_optionpopen.XAKgoyL6sWrM0wN.s_optnameadd_hometable.XAKgoyL6sWrMk2N.m_protoopt__Ostrcatopt__Pforce_logfile.XAKgoyL5sWrMEeN.ungotpinit_cmdhistprewindopt__Topt__Vuncompile_patterngetfractionlgetenvspecial_key_strfilenomlist_shellsetlocale.XAKgoyL6sWrMU3N.prep_endposch_length.XAKgoyL6sWrMkpN.attrinit_cmdscommands.XAKgoyL6sWrM0wN.k_optnameget_pos.XBKgoyL6sWrMUvN.propt.bufadjslinetgetnumtowlowerclear_botlinenumtoaeditregfreeis_combining_char.XAKgoyL5sWrMUcN.cmd_mbc_buf_indexis_ubin_charfindtagfexpandget_term__fsr_init_valuepr_type.XAKgoyL6sWrM0wN.P__optnamech_setbufspace.XAKgoyL5sWrMUXN.sc_bl_outreadingedit_next.XAKgoyL6sWrMkpN.linebuf.XAKgoyL6sWrM0wN.J__optname.XAKgoyL6sWrMU3N.hide_hilite.XAKgoyL6sWrM0wN.c_optnameend_logfilesquishedlsystemvbellabsbad_fileempty_linesgomark.XAKgoyL5sWrMUcN.literalsetjmp.XAKgoyL6sWrMUqN.sparejump_forwinit_signalsplinenumtgetflag.XAKgoyL5sWrMUXN.sc_visual_bell__1cG__CrunMdo_exit_code6F_v_pflushmbcpos_clear_DYNAMICprprotosigemptysetput_wchar.XAKgoyL6sWrM0wN.x_optname.XAKgoyL6sWrM04N.totalshell_coptioninit_linesize_linebuf.XAKgoyL6sWrMU3N.filter_anchor.XAKgoyL6sWrMU3N.filter_info.XAKgoyL5sWrMEeN.optgetname.XAKgoyL5sWrMUcN.tk_text__div64.XAKgoyL6sWrM0wN.O__optnamestrncpyeditornew_filech_beg_seekadd_forw_pos.XAKgoyL5sWrMUXN.sc_deinitungetccsync_logfilentabstops.XAKgoyL5sWrMkgN.edittablecalc_shift_count.XAKgoyL6sWrM0wN.p_optnameget_cmdbuf_startsqueezesprefix.XAKgoyL6sWrMU3N.hilite_anchor.XAKgoyL5sWrMkgN.list_ecmd_tables.XAKgoyL6sWrMkpN.end_ansi_charsset_mliststrchrback_lineforce_opentabstoppipe_mark.XAKgoyL6sWrM04N.circular.XAKgoyL6sWrM0wN.h_optname.XAKgoyL6sWrMUqN.startime.XAKgoyL5sWrMUXN.sc_bl_inml_searchcheck_winchforw_textlist.XBKgoyL6sWrM0sN.getmark.smstrncmpch_ungetchar.XAKgoyL6sWrM0wN.pound_optname.XAKgoyL5sWrMEeN.search_typeheld_ifilefinal_attrsavematch_brac.XAKgoyL6sWrMUqN.freelist.XAKgoyL6sWrM0wN.F__optnameput_lineget_indexjump_percentgettagtype_PROCEDURE_LINKAGE_TABLE_pappend.XAKgoyL6sWrMkpN.mid_ansi_charsadd_ecmd_tabletcgetattrcfgetospeedlongjmp.XBKgoyL6sWrM0yN.error.return_to_continue.XAKgoyL5sWrM0ZN.thisfilenext_ifile.XBKgoyL5sWrMUXN.get_term.sbufget_filenameclear_attn.XAKgoyL5sWrMEeN.ungotclr_hlistopen_getchrcmd_reseterrmsgsfchmodch_get.XAKgoyL5sWrMUXN.sc_s_keypadfind_posmemcpyfollow_mode.XAKgoyL6sWrMk2N.w_proto.XAKgoyL6sWrMkpN.mbc_bufgline.XAKgoyL6sWrM0wN.option.XAKgoyL5sWrMUcN.tk_originalopt_shift.XAKgoyL6sWrMU3N.is_ucase_pattern.XAKgoyL5sWrMEeN.pipecutf_modecs_aliasesno_inithomefile.XAKgoyL5sWrMUXN.attrmode.XAKgoyL5sWrMUXN.sc_init.XAKgoyL6sWrM0wN.u_optnameshell_unquoteul_e_widthlastmarkedit_listedit_indexireadcvt_length.XAKgoyL6sWrME1N.table.XBKgoyL5sWrM0ZN.end_logfile.triedis_wide_char.XAKgoyL5sWrMEeN.numberhprotostrcmpget_returneq_message.XAKgoyL5sWrMEeN.optchar___Argvadd_fcmd_tablequittingch_end_seekin_mcactldispquit_if_one_screenfstat64is_null_pattern.XAKgoyL5sWrMkgN.list_var_tables.XAKgoyL6sWrM0wN.m_optnamemlist_examineskipsp.XAKgoyL6sWrMk2N.more_protoeditchar.XAKgoyL6sWrM0yN.ob.XAKgoyL5sWrM0ZN.maxbufstabdefaultentire_file_displayedcreat64is_diroldbot.XAKgoyL6sWrM0wN.e_optnamebelow_mem.XAKgoyL5sWrMUXN.sc_b_outbadmarkprutfchar.XAKgoyL5sWrMUcN.cmd_offsetadd_linelinenumsml_shellch_back_getatexitml_examineedit_tagfilekill_charclear_cmd.XAKgoyL6sWrM0wN.L__optnamefcmd_decodemain.XAKgoyL5sWrMEeN.mcacurr_altfilenameopt_promptat_switchsetmarkstrcpyerase2_char.XAKgoyL5sWrMkgN.list_fcmd_tablesdohelp.XAKgoyL5sWrMUXN.sc_addlinestrstr.XAKgoyL5sWrMUXN.sc_move.XAKgoyL6sWrM0wN.z_optname.XAKgoyL5sWrMUXN.hardcopyget_swindowtgetstredit_lastchg_hiliteevery_first_cmd.XAKgoyL6sWrM04N.curtagcurr_devisattyline_leftcmd_intget_filestate.XAKgoyL5sWrMUcN.tk_trialpsignalsatoican_goto_lineforw_linematch_pattern.XBKgoyL5sWrMUXN.raw_mode.curr_on.XAKgoyL5sWrMUXN.sc_s_outraw_modeclr_hilite.XAKgoyL5sWrMUcN.cmd_mbc_bufset_status_col__longdouble_usedpos_init_GLOBAL_OFFSET_TABLE_regcomp.XAKgoyL5sWrMUXN.sc_s_in.XAKgoyL6sWrM0wN.r_optname.XAKgoyL6sWrMUqN.anchorcmd_acceptopt_bfgetc.XAKgoyL6sWrM0wN.V__optname.XAKgoyL6sWrM0wN.K__optnamewritewprotoopt_iopt_j.XAKgoyL5sWrMUXN.sc_eos_clearstrlenopt_kis_filteringopt_lscrsizemarkposopen_altfilecontrol_charopt_oopt_pbo_s_widthhow_searchputchrfgetssquish_checkopt_tregexecbinattr.XAKgoyL5sWrMUbN.wide_tableopt_x.XAKgoyL6sWrM0wN.j_optname__iob.XAKgoyL5sWrMUbN.utfbinfmtnexttagis_ascii_charinit_searchecmd_decodeecallocauto_wrapbs_modeat_exitcmd_putstrtagoptionsnprintf.XAKgoyL5sWrMUbN.binfmt__fsrerrnocurr_tagis_hilitedscan_option.XAKgoyL6sWrMkpN.is_null_lineinitial_scrposquit.XAKgoyL6sWrM0wN.b_optname.XAKgoyL6sWrM0wN.X__optname.XAKgoyL6sWrM0wN.w_optnameapply_at_specialsierrorgetpiduse_lessopen.XAKgoyL6sWrM0wN.keypad_optnamemlist_searchno_keypadsecure.XBKgoyL5sWrMUbN.prutfchar.buftputs.XAKgoyL6sWrM0wN.quote_optnamefopen64clear_bgpshift_allundo_searchmissing_capungetscinit_marksc_widthedit_stdin.XAKgoyL6sWrM0wN.o_optnamekillis_ttyneed_clrforward_lib_versionrepaint_hiliteget_back_scrollpclose_edata.XAKgoyL5sWrMUcN.tk_ipoint.XAKgoyL5sWrMUcN.cmd_mbc_buf_lenstore_pos.XAKgoyL6sWrM0wN.tilde_optnamecmd_lastpatternforw_scroll.XAKgoyL5sWrMUXN.costcount.XAKgoyL5sWrMUXN.sc_u_inat_enter.XAKgoyL6sWrMkpN.column.XAKgoyL6sWrM0wN.g_optnameend_attnposlen_cmdbufhilite_searchquit_on_intr.XAKgoyL5sWrMUcN.curr_mlist.XAKgoyL5sWrMUbN.comp_table.XAKgoyL6sWrMkpN.mbc_buf_lenfindoptis_ansi_middle.XBKgoyL5sWrM0iN.metachars.mchars.XAKgoyL5sWrMkgN.list_sysvar_tablesbl_s_width.XAKgoyL5sWrMUXN.sc_eol_clearopenquotegetoff_ifileutf_len.XAKgoyL6sWrMkpN.cshiftprep_hilitechopline.XAKgoyL6sWrME1N.table_sizesignalshow_attn.XAKgoyL6sWrMkpN.mbc_posreopen_curr_ifileeditprotopdoneget_ifileprognameback_raw_lineis_at_equivnopendopt.XAKgoyL6sWrM0wN.q2_optnamedup.XAKgoyL6sWrM0wN.t_optnameioctlsave_cmdhistis_filteredset_filter_patterninttoainit_charset.XAKgoyL6sWrM0wN.B__optnameopt_queryabove_memisoptpendingPCcvt_textso_s_width.XAKgoyL6sWrM0wN.query_optnamescreen_trashed.XBKgoyL5sWrMUWN.quit.save_statussleepadd_back_pos.XAKgoyL5sWrMUcN.prompt_col.XAKgoyL6sWrM0xN.read_label.XAKgoyL5sWrMUcN.curr_cmdflagsnifileignore_eoi.XAKgoyL6sWrMUqN.pool.XAKgoyL5sWrMUbN.comb_table.XAKgoyL5sWrMUbN.chardefonscreen.XAKgoyL5sWrMEeN.shellcmdfind_linenum.XAKgoyL6sWrMU3N.is_caselessfindopt_nameeqproto.XAKgoyL6sWrMkpN.mbc_buf_index.XBKgoyL5sWrMUXN.special_key_str.tbuf.XAKgoyL6sWrM0wN.d_optnamelibcurses.so.1SUNW_1.1SUNWprivate_1.1libc.so.1libz.solibintl.so.8libgen.so.1/usr/local/lib%0'= %qN % &'= %qN %4W lYاTTTUUU UUUUXU UF$U (U,U0U4U8UNEuEa|Ez EEA|EZ E EE @EE~EA|EZ E EE;Et-E@EE @E EEE@EE @NEEEÐUE} yE E yjjMuc`Wtdt;jjъjEPU$E;WuEEP PWuREܣ$yE(yE,yE0yE4yE8yEjj}Pu PEPEEjEPTUDEh05EPEP }EPh45?EEu 85E}@u<5EEHPj}P PEPEEjEPUDEh@5EPEP( }EPhD5}}u @5}EPhH5wEEu L5EEPhP5REEu T5ELt E}hX5EPEP }}@u 4pU}@}EEEÐU}h`PEP }EEÐU]E@uE @uWEE[E@uE EFE @uEE2jEPYjE PI;} EEE EE]ÐUE PEPЋEPE@uEUPEUPUE PE PЋEPE@uE Ph5ЋEPE@u E\5PÐU uhP}P (uhPx}P 8t2EE;}jj *E@EE;|WÐU졜WuQ(uhP|}Pp uhP}PM WÐUhj}P ÐUhP}P ÐUhj}P ÐUhj}P ÐUÐUEPj}P| hjP| ÐU졸}@uhP}PF ÐUjj)ÐUuÐUhP}P ÐUhj}P ÐUthj}P hj}P ÐUht{Wu "WE~jEPÐUjEPEEthj}P Ethj}P Ethj}P Ethj}P EWÐU졠Wthj}P^ Wthj}P< Wthj}P Wthj}P WÐUjEPEEEЋM#ȋEЋW#;t"jEPwÐUjEP/EjE PE E;E EEÐUE t E YEE@t EEEEEEEÐUhj}P U Et EEjEPV0EUUE;u;tUEPRZ t.Etjh`5*jht5*EE tEu0Etjh5x*jh5d*E;EuEHEEEuEt E 0EEEEEЉEEtjE;Eu E@EIE;E u@EHEE}1Et EE(ȋEPRQ !EЉEEujh5)UjjEPE PEPj#EEÐU@<}u E}@;}tX}@E}U$(;Bu;Ju/}U,;Bs}U,BEoE}$(##‰EE}DEE}MD;teEEE}H@;(u;$u }U,;Br+E@EE}MD;uE}MD;$}@;}t}@P@;u;tNt}tW|} ;W},t }@EEEUE@R P UE@ RP}M$(QAE@E}MDAE}MDA E}DUP E}ML} $( | +E@։EUc E؉U܋U؋E;u;tEU;EU| E}ME;u;}u E? }jjjUEPRP;u;u!jh5%Ej}EM䉂Wt&EUPWBEWq}t)}hEMHQE5 }EUPE@ PBPP EEu EE}jh5$Eu1W|'E~EUPEPBPWPq }EU}EPUEPE}EM䉂044Eu>EЍEPh5$jjEDutjhWP賬ЍHPRDDuAX\; u;uH;tEtE}@;EUE@RPUE@RP}U@BE}P}@UP}UPUE@R P UE@ RPE}MDAE}MDA E}DUP E}ML}U,;Br}U,BEE@<ÐUEtWtjh5"EWÐU졀W}Wu`}04;u;u?Wjh6"tt wujWPWWÐU$]E} PRQS/EUEUEU;EUE}@EE;}tUEEEP@;Eu;Uu(UE@PBPWPw EE@EE;}uEuEujh6X EEUEUEU;EU?]UUE ##‰EE}DEE}MD;tEEEEP@;E u;Uu E*E@EE}MD;uEEÐU}u E?EUEU ;|$UE;u;tEU;EU } EKPRUE PREU}}ME ;u;UEPR }EU ;}E};UE }HNu Et El};UE |EH}EM$(PRUE PRС},EEÐU }u E}t*}jP辚ʋ}04BEUUE;u;tUEPRE2t t EuEEÐU PRXu E}@EE;}u Ev}@EE;}t.EMP@;QA}EEE@EE;}uҋE }P@$(}ǀ,EEÐU}uEUd4tEUF}t@0@0EU}04UEEUÐU]u}uEUE} $( | +},։EUEU]uÐU}u EEEu Er},=s},}@,=} $(}$(}ǀ,EEEÐU}u E},v },}H, };$(| E}u5}$(+PRu EE}$(+ }$(}ǀ,EEÐUE} W-E  WW} WÐU}u}u%} 04R}@EE;}t(U BJE@EE;}uء}jP蟕ʋ}04} } $(}ǀ,}04;u;u6} 04}} }jjjPRPS;u;ujh<6dÐU h jEEu E} }@ U BJEEE}P}U@B}@UP}UP}U@B}UB }@UP }UPEEÐU]EE@}SE }E}T TE }E}T TE@EE@|]U}@;}tG}@EUE@RPUE@RPjEP}@;}u}ǀ ÐUjjjPREP.;u;EEÐUjhWP}}#h8j}}E}UP}UP}ǀ }ǀ} } $(}ǀ,}ǀ} 04}U E t,jEPu}}}PhWP}u}UÐUE}u} t | E}u:} u}jPH}ǀEEu*j}PH}jhWPÐU}u E}EEUEE}EE@lEEEzMME@ʍDЉEjhL6(jj,;EEE@EEPb}B҃ w$7btcn먋E=~rjh\6jjEUBE@EEHEEEE@E=~sEUBE@EE=~r\<<<<<<<<<<U Et E@uEWEE@t8E@PEPu E@EEEE@uȍXEE@t`E@PEP8u4Ej@PE@t E@@E@E EE@uE ujht6$jj(EEÐUEE=}hEWtU}5E tU}U}E@EE=|ÐUEtUYtKEEE@t9E@ | E@~~EEE@EE@uNjEteE@tYE@*u.E@tAE@t5EjnPuE@*tjnEPtEEE@*uk<YTYHY<Y0Y$E@s} dtkt܃stutЋEEE UPÐUjh6`EjEPt4jh6_EEt"E@tjEPjj1EjEPjtjh6_EEu4jh6v_EEujh6\_EEtnh6EPuBh6EPzu,h6EPduh6EPNtjh6tjh6ÐUh6jvjh6^Eh6hYEP jh7r^Eh7hZEP ÐUYtjEP5 EE%EE}EEÐUE%EE}EEÐUE%EE=r Yu3jEPu jjEPh 7j h~Euh$7h~aE=s:E@jPDu$E@jjPh(7j h~萾 jjEPYPj h~n~EEÐUEuh$7h~cE=srjEPt_E@jPu%E@jjPh(7j h~ؽ!EjjPYPj h~赽ijEP1 t%jjEPZPj h~3E=rEEE=s EpE=s EVE=s E@ t/@t!@ t@uEEÐUu EL BjP0t EEEÐUElE 0ltllPÐUluEBE ul@l@Bl@l@Bl@@ EEu <EEPhӡ@t@uEEÐUjE P_uE@EE;EtUE PB P?tOjjEjE P譫ЋEP EUPEU@BE@UPEUPEU@BÐUlu hlP0l@ÐU Elu EEl;u EEEPEPFEmQEm9Em@t/@ t!@t@ uߡ@ u@ tE(m=v-@ u=v@ t=v-@ tZ=v@ uEm jPEkm@t@uE1mEmMEmuEmEmEmE$EmjEPEkjEPEUEKmE5U}Bw$e}Bw$ et뺐Eô0,dDDddd,UjEPU‰EEEE@tREEEPjEP E+EPEPEEt藼EEE@uEEÐUEETEjEPYE@ tM@t?@ t/@t!F@ t@u=v@ t=uE5EE;s"E@ tE@EE;rދE;rEEE;Et EE~@EE;s2EPEPEP! uEEUDEVEtEPm;uE0EPm;u EE@ uE@EE@EE;;EEEÐU 4tj4P4EEuE8<tj<P+Ej@P<+EPEP<P @EBEPm;tjEPX4REj@PREEuEj@PrX4!jEP]X4jEPEBÐU0E Ph@ BE0E Ph@BEEtȃtۍ<EEÐUmtEuhC4u褸EfEu 4H0m4Ph@ @jEP,HHPEPH;8v;8wHu,mj<PtjHPtjHPat_=vPm;u~jh<8EEu (<EjEP`tEm9EEÐUYuELE:(TELE%u(WE%=u1E%=t"jEPg(EB{E.E%=umTET@TUELT;(} EjhLu(E(ٵ(E($t $EPhLEWt9Eu1jEP EEE'Ew$EPhLWEEðU$]ܡEUEE@0|hE@9\U]؋%ڋȋE@0ÉUEE@EE@0| E@9~E@E@EE@EEEE.uEPjEPQ ЋEPEUEUEU]ÐUEEÐUlu El@@@ EEÐU]jh,<;4EEt]E@tQh<<EP裓th@<EP荓u EjEPEjhL<3EEt E@u E^jEPjhT<DEjEPϝEjhT<EPh`<EPEP輔EEE]ÐUEuhh<P蓔jPuPhP` t)jhl<Phl<P tjP11PhP @tM@ t@ uB@@uh<P[u  mEKh<P7u  mE'"uEtPEPPhP jPÐU Ejh<1EEtjEP.EEuEdE@EEE;E}%E@ uE@EE@EE;E|ۋE@EE@ t,E@ Ph<E PS E@EE@ uÐUEEEuJmtE0mtEEuh<EP蚑EjEP EuEjEP覑Ѝ`PR褑\\|x%=tEEtjEPThPfhl<h<EP h<h<EP EPh mh<h<EP EPh mjEP贐UhÐUEXjE PEPEPÐUXtXt EEEEEÐU\% tX7(\tX X0\%tjh<E\%tjh<'\%tjh< \tjh<\%tjh<\% tjh</\tjh<jh<jPÐU`@E`࿉EEu <E <EEEX/責jEPdtjEPEtjh=*jh=$jh=EtЃtjj.ÐU%PE(hPEP \5\\PEP XE@+t E@ uE@EE@+tE@ tdWtjdWP芌E@udWjEPadWp`PEPR pEHEPhjjPjRQ藭}EHEPhjjPjRQkQt?jEP:m&E@!t-HmtjHmP腋jEP7FHmtHmuh=h =h=HmPРtqEPRGjh=qX#}=}$ } N  :&/}B݃w$P/77èU(yE7E+E0|E9~PE.tHjEPi.du5jhtEhlXEYp"O`࿉EEu/dEtE_tEu E EE`DE'Eu E EE`E`@`EdEE+}t!z+;-tdE tE uTpu(EEPh =2EBd!pEptE;tE;t E;uptEp`࿃ujEPt$`Ph8=EP EjEPEEu-EEEEEEjjjjEPj/ES~;E[X7tEX7tE{X7tEgE]EQE} }tt5 tt&*}t!t*c@rEt\3E\E`X}&} pDr./}M/7E tE uIEOjEPu E3X#t X$u|EEEÐUu跷2ÐUtT;u;uj PRqh PPRTh ZtM8E4E84u 6defE8E4ÐULmtLm=xv+jju8aMt.觼u!jhWPVu jjq t8Mt.eu!jhWPPVu jj/$u=h$EQtjh<=Et E@ujj:@"jj?jEPɡdÐUyEEPh@=sÐULmuELm=xvLmHLmLm@EsLmt ?u UEH&Eg;E //E"X}tكtސtՐEÐULmu xLmLm=܁rjhH=mjjqLmELm@LmEUBUjEP~UDEE;Er!E@jPkEHEE;EsÐU E2E\%tR\t /E /EEtjEP1E\%\E PEP\P E \\E ujEP1E }^\%uK\tjjR0Ejj0EEtEVE ~jh\=EtjEP&1jEP0U@\@EeX7 hlptt jj% #t두EeuEtoEetEEEeXt4GE뾐5jEPYw$RXt0jEPt uEEEEEEEEPEPEEtjEPEtnjjjjhp=j4 ;hl} hت ;hl|˫hlTtPR*]hjjPhL  ;hl} hت ;hl|?hl*hjjP+M  ;hl|hlTu.;hl}PR7\hjjPuK  ;hl|hlXhjjPYL  ;hl|hl Tu.;hl}PRg[hjjPJ 5 ;hl|hlhjjPK  ;hl|Rhl=TuPRZhjjPI ߳tjf[4ujjjI t4tuE2 ;hl} h`TuPRYjjPI  ;hl} hjjPJ a \L ;hl|hlhlPRZ hl; }  hlt;hl} hlt htPR[[k  ;hl| MYhlPRY& hl; } hl,PhlPR[ 3t ?E܍EPht= F hWt.t!`jjF(uQ EtE@jP葁jj腁% \ ;hl|hlE=\ ;hl|hl}E\ `E ;hl|hldhPj" \ \ ;hl|hl`hPj# \E\t\E\E̋Ẹ\ ;hl|hlvhPjE\, \E\t\E\EȋEȣ\\ \ ;hl|hl.hPjE\ ~ ߭tj ``jhx=; tjh=j jjjPh=j ETtjh="3tjhWPHh<Pqujh=տotjh=趿jjjPh=jjPAjPV&tjh=V ;hl|hlhjP`#ttt#<tu jj|;hl} >E >EċEĉE܍EPh>藾Gtjh(>v& ;hl|hlhjP"tD;hl}  >E <>EċEĉE܍EPh@> ;hl|hlhjPEЋEЃujhT>膽6jEPu7TEUċUE;u;t,PUEPREU  ;hl|hlhjPEЋEЃujh`>ּjEPQu7EUċUE;u;t,PUEPRT 5 ;hl|hlhjP!tjhp>,?thWEjhWPCEԋEԃu xjEPtjEPB!rjEPMB]`d&E`dErjjjjh=j ELtjh=jjjPh=jXEtjjjjh>j XEE;t&E;tE;tE tE u7jEPь!jjjjh>jEE;t&E;tE;tE tE uKjEP0tjh=jjjjh>j%$\EE;tE;t E;uKE tE uE.jEP螋tEqjjjPh=j%ELjjjjh>EPzE& ;hl}hȪ;Ȫ~ ȪEEċEċUhl``;hl}``hlh`+Љ`  ;hl}hȪ;Ȫ~ ȪEEċEċUhlh`£`Xt*͹jjjjh>j jEP 3E>5U2}B-w$^e}B΃w$etƐDsp <H$($L`xXP```@($ldUYt EEE@EEÐU EPjrEEE;E}UEE@EE;E|EEEÐU EtEU PUjE PYgU ‰EE EEEE;E_E+E EE+EEEPjEPe EEt\EuTE;EvLEHEE;Ev7E@%t&E@%=u͋E@%=tEtYEt E=uGE@EE;Es4E@EE@EEEjEPJ^uE;ErcEt$jEPhtjEPhEEPEPHEtUE} UEM E;EEtE;EvE@ uEHEUBEt U+UEPEtM+M U+UE U$EEEE U;EEE@E@ t!E@UBE@EE@EE@jPxEE@%EEEEEtjEPd;E~ >EE@t'E@UBE@EE@EE@uًE@?UBE@EE;EwUBE@EE;EvE@EE@%EE@EE%t>E@EE@EEEEtE@EE@EEE܋E܃uEE U;|ÐUhhPmhhojh>j jh>h> jh>h> ÐUEu Ebj j_cEEu EAEPE PEU PU UEPEU@BEUPEEÐUE PEPhok }jh?ÐUE PEPho; }jh ?װÐUEPE PEP }jhH?訰ÐU E@E EEEE;EEPE@;E@E@EE@%EEuE@EE@%EEtEguEf<E%tE@EEUPE%EEEE@u EE@uE@gu EfE@EE@EEEEtE@EE@EEEEuE@uE@EE@tE@%t&E@EE@tE@EE@uEHEE@EEEE@EE;EUEdEÐU EdEEEtBMUjjEPBPAPE PEEdtE@EEuEfuEdEEEÐUE PEPoPg EEÐUE PEPoP7 EEÐU EPEPoP EEu EEdjEPaEEtE@t EE6EPEPoP EEu EE EEÐUEEE@EEU@BE@EEEE@EEU@BE@U‰EEEEÐUEE @tEE @t EE PEPsEEÐUEE @EuEE @nuEE @dt EEEE@EE@EjEPEEPEPEEEjEPEEPEPEEEjEPEEt oE oEEPEPEP EEEDECE7Ev}c+eR؃vwxtEÐUt EjEPEjEPX_EjEP'^E} EjEP(EUUE;$u; tEU;(,}jEP]E;EjP=\EEujEPd]Ejjj04PREP\;$u; u)jEPJ]jEP ]EEPEPEPK^ EjEP\UE;Eu;UtjEP\E`E@u$E@MuE@+u E@GtEPEPEUE PREP EEÐU Et.jEP7EEtjEP>eE/EtjE P!eEjE P}EEu;EPEP}EEEPh?蓨jEP[U$E;t E;u E@E;u E)EE~EUEDߋUDE@EEPEPEEtE t EdEttE tEdE ttE t"EdEw$}E uEdu/E~"EHEEDjPEEtjEPEEEUjjEPE PEPjYEEÐU]EEEjEPFXEjE PucЋEP]Ej@PXSM‰AE EEU;PEtEE~@UUE;Ps2EPEPEPY uEEUDEZEtEPm;uE4EPm;u EE@ u UBE@EEU;P5]ÐUE uE@EjE PVU ‰EEU;Pr EEEjEPB=U‰EEUBE@EUBEEEÐU]jhAkEEE@jEPEEuhAEP?EjEP<jEPy<DEjEPDGEIЋEPREPhAEPEP,>jEP=hAEP?EjEP=hAEP>EEEE]ÐU,]؉ujEP)Et EETjEPEEjEP;u (AEjEPEEujEP<EEjh,AEEt E@u 8AEjEP ;jEP:jP:+Ѝ3DEjEPEE mmEPRQEPhDAEPEP<jEP)<AEE@t?jEPg:ЋME@Ph\A P: E@EE@ujEP(:ЋMEPhdA P: jEPEjEP;EujEPy;EEtjEPEjEP<E@u%jEP6;jEP(;EE#jEP;jEP;EEE]؋uÐU$]Et t Ejj7ejhlAxEEuEE@|uE@EEE@-u E@E%h(AEP8uEDjEP}8jEPm8DEjEP8CEjjEPEPEPEP):jEP+EjEP9EuEEtxjEPM:EjEPEP: tjEP:EsEjPcEUPE UPjh(A+BE=jEP5EjEPt:E@u EEEE]ÐU]u血tEtjEP:jhxArEEujEP6jE P6jEP63DEjEPyAEjEPE PEPEPEPh8jEPjEjEP7EtjEPS9]uÐUEjEPeEdPEP_7EE|!|%=@uDž` Dž``EjEPR7EEEÐUEjEPEuYjEP:tFjEPW5jP)@EEPEPV5hoEP5dPEPl6EE}jEPCzEit ES|%=t@jEP4j*P?EEPEP4hpEP5jEP6EEEÐUhPEP6|EUEUjEPuEUEUÐUAEEUuSwSÐU]4t Eue;\u;Xu EWjj;EUUE;\u;Xteȋ]E;u;u E EEEE]ÐUUu EXjj軆EUUE;\u;XtUE;du;`u EEEEEÐU졔uaÐU]EEEt UH;"\|!E;\~UH;t EEEEE8tHUH;|;/dȋ] E;u;t&U EPREQPjj`ȋ] E;u;u 8tL讆U EPR豅E8t xQCP0pujhAzEHEE^E~(EHEEu`dE UU EPRg E UU E;\u;XupEEu!jjp;\u;Xtjj_u/jjNuHPj8tU EPR苄E@EEt^0ptBU E;\u;Xu,8u"ququw$EHEEEu Et0pjjE]ÐU EU;EtUH;~ EEEEEHEE|uU EPR E UU E;\u;Xu Eu?U EPR裃E@EEuMMvEHEE}EuEtwhuMjjDÐUnt<t2iu%jjt jj:jjہEUUE;\u;XE tHPj貄tz4th{t`dEUIjjgjjjRPjjjIEUUE;\u;XtjEPE PUEPREPUjjEUUE;\u;Xu.E tjj;du;`u !jEPE PUEPREPIÐU4pt E6X| XE8tEE'EUE=8pt"EPU EPE@EE=8puÐUE u 8pE E U@BEU PE @UPE UPE @U@BEj@Pg`p@`pÐUUE@RPUE@RPEj@P!`pH`pÐUj(jQ6EjEP6ЋEPUD0 H0BJ UBE@E@ E PEPEEEÐUEuajEPME;hWujhWPhWEEjEPEj@P@,jEP2,ÐU Eu8pE EEEEE@=8pu E E@EEÐU Eu8pE EEEEE@=8pu E E@EEÐUjEPEEt EE,jEP-EEt EE EEÐU`pEEÐU8pEE=8pt3E@PEPH)uEEE@EE=8puEEÐUjEPEEuE PEPTEEEEÐUEu E E@EEÐUE@EEÐUMU BABA BA$ÐUUM BAB AB$AÐUUBUE@EEÐUEPU EPÐUE@EEÐUE@ EEÐUEU P U0]ЋUE ;P0u;L0u 0L0P0EUtu tL4t E Elp@ʋMU jEPRQUE PRUE PRUtp/L0P0EU*EU EUt:/L0P0EUZEEu.E uYEU+T0X0EU뚐UEPRUEPRUEUEUEU;EU t.L0P0EUI#YEUEPREPO# EءT0X0EUEUE؃~AE؋UM]+ډM]EHE؋E؃|hYEHE؋E؃}EU;EU F*MXEEu-L0P0EUE tE u E EEԉEtu-L0P0EU/E tEu`*EoWEUE؃~9$u/`u%E@M]+؉M]E EE tEW+T0X0RPEP! E؋E؃~o$u `~7JWEE tEuVEUE  VM؋]+ӉEUEVEjEPI)UEPR詓tEUEU t8!V+T0X0jjRPUEPRғt jj*+ЪtxEtpWVEE tE u@t+L0P0EU?VEE tȋE tEtVrUEUEUEUEU]ÐU@]UE ;P0u;L0t\0`0;EU |*L0P0EUMtu tglp@ЋEM ;}\0`0ẺUlp@M] +؉M̉]jjUE PRŰEPR讟UE +T0X0PRrPt%*L0P0EUЪTTELUGUE܃ t E܃ .UE܋E܃ tE܃ uCt)L0P0EU TE܋E܃ tŋE܃ tE܃uk)L0P0EUSt=)L0P0EUTE܋E܃ u ?S T0X0ډM]E܃uSEU닐EUEUUEPRNt(L0P0EUEP UEPR EUEUUEPRNSE܋E܃t tB(L0P0EUT0X0EUEUE܃ u9$EԋEԃ~$u`u E@EdEQ+T0X0RPEP EԋEԃ$u `~E uEԉEЋEHEԋEЉE̋Ẽ~8REU+T0X0EUEԉEȋEHEԋEȉEċEăEU;EU jEP$UEPRtEUEU t8P+T0X0jjRPUEPR覎t jj*%EUEUEU]ÐUUE ;P0u;L0tdUE PRLtPEEuE t E tT0X0EU EU 뻐EU pWtWPET0X0EU EU EtE tE uÐEU xW|WUuMtjhA$k=q}OEUUEPREUUE;h0u;d0uHPl0p0PR 8HPUEPR jHPo;Uu;EtÐUUE PR-/EUUE;h0u;d0tJUEPRJu5TtUEPR,PUEPR ht0x0;EU |5Lu+RNȡ,PRQ jhAi EU EUEPhAiÐU jEP?r7pEPUEPRv ÐU5MEUUE;h0u;d0ujhAjeKMEUUE;h0u;d0ujhBhajjE PEPUEPR`EUEU;EU|EU+t0x0EU,PUEPR UUE PRHuHNEE t EtMEE tEuE u(MLEU TtUE PREPUE PR ÐU]jEP,qEUE PRoEE|sE+EEE~"jjljjjRPEP"]jjljjjRPSyTt jjzUE PRGtjh0B'gNjjclEUjjQlEUUE;h0u;d0tEU ;EUEE;EUE;h0u;d0tSEU;EU |E +M]jjjUEPRDPTt jjUE PRgEU UE ;h0u;d0uE@EE;ET8 E+EPjjUE PRAPEEUH;UE PREU UE ;h0u;d0u_EU ;EU|6MjjjUEPRAPlTt jjpE@EUH;s78u 65UE PRDk jjjUE PRAP]UjhTBѶt@u hBjhlB蚶t@u Bjh dpjh hplpÐUlpEEjEPEjEPEEtEu5EtjEPEtjEPEolpPdpPEP? lpPhpPEP' jhpPjdpPEdpEhpElpEEUEEEÐUpptpt @ÐU(|00EUuUE PRB#EUdp BpWtW;0u;0t@EU ;pWtW|,EU ;xW|W}hp@BhpB@@EPUEPR] jEPE؋E؃}EdpjjEPEPhBR]E@EEE;E}&U hp E@EE;E|ڡEأEأEأ;}Pdp BE@hpUB@;|ÐU,EE+U;~+E+U;~+EEEEE;E:E;+dpE@EԪEtE=EdpUBhpEhpU@BE@EE@EE;dpE@dpEdpU@BhpEhpU@BE@EdpE@E؋E@EE؉EjEPu E;}dpE@xEE%YEjPVEEE;~dpEjPWEjEPW_u@EPEP_u+jEP_t E EEԉEE؉EmEEu8YtjEP?_t E EE؉EEjPQuEEEu^E+EuShpEhpU@BdpU B EE@EEEEE@EhE~hpE@E EE؉EEE;}EEhpEEEԋEԉEܡhpEPEPR0hpEPEPR0hpE@jPdU‰EEE;}hpE@jPU‰EEPEPo0t:jEPU‰EEE;}jEPU‰EE+E;E}8EEEEEEE}EE;EE;E;}IdpEdpU@BhpEhpU@BE@EE@EE;|E+EEUjPÐUEjEPx/EEt EEEt EEEt EEEt EEEEEÐUEjEP.EEt EEEt EEEt EEEt EEEEEÐU Eu:YtjEP=[t EEEEBYtjEPt'EjPMtE6jEPiZuEPEPZt EEjEPZtE@E~ChpPE PR,-u"hp@jPMU‰EjE P7-tAt!hpPE PR,ujE PiU‰EEEEÐUdpEdpPjEPEW E;;hp@0E+dpdpPjEPV EhpPEPREP E+EE~ EDEE;~(;~hp@0WEEÐU dpEE;dpv\dpPjEPV EEt E=u E1jEPu EE;dpwEEÐUjEPu E!EPP EEÐUjEP?u E=jEPt EEPPp EEÐU$]܋E EEtEpp 00MUEPjRQUEPRwtE t E @E Ԫ;jEPuojEPu\dpEdpPjEP-T EE;dpvEt E=űE+dpEE EhԪu"Et E=uE EԪtԪuCEt E=u1jUEPRE PjEPt ES*MUEPRQ6 tE)YԪjEP1KjEP:?EjEP؋5jYPj \3jYP;~ EE@t?EHjUEPRjj Qut EKE@EE@u/jUEPRE PEPEP1t EEE]u}TnTnPnUEtp~"(,PREtpEEEÐUt7 uEu# jj $PRjQ;`}`+jPԪusjjm\tbBEE@tMEdp@BE@hpUBE@EE@u;|&ܪtEt ܧu Ԫu;dp BhpB@ܧ;|xE tpdp BE@hpUBdpBE@hpUBdpBhpBÐUEdpB@hpBUt\t%EuE @E~]EHEE @Et E E EE'hpEPE PdpE@%EEÐUÐUUE ;0u;0t%UE PR%uZ*EEu00EUEE tEt t)EUSlpUH;|#th)+00EU dpUEBE@E)E냋dpUBEt EdpPEt EUPEUEUEUÐU,]ԋUE ;0u;0t4|00;EU }!UE +00PR$t00EUslpEEHEdpUB)EE t t#2( 00ډM]Eu|00EUElpE[t' 00ډM]ydpEHEdplpHE܋E;dpr,E@U܈BEHEE܉E؋EHE܋E;dpsԡlp+EEEHEdpUEBEtdpUEPEtlpP+UEPEUEUEU]U0EE=sEU BE EE=r0048<8800HL00@D00PTÐUE=8t E@=8u!EPE@JR +HP EHPÐU8EE=8tPEP@ ;UE}?EP@;E u;UuoE@EE=8tEP@ ;UE|EEE@E0t0E0@04E4EUPEUPUEMBJ UEM BJEUPEUPjEPjEPjEP48P@UE8EE@=8t>MEU;AQ|E4EP@UEE@EE@=8u‹44@RP44@RPÐUjhB@ÐUX|AX@XXd~,X?6С\;|XUu jhB#?ÐU ]u00EUUE ;0u;0u00EUk00;EU |00EUB8EE=8t5EP@ ;UE }$E@EE=8tEP@ ;UE |܋EP@ ;E u;UuEP@UE4\E=8t+E@M] +HX EP@ +UE ;]E@EEP@ PRDt00EUYXEP@UEEP@ UEEU;EU jjjjUEPREUt00EUUE;0u;0u00EUS00EUEUEU;EU `jjUEPRUEPR1EU ;EU}EU+00EU*EP@ PRt00EUXEP@UEEP@ UEEU ;EUjjjjUEPREUt00EUUE;0u;0u00EUZEU+00EUEU ;EU_jjUEPRUEPREUEUEU]ÐU ]࡜00;EU |00EU8EE=8t5EP@;UE }$E@EE=8tEP@;UE |܋EP@;E u;UuEP@ UE`E=8t+E@M] +HXEP@+UE ;E@EEP@ PRt00EUEP@UEEP@ UEEU;EU jjjjUEPRKEUt00EUUE;0u;0u00EUR00EUEUEU;EU gEP@ PRt00EUEP@UEEP@ UEEU ;EUjjjjUEPR{EUt00EUUE;0u;0u00EUUEU+00EUEU ;EUfjjUEPRUEPREUEUEU]ÐU jEPo=EUEUUE;0u;0uWE|OE;}DE@EjEP =EUUE;0u;0uE| E;|UE;0u;0u EUEUUEPR_EUUE;Eu;UuEU+00EUEUEUEUU]E@-u E@E3+ jhB1jEP1jhB1Ejj螓0jj8jjjjj`EjjjhB}jEP/EjhBiEEE@E@ujEPPEjEP٠EEtijEPjEPpDEjEP;E@ЋEPREPhBEPEP#jEPEu3E@ujhCEjEPEjEPjEPnjj2jEPjEPjj:ijj~E t3jE P/jhC/4jj 8/.jEPjjh]ÐUjEPoEUUE;0u;0u Ejj9EUUE;0u;0u00EUjjR9EUE.u)jUEPRUEPRE PEEU;EU|&jUEPRUEPRE PEcUE;0u;0u&jUEPRUEPRE PCE'jUEPRUEPRE PEEÐU0U EPRtjhC2EhEE؋EuEPhLG!EPhGjjE'EtUE@R P*E@ u EEE@UԉPEtUE@R P!UEPB PЋE@PE@uEE@ uE@EE@ tEjj@PEPEPEPEoE@uEjEPEPm ЋE@P3E@}t2E@tUEPjBЃE@ttttttttttU E@EE࿉EjEP EEu'jEPEEPhGEu8E@@t*jEPgEEPhGEu8E@%t(jEP%EEPhGqw"EuE @uEE@t҃t͋EtE@%t jj4ErE@@u EEE@UPSUE@R P?E@ u EEE@UPEHw$Ea|Ez E EEPEPBPrЋE@PjUE@R PWEa|Ez E EUEPB PЋE@PEHw$jhHEttVEPjE P EEu E@UP9UE@R P'jh4H4:EHw$8E@}g2E@t-Eu E EUE PEPBЃEtE@%t:EusKE@PEjDPhQE@@EUEPBPD-(E@}tt tt֋EtE@ t ØȢܢ(p<PUE t"Eu EEEE%Eu E EEEEÐUjEPPhXHhĞ\ ĞEEÐUjEPEEu EE@SEEÐUjEPEEtE@ u E E@EEÐUEEÐUEEEPh\HFÐU@jPjPÐUE@ujEPjjE UPEEE@E@$t)EE@PEPbUBE@EtE+Ej@PЋE PU E+EPEPBP E U+UH *E@$} t t뜃$t-zE@EE@$EEEÐU E tE @E5EtEEEPhxHjjEEÐUEj@P<EEE@-uEE@EE@0| E@9~EPE P@EEE@0|FE@9:MME@ʍDЉEE@EE@0| E@9~ƋEUPEt E@EtE؉EEEEÐU EEEj@P.EE@0| E@9~EPE PSEE@0|ME@9AMME@ʍDЉEE@EE@EE@0| E@9~E~GEEEHEEEE~)E EEEEHEEEEGEEE@EEEE}+UUЉEEEE@EEEE|ՋEUPEt E@EEEÐU qu E# t EEEEEUjhH_EEtE@t  qqEE@tNE@tUE@R PE@%tEjj@ЃE$EE@uÐUqEE@tRE@;Eu EEEE@tE@ ;Eu EEE$EE@uEEÐUEA|EZ E:Ea|Ez EE-u E EEU0E@EEEEEEqEE@E@EEEEUEPBPEP EE~EE@jPtoEԃuE;Eu ECE;E~8EEEEEEEEj@PѼU;EԋE@uE@EE@E@EEE$EE@E؃tEt E@E@UU܋EPE t&Eu E E@EЋE UЉPEEEUjh̞^t6jEPQjEPjQ E EPE PEP` E4u8Eux@x xx~ jjE}.اu-ا uE EEEÐUjh̞聾ÐUjEPoEEEÐU]jاPZEjEP艺jEPyDEjEPDEjEPEPhSEPEP2EEE]ÐU UM 0 0ȋ%0ʉEM00PRUEPRh;U u;EuUEPRUEPRIЉU200PRUEPR&RPUE PRЉUEÐU ]u}] ‹  4Ed3‰EEu00EU]EMu EuUEPRUEPR_;U u;Eu%00PRUEPR;EUC]u00PRUE PR ‹EuEU]u}U tEEPEPEEtXjEP%EEu jEPE@EEPEP趿EEu3ÐU x-EEuS`Wt EEEEEPhEP荸 ;Et xÐUtx=rPxEx@xEUB0EEEÐUE@t1E@EE@EEEjEP\E@uÐU$]܋EU ;00EEEEtEU EU EHEUBEHE01PRUE PRw1 1ʋˋEH01PRUE PR5EU UE ;0u;0uEtEHE-UBEPEP蒵]ÐU$]܋EU ;00EEEEtEU EU EHEUBEHE01PRUE PRw1 1ʋˋEH01PRUE PR5EU UE ;0u;0uEtEHE-UBEPEP蒴]ÐUEEEEEtE؉EEHEUBEHEE ƒ0UBE EEu͋EtEHE-UBEPE PÐUEPEPMjEPjEP葳EEÐUEPUE PR jEPjEPMEEÐUEE@-E@%t3E@EE@EEEjEPE@EE@EE @EE E E@t8E@EE@EEEjEPxE@EE@uzE j@PU‰EE E VE P@PRU‰EE E 0EEE@EE@n}dtnts.E@EEEÐUIEE t&E tE tEtjEPg2ÐUE@`Wt;dt1hu~jjBEEE PEPU‰E`Wt dujj HjhxLUDEE;| !ÐU83jjE PEPJjhxÐU E`WtdtE PEPGE`Wt dujj EE'E;| 9EEEU E %uzjj脺EEEjEPEPY t)jEPjhSE/E@tEj@PEUPEEÐU tEE?jEPjPFPjǹEjjjjEPEPLGEPE PEP EE;EtjEP?EEEÐUEEE@tEj@PKE@ÐUEEEÐUEE EEEEE;EEEEEEPE@;u8E;EtE;Eu&E@EEEE@EEPE@;tȋE;Eu.Et EUPEt EUPEE@EE;EaEEÐU0EEE$%t3jE P<ЋEPEPEPEPRE PEzE t E EEԉEjEPEPjEPEPʰu EEEЉEEtUUEPUUEPE$%uEuE$%tEu EEEEEEEU0E5HE'HEEw$GUx ЋDMEEUU ]uEE;}2Uxux ЋDLDE@EE;|΋ xE] D\]uÐU ]uHEE~/UxuxLD DEHEEыEM xBJ]uÐU]EE;}-Mx 11ʉ\E@EE;|Ӌ]ÐU];xt"jEPjxP 11EUjP x3UE;1u; 1tMxE]D\]ÐU ] xEU ;AQ} EOEE;}4] xEU ;T} EHEE@EE;|EE]ÐUHPj EEÐUEEE;E 7Ux ЋD;1u; 1t EE@EE;E ~EEÐUEE;}VUx ЋD;1u; 1t%EU@BUx ЋTEHP'E@EE;| 1 1UBJÐUE} EEEEE;| HEEHEEUjh1莲t qt H1E 1EjEP\xjh1H|jh624xjh2 xjh2 xÐUjEPOEE=ģr؍ãEEPEPP' EBÐUEEEjEPpÐUEPUE PRI jEP;ÐUEPUE PR jEP ÐUEPEPjEPÐUjhSÐUjEPEUUE;2u;2u[E|SUH;}FE@EjEPiEUUE;2u;2uE| UH;|UE;2u;2u EUEUEUEUU$]~=EjE P ;2u;2E`EqEjhWP|hSPɤEfEXt;2u;2t EEEE,t,EzEEE,t E EEEjE P;2u;2t"ڋ2 2;} EEEEcjE PŹ;2u;2tJEU22;EU},UEPR觲;2u;2t E EEE_;2u;2E{+tEjhWP[xEUl}>a}*L}BtD[LPFBw>$p}Bw*$s} pgs+xFEE]4L\U,]njE PEUUE;2u;2tUEPR j`PKjE PŷEU22;EU}M~C]M+2 3HPRQSɢ2 3QSW[EUUE;2u;2u UE;2u;2ujjE|UE+23PREU22;EU|f@]M+2 3HPRQS2 3QSjHPljhWPgwjPI(t(jPjhWP[wjP jE PEUUE;2u;2tUEPRgEUUE;2u;2t?UE;2u;2t)UEPR蜮EU22;EU|UE+23PR<'EEtjEP_ujPwjE PEUEUUE;2u;2t?22;EU},jjUEPRUEPR;jP#jE PqEUUE;2u;2t`]EUUE;2u;2t?UE;2u;2t)UEPR.E܉U22;EU| *jjU܋EPRUEPRojP4EUUE;2u;2tUEPR#=v3@ u%H=v@ t=%tjhSjhS jhWPKrE؋E؃tjEPsjPGkUf}WP}'L}B$jLb}PTA|Bwq$zp}0l}fiLl3m5x}'s}p! sSt x]äe0xUEUE@EEuEExpEHEEu EE]TE@EIEHECE@EE@:} t܃.t?}:t?w\tjEÐUjE @E @E @|E @pj,PKЋE PVE @EHEAE@EE@j} Btbt͐m}jtmstZDE@d}P;b2"l} d"lpEEEÐUE@uSEEEE@%E@jPUE@EE@jPz6E@EE@EEu EHEBEEPEP8EEPEPujEPbEjEPIEE@EE@EEu EHEU+UjjУPjE PEPREP̣PȣP(.ÐUujhȣÐU jEPUE;3u;3u.jjkjjRPUEPR jjÐUuÐUthEt 33EUgEUUE;3u;3u覻AEUEUEUH<t6Et E EjEPfEUj,PKEjEP:EUEtvjjjjUEPR!EUUE;3u;3u@E@EE;|,jEPEUUE;3u;3tRUE;3u;3uEjEP}EjEPEPEPEPEPEjhԣtyjjܣPjEPEPEPEPأPԣPy(EEt>jj袑EUEȋM̉BJUEM B JEPhx@jhȣ1jjEPjEPEPEPEP̣PȣP(E܋E܃Et1jjEPEPEPEPEPEPUȋEPR(EHEEyu1NjjEPEPEPEPEPEPUȋEPR(jEPGjEP9E$tEȋM̋U$BJE&jEP jEPEÐUjPEEuEEPEPhȣJ } E_jEPtt  uuEEÐU E tE @jhȣu.jEPujhSEUУ%;tjhT]Eu jjutEPE Phȣ }EpjE Ptt  tjj;ujEPEUUE;3u;3u4E%t EEjh TEjjEPjEPEP33PRUEPR(EEt&uE~ jjgEE>Eu,PUEPRh u jj(EEÐU0]СEUEUjhȣyu|uE}33EUIEU EUEE;E}-jjjjUEPR$EUE@E؋E;E|Ӌ;3u;3t=UE;3u;3tEU;|;EU }L_zUE;3u;3tlp@UEUEEU EUUE;3u;3uA;EU}lp@UEUEEUEU ;}[lp@ЋEM ;} 33EU lp@M] +؉M] EU EUEU UE;3u;3t0UE;3u;3tEU;EU} EUEUUE;3u;3tEU ;EUEУ%U ЉUjEPjEPjEPUEPRUE PR(E܋E܃}];3u;3t;EU} EUEUEUEU]ÐU(Et E@ujhԣE PEPhԣ ÐU赹t EjhԣEEUh0j<tÐUhpjtUhjрtrUEt=h0j虀hpj芀hj{jjo2jj_jjSjjGjj;ÐU EEuEjj*jjwjjjjwjPhpjjj4 EEEtPEEi;Eu ;Et'@=أEtt jj U yEE= yt>UE@RPUE@RPjEP| yEE= yuÐUjjEjE P{j@PԅЋEPUE PBPzUEMB JUEBEuE@7jEPzj@PqЋEPUEPBPzEEEÐUh4TyPZzuEhjyPW|EE|jEPzE EEÐUEEujEPEEPEP7ECMjhXTl:jhhTX&jhTDEw$e,@Uu3 3EU9P @;(3u;$3t EUEUEUÐUEEEEHEEEE~#s EEEEHEEEE݋EEEÐUEEEEHEEEE~# EEEEHEEEE݋EEEÐUEEÐUEEÐU0jyPz.EhTEP6yEjEPxEuEGjEPvEEPhPx ~!uLEPPEPx u E tE t EEjP{EE@uEEE@ tCE@ t7E@t+E@EE@ tE@ t E@uոUBE@EjEPEE@uMEEPjEPr UEEԃ$3(3EUE@E؋E@EE@^uE@EEEE@;Et>E@t2E@\uE@EE@EE@;Et E@u΋E@$E܋E܃tEHEUBEPEPUEPREPEPy yPyPyPy@EPhPiv jEPbvu E yEEÐUu Ej@PEEÐU($3(3EUUEPR̂EUt3 3EUPEUEUjjjEPUEPR{EUUE;(3u;$3t,303EUEUUE; 3u;3u%jhT53 3EUtjjUEPRUEPRyj@PrE܋EPEPBPit uM@tEE@tEE@ u!UEPRxʋB J EUEUEUÐU(E tEuEE uTyjhTt@u ENTPT@T0T E8E w$}jEP*u EjPpjPpjPp3jDP\{jPPPhTPp;EtjPqhTPsjPqPhP r t,=tjPrEjPo~* u0jPns t ujjPPPPtjPojjPRPP yPyPyPy@PhPp =t=jPCqt'E@ y= yu EEEUu Ea@EE= yu+yu E6 yE@@EEÐUu Ea@EE= yu+yu E6yEH@EEÐUu3 3EUP @PREUEUÐUEEE UPE@tEE@u,E@EE@tE@tԋE@uEEUBE@EE@tEE@t,E@EE@tE@uԋE@u EE@E@tEE@u,E@EE@tE@tԋE@tEE@t,E@EE@tE@uԋE@u EEUPEUPE@tEE@u,E@EE@tE@tԋE@u EhUBE@EE@tEE@t,E@EE@tE@uԋE@u EEUPEUPE@tEE@u,E@EE@tE@tԋE@u EsUBE j@PhtKEj@Pht5Ej@PhtEj@PUi~ EEEUjhT1k  }  ÐUÐU jEP P) EEu E;E} jjotEuEEuE%EEUWVS[}Q[^_UWVS[aQ[^_?   m 4m md SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- Search patterns may be modified by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceeded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Forward search skips current screen. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop long lines. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. --no-keypad Don't use termcap keypad init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. CNTL-RightArrow ESC-RightArrow ESC-w Move cursor right one word. CNTL-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. CNTL-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. CNTL-DELETE ESC-DELETE ESC-X Delete word under cursor. CNTL-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. CNTL-L Complete filename, list all. +d@B 0?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSSECURE/moreMORELESS--VISUALEDITORviLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functional-No filenames allowed with -t optionCannot allocate memoryLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_LINESliCOLUMNScokrklkukdkPkNkh@7kDTERMunknownhcamxndadbutsgpcksketitececdcl cmsoseusuemdmembvbbsbcho|^ll cralsrNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread error%sch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMT%cESC^%cascii8bcccbcc18b95.b8bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.next8bcccbcc18b95.bb125.bbdos8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bANSI_X3.4-1968US-ASCIIISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255?LESSSEPARATOR/LESSHISTFILE-/dev/nullHOME.lesshst%s/%sr.less-history-file:.search.shellLESSHISTSIZE"%s w%s Non-match First-file EOF-ignore Keep-pos Regex-off &//?_-(P)+!!done|doneThere is no --%s option& less %sungetcc overflowPattern not found:%s@/\less/\help/\file/\@Command not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filemark: goto mark: |mark: Brackets: /usr/local/bin/.syslessLESSKEY_SYSTEM/usr/local/etc/syslessLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"-@/\less/\help/\file/\@%s"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"LESSMETAESCAPE\LESSMETACHARS; *? '"()<>[]|&^`#\$%=~%c%s%c%s%s%s/HOME%s*SHELLr%s %s %s-LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x -- %sLESSOPENLESSCLOSE-c...skipping... Cannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSmLESSANSIMIDCHARS0123456789;[?!"'#%()*+ %*s Calculating line numbersLine numbers turned off! /dev/ttySHELL%s %s %ssh (press RETURN)Cannot seek to start positionwCannot create pipeInvalid mark letterCannot seek to end of fileMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"lLine number is required after -ljInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %s#Invalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"tags support is not availableTags file "%s"/%sless Copyright (C) 1984-2009 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops ,%d and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sLESS_IS_MOREsearch-skip-screenbuffersauto-buffersclear-screendumbquit-at-eofforcequit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filequit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEpatternpromptsilentquietraw-control-charssqueeze-blank-lineschop-long-linestagtag-fileunderline-specialversionhilite-unreadtabsno-initmax-forw-scrollwindowquotestildehelpshiftno-keypadold-botfollow-nameSearch includes displayed screenSearch skips displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command Follows file descriptorF command Follows file name%s: %sInvalid pattern?-tagfileNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATH-No tags fileNo such tag in tags fileunknown tag typerTag not foundtagsLESSGLOBALTAGSsP%s -x%s %s/dev/ttyVjjkk&k6kFkVkfkvkkkkkkkkkll&l6lFlVlflvlllllllllmm&m6mFmVmfmvmmmmmmmmmnn&n6nFnVnfnvnnnnnnnnnoo&o6oFoVofovo&&(&% & ` |4&4&A C& ozogoPhPho`oTpo66:,7:,76\7:\7:\7:\7:\7:\7:x7:\7:\7:\7;\7;7;7(; 80;88<;\7D;\7P;\7X;\7d;\7l;\7x;\7;\7;\7;\7;P9;9;L:;d8;d8;8;8;09;9;h9<9<9,7476YD7\7d7x777777 8888@8d8l8888888 990989P9T9h9x999999:L:X:oK^pp0J  < < A H M M Q T b c   < < A B G H K M p q   < < ? ? A C M M V V > @ F H J M U V A C M M 114:GN557799q~-0226799XY__24RSrs   "'(229;446:<<BBks *0/000 %& #      8 : ? ? gi{BD psvy0WX``   ;?__KLn : ; N O U W q z      ) ) 1 1 4 4 7 7 : ; = = C F I J N X ] ] _ e u      ) ) 1 1 4 4 : ; D F I J N U X [ ^ ^ b e r     ) ) 4 4 : = E E I I N T W _ b e p      ) ) : = D E I I N V X _ b e p ;>\HHkp""((++35:?ZZ^IINOWWYY^_[^}w  7?T_mmqqtx,/<?ACnou LO}FGNOXXZZ\\^^~  ( ( ) ) * . ` c d i j o r s O!R!!!##'$?$K$_$&&&''' ' '('('L'L'N'N'S'U'W'W'_'`'''''''''''++$++/,/,_,_,m,s,x,,,,&-/-f-n-p--------------------........////@0@00011-10111111122D2O222MMǤ",?x./ko77==??BBEE@O$/SSgglouu  '';;>>NO^46$/K  669;=>@            4 7 ; > H O Y o##c$o$t$')szFW_rUU  ::??EEGIQQצ _)#*#./000>0A0MNƤ0k`D"D#D%D'"" m m m m m m4m4m4m e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789.=:f/?/*?*n+n,N-N.&7m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)8p8paHw<JJbPw@JKBXw8K`Kc`w8KKKdhwAPKKepw L0LDLfxwdL|LFw LLgwLM4MhwXhMMiwMMMjw NNJw!$NDNkwH`Kw\NNlHLwNNmwpNNNnw"O O4OowpTOOw`OpwHPwPlOqxxOOOrx"ԪOP(Psx!ЪhPPSx!$PPt xPT(xPu0x"PQQV8x0w@x"T4QXQQxHx(QQXPxA QRyXx\$R~ L- Z f w qP _ v L  ] { ypPm ( P      {po8P"( #F @$, 0& ,h ,6 0. { ypoH!@7 { yp0pX*{ ypWh19>1 F?i Dp?? Q?y [AW { yp8pD0f{ ypWL0n{ ypWd0u|U  Y  `^ ^ _ a# @b c 0f5 pg Phf lu {pdp|0 w? y #yP +@z2 {0pW06{ ypW0@Gg PPk {`pW0X{ ypq0bk05 q2 {ХY 0 [ {pq` { yp q{̞px0p: > U {px0p  { ypW{px 1i @% &p* -* 8& ? H  V [ J R e@  {px1o {@9 #  pl ^ u '  @\  E  {ȣpx305 +p0 { ypW07 BT K@= TG _ j s | {p y3{ ypW{ ypy$W Pl14t0  p }0$ ;kE`D Q0 ; ZPV bP ljv ~=|  n0" - !  XxAN 8p( A  p$ * n3 ` = v G  T ppu ȣ  n y } m @0 po" @1  m& `p> (xZ b pmi x   W x 0@s t}0  m P x; D^B yW _ mh `   #4 w k  C lW |    x2 |}O `lW 2Pp y  /  x s& q @w  Hw }+ ? wZ Xc g l @ t } q ܧ 1f  } 0pP X8lAW!Ie` n$  on`Wд J xwlP/ x Dw(~ D NY`P`d pV w  + W#62TAhWL+ UPmo0lu *  `M C | @P/ (6L p   8 W' l/`7 =Xr ^kf}Q$  `M W T nC "w .@ 4`q <Q J yc4 q4p`pWpB `    ;  PP 0nx` )1MB IkPPI WWeLm} Vt i 0 4  l   ~ m mmp @Whp0pb :R Cw^B fĞI  mR е I E lW T$  '  p$wFO}jr" bH |dpw`wWp Њ/ 0o57 W % ,$EnL4cPN tXmz zW k} pD @ Vt np  Hx. 7 <T FlpSxrԣ d@@F 4lw@mH `r -b 4` <@0 IxpSoosȪw o Ъv xo- h+'l.H 8(̪CQ ,Mygw\}}U w   0m`. x*\GPC R]u> b` m0 B w B 0P  j " hI c l P . pk.l5n=xg}@N typB& @ xd t - F m @ x}-P~  6Pn=DI2b{0s q0<a p q` YWH  @'D W8}Q0xl"0 zh8 Pd 0| `Y n0) xW! hx@k!P> ,p 7pP,WX`. gpЛ |06 Ԫ<-  m ow4mpvH H1;#m ,x@WYpd8v zn5 hpw}% Ю  0    0  $ k+  0C 6 P7 C M # W ws P $  p< X o F `N U  Pk  o @!}!m&!}?!`xZ!Hyx!تl!$ !# !dW!!! k!p ! !pC !H"P5 "k"#"C  -"н ;"W]"}w" x " "L"s  "8W" "T"o"} #x"$#8 <#p1 G#1 M#`oS#8xo#w#pl#x#% # a #}#0k#`> #3 #n #}0 #{ #1 #& $p $F $#$<.$a 5$`m;$8! H$ N$ oV$Y^$\lz$ $w") $!l$Z$V $pV A  $# e $ t!Л/ $`k$ܪ$$j$ % + %q$% m7 %Y6%p{ <%اB% $kK% V%$ v%s % %w 6` %Pw%Px%@xPM %E %N %@o&&x% 3& m$vS  !@&(J&Q&~ p&@lv&hx&Pm&&@^ &] &W&PI &E O &&M &w5Po 'dpn''<0 "'/'@ >'`>T b%N'@nU' y0 \'8kw'(MĪ'B 'px ' ' 2 '\'}'}(  (2(wM(xWY(Ph d(r(m60 (l(Z@(tp(y ( cd (o )}&)oJ)U)}s)m})PAX ) ))0Q )$))n)T)(*# *J|p!*p '*0B= 1*:* u H*< T*P$ ^*wz*`n~* xn0+ *l*Pq *`e *Q %E *ж *l *Xw*к +L+ *9 ++  &m(+3+xxR+a+ y+ln +f +,+̞(+0+A +4+0,l 1,}  J,P} HmS,z `,)k},` ,x,q,Ly(,hw0 chg_caselesscrti.scrt1.ocrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptrfsr.strap_tablevalues-Xa.cDdata.dataBbss.bssDrodata.rodatamain.cscreen.cltget_envltgetflagltgetnumltgetstrtmodescheaperinc_costcountcostbeepclear_eol_botbrac.csearch.c_xmknodch_addbufbufferedinit_hashtblch_delbufscharset.cichardeficharsetilocalesetbinfmtset_charsetis_in_tablecmdbuf.ccmd_step_commoncmd_step_rightcmd_step_leftcmd_repaintcmd_leftcmd_homecmd_lshiftcmd_rshiftcmd_rightcmd_icharcmd_erasecmd_deletecmd_werasecmd_wdeletecmd_killcmd_updowncmd_editcmd_completecmd_istrdelimit_wordinit_complnext_complhistfile_namesave_mlistcommand.ccmd_execstart_mcamca_searchmca_opt_toggleexec_mcamulti_searchmca_charclear_buffersmake_displayat_promptcvt.cdecode.cexpand_special_keysadd_cmd_tableadd_var_tablecmd_searchecmd_decodegintold_lesskeynew_lesskeyedit.cclose_fileedit_istepedit_inextedit_iprevfilename.cmetacharsmetachardirfileseek_filesizereadfd.XAKgoyL5sWrMEeN.shellcmdforwback.ceof_bellhelp.cifile.cincr_indexunlink_ifilenew_ifilefind_ifileinput.cjump.cline.cexpand_linebufpshiftattr_swidthattr_ewidthpwidthbackcin_ansi_esc_seqstore_charstore_tabstore_prcharflush_mbc_bufdo_appendlinenum.ccalcgaplongloopmessagelongishabort_longlsystem.cmark.cgetumarkgetmarkoptfunc.coption.cproptoptstringflip_triplenostringnum_erroropttbl.cis_optcharos.coutput.ciprint_intiprint_linenumless_printfpattern.ccompile_pattern2matchposition.cprompt.cap_strap_charap_posap_linenumap_intap_questcurr_byteskipcondprotocharwherecharset_patternclear_patterninit_patternget_cvt_opsis_ucaseprev_patternis_hilited_rangeadd_hilitehilite_linehilite_screensearch_possearch_rangehist_patternsignal.cu_interrupttabstoptags.cmaketagentfindctagfindgtaggtagsearchctagsearchnextgtagprevgtaggetentryttyin.cversion.ccrtn.s_END__START_forw_promptstep_char.XAKgoyL6sWrMk2N.s_proto.XAKgoyL5sWrMEeN.fractioninit_promptclr_filterpipe_data.XAKgoyL5sWrMUXN.sc_u_outedit_firsttcsetattrbinary_charcat_fileprevtagpr_expand__fpstartch_seekbackward__filbufedit_prevpercent_posbo_e_width__ctype.XAKgoyL5sWrM0hN.curr_altpipe.XAKgoyL6sWrM0wN.y_optnameprev_ifile.XAKgoyL6sWrMElN.anchorseekableshell_quote__flsbufclear_eolcleantagsclose_getchr.XAKgoyL6sWrMkpN.last_overstrike.XAKgoyL6sWrMU3N.search_infosigprocmaskdispversion.XAKgoyL5sWrMUXN.sc_lower_left.XAKgoyL5sWrMUcN.in_completionsize_helpdata_get_exit_frame_monitorwait_messageclosequote.XAKgoyL6sWrMElN.ifiles.XAKgoyL6sWrM0wN.T__optnamewscrollfclose.XAKgoyL6sWrM0wN.oldbot_optnameget_quit_at_eofsc_height.XAKgoyL5sWrM0ZN.ch_ungotchar.XAKgoyL6sWrM0wN.q_optnamedel_ifile.XAKgoyL5sWrMUXN.sc_padcmd_addhistfprintfknow_dumb.XAKgoyL6sWrM0yN.intr_to_abort.XAKgoyL5sWrMUbN.ubin_tabletwiddleiswupper.XAKgoyL5sWrMEeN.optflag.XAKgoyL5sWrMUcN.cpch_forw_getget_meta_escape.XAKgoyL6sWrM0wN.i_optnamefsyncget_wcharopenedhold_ifilech_tell.XAKgoyL6sWrMkpN.currquiet.XAKgoyL6sWrM0wN.follow_optname.XAKgoyL5sWrMUXN.sc_e_keypadlseek64.XAKgoyL6sWrMk2N.h_protocurr_ino.XAKgoyL6sWrM04N.curseqch_getflagssigs.XAKgoyL6sWrM0wN.S__optnameforw_raw_lineplusoptionjump_sline_fractionopt_quote.XAKgoyL6sWrM0wN.a_optname.XAKgoyL5sWrMUXN.sc_return.XAKgoyL6sWrMk2N.mp.XAKgoyL6sWrM0wN.n_optnamecharsetspositionintread.XAKgoyL5sWrMUXN.sc_backspaceless_is_moreignaw.XAKgoyL6sWrMk2N.M_proto.XAKgoyL6sWrMUvN.pendopt.XAKgoyL5sWrMUXN.sc_clear.XBKgoyL6sWrMkjN.forw.first_timeget_scrpos.XAKgoyL6sWrMUqN.loopcount__rem64_environ.XAKgoyL6sWrMkpN.overstrikecurrlineis_composing_charis_utf8_well_formedfd0.XAKgoyL6sWrM0yN.obufget_timebl_e_widthany_displaypostoainit_textlist.XAKgoyL6sWrM0wN.f_optnamenl_langinfoadd_lnumshift_count_fraction.XBKgoyL5sWrMUbN.prchar.bufcmd_charwerase_char.XAKgoyL6sWrM0sN.marksunmarkempty_screen.XAKgoyL6sWrMk2N.messageback_textlistautobuf.XAKgoyL6sWrMkpN.lmargin.XAKgoyL5sWrMUcN.cmd_colcalc_jump_sline__environ_lock.XAKgoyL6sWrMU3N.prep_startpos.XAKgoyL6sWrMk2N.e_protosave_curr_ifilebin_file.XAKgoyL5sWrMkgN.cmdtabletgotofcompletereedit_ifilecvt_alloc_chposset_open_fini.XAKgoyL5sWrMUcN.tk_tlistlglobis_ansi_enduse_logfile.XAKgoyL6sWrMkpN.pendpostop_scrollch_closenamelogfileul_s_widthtgetenteof_displayed.XAKgoyL5sWrMUcN.cmdbufch_flushsprintf.XAKgoyL5sWrMUXN.sc_b_injump_locso_e_widtherrno_messageset_attnpos.XAKgoyL5sWrMUXN.init_done.XAKgoyL5sWrMEeN.bottompos.XAKgoyL6sWrMkpN.pendc_etextpr_stringstrerrorset_filestateclr_linenumputbsch_initjump_line_loc.XAKgoyL6sWrM04N.taglistclose_altfileno_back_scroll.XAKgoyL5sWrMEeN.save_hshiftstart_attnpossingle_char_optioninit_optionpercentageunsave_ifilejump_backtoggle_optionpopen.XAKgoyL6sWrM0wN.s_optnameadd_hometable.XAKgoyL6sWrMk2N.m_protoopt__Ostrcatopt__Pforce_logfile.XAKgoyL5sWrMEeN.ungotpinit_cmdhistprewindopt__Topt__Vuncompile_patterngetfractionlgetenvspecial_key_strfilenomlist_shellsetlocale.XAKgoyL6sWrMU3N.prep_endposch_length.XAKgoyL6sWrMkpN.attrinit_cmdscommands.XAKgoyL6sWrM0wN.k_optnameget_pos.XBKgoyL6sWrMUvN.propt.bufadjslinetowlowerclear_botlinenumtoaregfreeis_combining_char.XAKgoyL5sWrMUcN.cmd_mbc_buf_indexis_ubin_charfindtagfexpandget_term__fsr_init_valuepr_type.XAKgoyL6sWrM0wN.P__optnamech_setbufspace.XAKgoyL5sWrMUXN.sc_bl_outreadingedit_next.XAKgoyL6sWrMkpN.linebuf.XAKgoyL6sWrM0wN.J__optname.XAKgoyL6sWrMU3N.hide_hilite.XAKgoyL6sWrM0wN.c_optnameend_logfilesquishedlsystemvbellabsbad_fileempty_linesgomark.XAKgoyL5sWrMUcN.literalsetjmp.XAKgoyL6sWrMUqN.sparejump_forwinit_signalsplinenum.XAKgoyL5sWrMUXN.sc_visual_bell__1cG__CrunMdo_exit_code6F_v_pflushmbcpos_clear_DYNAMICprprotosigemptysetput_wchar.XAKgoyL6sWrM0wN.x_optname.XAKgoyL6sWrM04N.totalshell_coptioninit_linesize_linebuf.XAKgoyL6sWrMU3N.filter_anchor.XAKgoyL6sWrMU3N.filter_info.XAKgoyL5sWrMEeN.optgetname.XAKgoyL5sWrMUcN.tk_text__div64.XAKgoyL6sWrM0wN.O__optnamestrncpyeditornew_filech_beg_seekadd_forw_pos.XAKgoyL5sWrMUXN.sc_deinitungetccsync_logfilentabstops.XAKgoyL5sWrMkgN.edittablecalc_shift_count.XAKgoyL6sWrM0wN.p_optnameget_cmdbuf_startsqueezesprefix.XAKgoyL6sWrMU3N.hilite_anchor.XAKgoyL5sWrMkgN.list_ecmd_tables.XAKgoyL6sWrMkpN.end_ansi_charsset_mliststrchrback_lineforce_openpipe_mark.XAKgoyL6sWrM04N.circular.XAKgoyL6sWrM0wN.h_optname.XAKgoyL6sWrMUqN.startime.XAKgoyL5sWrMUXN.sc_bl_inml_searchcheck_winchforw_textlist.XBKgoyL6sWrM0sN.getmark.smstrncmpch_ungetchar.XAKgoyL6sWrM0wN.pound_optname.XAKgoyL5sWrMEeN.search_typeheld_ifilefinal_attrsavematch_brac.XAKgoyL6sWrMUqN.freelist.XAKgoyL6sWrM0wN.F__optnameput_lineget_indexjump_percentgettagtype_PROCEDURE_LINKAGE_TABLE_pappend.XAKgoyL6sWrMkpN.mid_ansi_charsadd_ecmd_tabletcgetattrcfgetospeedlongjmp.XBKgoyL6sWrM0yN.error.return_to_continue.XAKgoyL5sWrM0ZN.thisfilenext_ifile.XBKgoyL5sWrMUXN.get_term.sbufget_filenameclear_attn.XAKgoyL5sWrMEeN.ungotclr_hlistopen_getchrcmd_reseterrmsgsfchmodch_get.XAKgoyL5sWrMUXN.sc_s_keypadfind_posmemcpyfollow_mode.XAKgoyL6sWrMk2N.w_proto.XAKgoyL6sWrMkpN.mbc_bufgline.XAKgoyL6sWrM0wN.option.XAKgoyL5sWrMUcN.tk_originalopt_shift.XAKgoyL6sWrMU3N.is_ucase_pattern.XAKgoyL5sWrMEeN.pipecutf_modecs_aliasesno_inithomefile.XAKgoyL5sWrMUXN.attrmode.XAKgoyL5sWrMUXN.sc_init.XAKgoyL6sWrM0wN.u_optnameshell_unquoteul_e_widthlastmarkedit_listedit_indexireadcvt_length.XAKgoyL6sWrME1N.table.XBKgoyL5sWrM0ZN.end_logfile.triedis_wide_char.XAKgoyL5sWrMEeN.numberhprotostrcmpget_returneq_message.XAKgoyL5sWrMEeN.optchar___Argvadd_fcmd_tablequittingch_end_seekin_mcactldispquit_if_one_screenfstat64is_null_pattern.XAKgoyL5sWrMkgN.list_var_tables.XAKgoyL6sWrM0wN.m_optnamemlist_examineskipsp.XAKgoyL6sWrMk2N.more_protoeditchar.XAKgoyL6sWrM0yN.ob.XAKgoyL5sWrM0ZN.maxbufstabdefaultentire_file_displayedcreat64is_diroldbot.XAKgoyL6sWrM0wN.e_optnamebelow_mem.XAKgoyL5sWrMUXN.sc_b_outbadmarkprutfchar.XAKgoyL5sWrMUcN.cmd_offsetadd_linelinenumsml_shellch_back_getatexitml_examineedit_tagfilekill_charclear_cmd.XAKgoyL6sWrM0wN.L__optnamefcmd_decodemain.XAKgoyL5sWrMEeN.mcacurr_altfilenameopt_promptat_switchsetmarkstrcpyerase2_char.XAKgoyL5sWrMkgN.list_fcmd_tablesdohelp.XAKgoyL5sWrMUXN.sc_addlinestrstr.XAKgoyL5sWrMUXN.sc_move.XAKgoyL6sWrM0wN.z_optname.XAKgoyL5sWrMUXN.hardcopyget_swindowedit_lastchg_hiliteevery_first_cmd.XAKgoyL6sWrM04N.curtagcurr_devisattyline_leftcmd_intget_filestate.XAKgoyL5sWrMUcN.tk_trialpsignalsatoican_goto_lineforw_linematch_pattern.XBKgoyL5sWrMUXN.raw_mode.curr_on.XAKgoyL5sWrMUXN.sc_s_outraw_modeclr_hilite.XAKgoyL5sWrMUcN.cmd_mbc_bufset_status_col__longdouble_usedpos_init_GLOBAL_OFFSET_TABLE_regcomp.XAKgoyL5sWrMUXN.sc_s_in.XAKgoyL6sWrM0wN.r_optname.XAKgoyL6sWrMUqN.anchorcmd_acceptopt_bfgetc.XAKgoyL6sWrM0wN.V__optname.XAKgoyL6sWrM0wN.K__optnamewritewprotoopt_iopt_j.XAKgoyL5sWrMUXN.sc_eos_clearstrlenopt_kis_filteringopt_lscrsizemarkposopen_altfilecontrol_charopt_oopt_pbo_s_widthhow_searchputchrfgetssquish_checkopt_tregexecbinattr.XAKgoyL5sWrMUbN.wide_tableopt_x.XAKgoyL6sWrM0wN.j_optname__iob.XAKgoyL5sWrMUbN.utfbinfmtnexttagis_ascii_charinit_searchecallocauto_wrapbs_modeat_exitcmd_putstrtagoptionsnprintf.XAKgoyL5sWrMUbN.binfmt__fsrerrnocurr_tagis_hilitedscan_option.XAKgoyL6sWrMkpN.is_null_lineinitial_scrposquit.XAKgoyL6sWrM0wN.b_optname.XAKgoyL6sWrM0wN.X__optname.XAKgoyL6sWrM0wN.w_optnameapply_at_specialsierrorgetpiduse_lessopen.XAKgoyL6sWrM0wN.keypad_optnamemlist_searchno_keypadsecure.XBKgoyL5sWrMUbN.prutfchar.buftputs.XAKgoyL6sWrM0wN.quote_optnamefopen64clear_bgpshift_allundo_searchmissing_capungetscinit_marksc_widthedit_stdin.XAKgoyL6sWrM0wN.o_optnameis_ttyneed_clrforward_lib_versionrepaint_hiliteget_back_scrollpclose_edata.XAKgoyL5sWrMUcN.tk_ipoint.XAKgoyL5sWrMUcN.cmd_mbc_buf_lenstore_pos.XAKgoyL6sWrM0wN.tilde_optnamecmd_lastpatternforw_scroll.XAKgoyL5sWrMUXN.costcount.XAKgoyL5sWrMUXN.sc_u_inat_enter.XAKgoyL6sWrMkpN.column.XAKgoyL6sWrM0wN.g_optnameend_attnposlen_cmdbufhilite_searchquit_on_intr.XAKgoyL5sWrMUcN.curr_mlist.XAKgoyL5sWrMUbN.comp_table.XAKgoyL6sWrMkpN.mbc_buf_lenfindoptis_ansi_middle.XBKgoyL5sWrM0iN.metachars.mchars.XAKgoyL5sWrMUXN.sc_home.XAKgoyL5sWrMkgN.list_sysvar_tablesbl_s_width.XAKgoyL5sWrMUXN.sc_eol_clearopenquotegetoff_ifileutf_len.XAKgoyL6sWrMkpN.cshiftprep_hilitechopline.XAKgoyL6sWrME1N.table_sizesignalshow_attn.XAKgoyL6sWrMkpN.mbc_posreopen_curr_ifileeditprotopdoneget_ifileprognameback_raw_lineis_at_equivnopendopt.XAKgoyL6sWrM0wN.q2_optnamedup.XAKgoyL6sWrM0wN.t_optnameioctlsave_cmdhistis_filteredset_filter_patterninttoainit_charset.XAKgoyL6sWrM0wN.B__optnameopt_queryabove_memisoptpendingPCcvt_textso_s_width.XAKgoyL6sWrM0wN.query_optnamescreen_trashed.XBKgoyL5sWrMUWN.quit.save_statussleepadd_back_pos.XAKgoyL5sWrMUcN.prompt_col.XAKgoyL6sWrM0xN.read_label.XAKgoyL5sWrMUcN.curr_cmdflagsnifileignore_eoi.XAKgoyL6sWrMUqN.pool.XAKgoyL5sWrMUbN.comb_table.XAKgoyL5sWrMUbN.chardefonscreenfind_linenum.XAKgoyL6sWrMU3N.is_caselessfindopt_nameeqproto.XAKgoyL6sWrMkpN.mbc_buf_index.XBKgoyL5sWrMUXN.special_key_str.tbuf.XAKgoyL6sWrM0wN.d_optnameanotate anotate0 ,(oVo|p0W4Wanotate anotate yzzxzxzxzxzyzyz$yz4yzDyzTyzdy{ty{y {y {y{y{y{y{yOgg~ko,sHwd{`4މ4TtDd@`ь7Danotate bn0anotate anotate 77;\?<C<G<K<O<S<W<[<_<c<GPP̲TX\8`|d̳anotate  0,dDD d dd,anotate 8PPTXR'^;RVZ^Dbsfjpnrv z~<H$($L`xXP```@( $l"&d*anotate anotate0 ,(}}anotate anotate anotate anotate anotate anotate anotate( $ nppTnpTnpPnanotate anotate anotate anotateh d`ouuy,}{,Ȑ,!!̑%h)̑\d\̖ۖӗٗٗDݗ88{Pkqqu(yanotate $$t(t,t0t4t8t<t@tDtHtԣpȢܢ(p<Panotate Hqrr r`@sspst*Uadd_lineM0NUlower_leftPjUline_left,pUcheck_winchLUgoto_linekɊU  slinenumivbellЊUbeepUbell  ;Uclear@^Uclear_eol(`zUclear_eol_botcUclear_bottUu ݋saved_attrmode at_enter U  attrat_exitWUat_switch`U'  attrnew_attrmode ignore_modes is_at_equivU o  attr1 attr2 apply_at_specials5U   attrputbs% @ZUcostcount E}hardcopy kHytgototgetstrclear_bg can_goto_line below_mem above_mem Lbl_e_width bl_s_width so_e_width so_s_width ul_e_width ul_s_width bo_e_width bo_s_width sc_height sc_width werase_char Īkill_char erase2_char erase_char ignaw ܧauto_wrap ܪsc_deinit}sc_init}sc_e_keypad|}sc_s_keypadx}sc_backspace}sc_visual_bell}sc_bl_out}sc_bl_in}sc_b_out}sc_b_in}sc_u_out}sc_u_in}sc_s_out}sc_s_in}sc_eos_clear}sc_eol_clear}sc_clear}sc_move}sc_return}sc_lower_left}sc_addline}sc_home}sc_padt}unsigned long long ;rlim64_t rlimit64rlim_curQ#rlim_maxQ#`getrlimit64  `setrlimit64   ;rlim_t rlimit(rlim_cur#rlim_max#getrlimit64 Q (Qsetrlimit64  Vitcsetattr   itcgetattr  i speed_tcfgetospeedpos_initputchr lgetenvvoid:ecallocBsaved size_tstrlennistrcpystrcmp strcatmkstemp64 7mkstemp64 TTatoi vYPP{ tm$tm_sec #tm_min #tm_hour #tm_mday # tm_mon #tm_year #tm_wday #tm_yday #tm_isdst # __wcsftime_xpg5nZvn#wchar_tZZje__wcstok_xpg5eeot Pwint_t__putwchar_xpg54 __FILE_cnt #_ptr#_base#_flag4# _file4# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  __putwc_xpg5__getwchar_xpg5__getwc_xpg5__ungetwc_xpg5?P?__fputws_xpg5 tDI__fputwc_xpg5__fgetws_xpg5ee __fgetwc_xpg5long longlockf64   truncate64 J" off64_ttell64Jr  ssize_t:pwrite64rr:pread64rrlseek64J  J ftruncate64 - -truncate64 Z2 off_ttell64Z :pwrite64rrpread64rrlseek64Z Z lockf64 )  ioctl H  ftruncate64 l fsync  attropen64  openat64   unsigned longcreat64 ..open64 X3 Xbattropen64 ]g openat64   creat64 open64  ftello64J;fseeko64 aI afsetpos64 Iffgetpos64 I FILEtmpfile64freopen64fopen64F!ftello64ZgFfseeko64 I fsetpos64 Ifgetpos64 Isprintf freopen64A AKfopen64uFPtmpfile64 Ibrac.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g brac.c -W0,-xp.XAKgoyL5sWrMEZN.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL5sWrMEZN.;backend;raw;cd;DBG_GEN 5.2.71match_brac!` Uobraccbrac forwdirnc"nest#pos$chget%ch_back_getch_forw_getintlong longPOSITION position error jump_line_locch_back_getch_forw_getch_tellch_seekchar  mkstemp64  mkstemp64 long unsignedsize_t  tm$tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst#   __wcsftime_xpg5    wchar_t     __wcstok_xpg5(   wint_t __putwchar_xpg5(X (unsigned char X__FILEJ_cnt#_ptri#_basei#_flagX# _fileX# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  n __putwc_xpg5(t ( J__getwchar_xpg5( __getwc_xpg5( J __ungetwc_xpg5( ( J   n __fputws_xpg5    __fputwc_xpg5(/ ( J n __fgetws_xpg5_   / __fgetwc_xpg5( J lockf64      truncate64  off64_t tell64 ssize_tvoid   pwrite64E      pread64t  E   lseek64    ftruncate64     truncate64  off_t tell64    pwrite64E     pread64o  E   lseek64    lockf64    ftruncate64       attropen64      openat64K     K unsigned long creat64 P U  open64    attropen64   openat64     creat64H # U  H open64r M  n ftello64 r fseeko64     fsetpos64   fgetpos64  nFILE tmpfile64   /  9 freopen64 j 4 >   j  t fopen64  o y n ftello64 fseeko64     fsetpos64  fgetpos643   3  = freopen64 n 8 B   n  x fopen64  s } tmpfile64 @ch.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g ch.c -W0,-xp.XAKgoyL5sWrM0ZN.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL5sWrM0ZN.;backend;raw;cd;DBG_GEN 5.2.7mknod8Uffz_path_mode _devintcharmuunsigned longmode_tdev_tch_ungotcharf}Wmaxbufsf~W ch_get@RUf-bpbnrnfsleptfhfposlen @< L< L< d$ r$ r$ r z z pargt7 $ $ $ stJ rfK bufnoder nextr# prevr# hnextr# hprevr# -long longwBLOCKNUMunsignedunsigned charlong buf  node-# block# datasize# data#wPOSITIONmwLINENUMpargt p_string## p_intf# p_linenum(#6PARG unsigned long longino_tnlink_tuid_tgid_twoff_ttime_ttimespec2 tv_sec# tv_nsec#timestruc_tblksize_twblkcnt_tmt stat st_dev# st_pad1# st_ino# st_mode# st_nlink# st_uid# st_gid#$ st_rdev#( st_pad2#, st_size#4 st_atim2#< st_mtim2#D st_ctim2#L st_blksizeD#T st_blocksT#X st_fstypec#` st_pad4t#pch_ungetchar}`Ufc{end_logfile4U  triedfWsync_logfile@pU bp bnr warnedf block nblocks k B B wrotefbufferedpUf:block bp bnr hfch_seek˛Ufpos new_block lench_end_seekЛUf lench_beg_seek"fUf$ bnr# firstbnr$ch_lengthBpUch_tellQ|Uch_forw_get\,Uf cf]ch_back_gets0:Ufch_setbufspace@U fbufspacech_flush1U$ bnrch_addbuf@Ufm bp bnrinit_hashtbl U hfch_delbufsU bnrseekableQUf ffch_init/`ѥU@ ff,fflags, ch_closeVUy keepstatefWch_getflagsߦUf- ?filestate8F buflist-# hashtbl # filef# flagsf# fpos# nbufsf# block# offset# fsize# thisfileF |}ignore_eoif 4fm _xmknodf |  m lstat64f   m stat64f   fstat64f- f m- fstatat64fc f2  fmc  ~ ino64_t woff64_twblkcnt64_tm  stat64 st_dev# st_pad1m # st_ino~ # st_mode# st_nlink# st_uid# st_gid#$ st_rdev#( st_pad2 #, st_size #4 st_atim2#< st_mtim2#D st_ctim2#L st_blksizeD#T st_blocks #X st_fstype #` st_pad4 #p fstatat64f2fh fm2lstat64f\7m\stat64fafstat64ffwait_message# ierror errorireadf set_filestatevoidget_filestateget_filename#filesize clear_eolmkstemp64fc#mkstemp64f#!freecallocsize_ttm$h tm_secf# tm_minf# tm_hourf# tm_mdayf# tm_monf# tm_yearf# tm_wdayf# tm_ydayf# tm_isdstf# h__wcsftime_xpg5mwchar_t__wcstok_xpg5wint_t__putwchar_xpg5__FILE  _cntf# _ptr# _base# _flag# _file# "__orientation# "__ionolock#  "__seekable#  "__extendedfd#  "__xf_nocheck#  "__filler#  #__putwc_xpg5)#__getwchar_xpg5__getwc_xpg5b__ungetwc_xpg5#__fputws_xpg5f__fputwc_xpg5#__fgetws_xpg5f__fgetwc_xpg55lockf64fZffwmZtruncate64f_wtell64 ffssize_tpwrite64wpread64wlseek64 8f fftruncate64f\fw\writeamtruncate64fwtell64fsleeppwrite64wpread64Hwlseek64mfflockf64fffwftruncate64ffwcloseffmmattropen64f f$m openat64f=ff$m=creat64fgBmgopen64flf$mmattropen64ff$mopenat64fff$mcreat64f)m)open64fS.f$#ftello64 tSfseeko64fwfwfsetpos64fwfgetpos64f#FILE #tmpfile64mmfreopen64KmKmUfopen64PZ#ftello64fseeko64fwfwfsetpos64ffgetpos64fmmfreopen64O#mOmYfopen64T^#tmpfile64%lseek64&lseek'stat64&statOcharset.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g charset.c -W0,-xp.XAKgoyL5sWrMUbN.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL5sWrMUbN.;backend;raw;cd;DBG_GEN 5.2.7!intutf_mode"YcharA"charset nameI#p_flagN#descI#longScharsets$Xcs_aliasnameI#onameI# H(cs_aliasesBW binfmtIrY utfbinfmtIsZbinattr"tY ichardef7U Is cpI n" vA icharsetpU" Iname "no_error p aS ilocale됩UP c"setbinfmt xU Is fmtvarptr Idefault_fmt&88tIIset_charset0U sI1init_charsetw\UBsIxbinary_char`U"ucunsigned longuLWCHARcontrol_char֭U"cprcharîUIcbuf~A prutfcharЮUIchbuf~֮ܰܰܰtܰtܰܰܰlen"A utf_lenU"Achis_utf8_well_formedU"si"len"t,t,tmask%unsigned charget_wchar7PUIp5put_wcharlpyUppichi step_char׹Uppdir Ilimitchlen"pIsigned intwchar_rangefirst#last#comp_tableZ @comp_tableZ<comb_table-l gcomb_tableVlubin_table/D^ ubin_table/D^wide_table;\l wide_table ;\lis_in_tableLtU" chH tableH "tsizeHhi"Mlo"N h``mid"Wis_composing_chariU" chgis_ubin_charsԺU"L chqis_wide_char}U" ch{is_combining_chargU" ch1ch2 i" A  chardef q}nl_langinfoI% "A% setlocaleIQ "* errorlgetenvIquitAt A~ strstrI y  A strchrI  "A strcpyI I A A strcmp",   mkstemp64"I Imkstemp64"f Iunsignedk size_t tm$' tm_sec"#tm_min"#tm_hour"#tm_mday"# tm_mon"#tm_year"#tm_wday"#tm_yday"#tm_isdst"#  ' __wcsftime_xpg5w c f w  , wchar_tc c s n __wcstok_xpg5n  n x } wint_t__putwchar_xpg5   __FILE_cnt"#_ptr#_base#_flag# _file# __orientationk # __ionolockk #  __seekablek #  __extendedfdk #  __xf_nocheckk #  __fillerk #   __putwc_xpg5   __getwchar_xpg5 __getwc_xpg5 __ungetwc_xpg5 C C __fputws_xpg5"xHM__fputwc_xpg5   __fgetws_xpg5n n "__fgetwc_xpg5 long longlockf64"!""A!truncate64"N&off64_ttell64Nv""ssize_tvoidpwrite64vvk pread64vvk lseek64N"N"ftruncate64"9"A9truncate64"f>off_ttell64f"pwrite64vvk pread64vvk lseek64f"f"lockf64"5""ftruncate64"Y"AYAcattropen64"^h"!Aopenat64"""!Acreat64"uAopen64""!AA%attropen64"X *"!AXopenat64""]"!Acreat64"uAopen64""! ftello64Nfseeko64"$M"$fsetpos64"PM)fgetpos64"wMP FILEw tmpfile64AAfreopen64AAfopen64  ftello64f* fseeko64"PM"APsnprintf"Ik U!fsetpos64"Mfgetpos64"MPAAfreopen64 A Afopen64> tmpfile64'xcmdbuf.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g cmdbuf.c -W0,-xp.XAKgoyL5sWrMUcN.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL5sWrMUcN.;backend;raw;cd;DBG_GEN 5.2.7+mknodpUnn_path_mode _devintcharu}unsigned longmode_tdev_tin_completionn'm openquoteu3m closequoteu4m mlistW nextW# prevW# curr_mpW# string\# modifiedn#u mlist_searchM mvoid} ml_searchO mlist_examineQ4m ml_examineS mlist_shellV m ml_shellXcurr_mlistWil cmd_resetvU clear_cmdU cmd_putstr KUL\sprev_chLchLendline\CIS9S9ns\3ȼ3ȼ333widthnLWCHARlen_cmdbufPUns\endline\lenncmd_step_common}U\-\pLch nlen-pwidth-bswidthpr\ƽrν"ν"߽"""lenn(r(r9rMrMrMrrrҾҾlennؾrؾrprev_chLncmd_step_rightU\pp-pwidth -bswidthp\chL\cmd_step_left4U\6pp-pwidth -bswidthp\chLcmd_repaint"@/U\old_cp KYYnp\)widthn*pr\+np\4widthn5pr\6cmd_homeJ0U6CCwidthnMbswidthnMcmd_lshift]Ua s\^save_cp\_colsn`BwidthnjBNvNvwidthnpns\qcmd_rshiftXU s\save_cp\colsn.  widthncmd_right`\UnT pr\ncp\widthncmd_left`-Un ncp\widthnbswidthncmd_ichar0 Un \csnclen s\cmd_eraseUnU s\clenncmd_delete6Uncmd_weraseIUncmd_wdeletecAUncmd_kill}PUnset_mlistU mlistncmdflags cmd_updownUn] nactions\cmd_addhistfU Wmlist\cmd mlWcmd_acceptpUcmd_editUn* ncactionnflagsncmd_istr Un \strs\actionnendline\<NNos\delimit_wordU\~word\p\delim_quotednmeta_quotednesc\esclenninit_complUword\cu`qword\next_compl2CU\?naction/\prev/ cmd_completeGPUnnactionEs\Hcmd_charUnncactionnlenncmd_intU[Nqfracp\n[errnlong longNLINENUMlongiget_cmdbufU\cmd_lastpattern" RU\histfile_name/`uU\ home\0name\1lenn2init_cmdhistTzUmlWVlineWfilename\XfYp\Zuiunsigned charunsigned__FILE _cntn# _ptr# _base# _flag# _file# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  FILEsave_mlistFUAWmlf histsizennns\save_cmdhistPUfilename\fmodifiednMdo_chmodnstatbufrni iunsigned long longino_tnlink_tiuid_tigid_ti_iNoff_titime_ttimespec tv_seck# tv_nseci#xtimestruc_tiblksize_tNblkcnt_tuii istat st_dev# st_pad1# st_ino# st_mode# st_nlink(# st_uid6# st_gidB#$ st_rdev#( st_pad2N#, st_size_#4 st_atim#< st_mtim#D st_ctim#L st_blksize#T st_blocks#X st_fstype#` st_pad4#pcmd_mbc_buf_indexnnTcmd_mbc_buf_lennm(ukicmd_mbc_bufZlLcurr_cmdflagsnj0textlist string\# endstring\#tk_tlist,@tk_trial\+Htk_ipoint\*8tk_original\)<tk_text\(4literaln $cmd_offsetn cp\prompt_coln,cmd_colnuicmdbufnu _xmknodn!!!!u lstat64nH!!#uH stat64nq!M!# fstat64n!n!#u fstatat64n!n!!#!nui iino64_tiiNoff64_tNblkcnt64_tu1ii Bistat64e st_dev# st_pad1# st_ino# st_mode# st_nlink(# st_uid6# st_gidB#$ st_rdev#( st_pad2#, st_size#4 st_atim#< st_mtim#D st_ctim#L st_blksize#T st_blocks#X st_fstype #` st_pad41#pB fstatat64n!n!!e!nu lstat64n!!eu stat64n!!e fstat64n !n!e fchmodn(!n!"putstr#putchrn#getfractioni#is_dirn#fcomplete\#shell_quote\#get_meta_escape\#back_textlist\#forw_textlist\"init_textlist#editcharn#lgetenv\#in_mcan#is_combining_charn#is_wide_charn#is_ubin_charn#is_composing_charn#step_charL#is_utf8_well_formedn#utf_lenn#prutfchar\#prchar\"putbs"clear_eol"bell#ecalloc#save\u  strncpy\;!\!!u;uE strncmpnt!@!J!utsize_t strlen~!yu strcpy\!\!uu strcmpn!! mkstemp64n!\ mkstemp64n;!\$freeO!uO atoinq!Tiivtm$  tm_secn# tm_minn# tm_hourn# tm_mdayn# tm_monn# tm_yearn# tm_wdayn# tm_ydayn# tm_isdstn#  __wcsftime_xpg5~U!q!~!{!wchar_tUUe` __wcstok_xpg5`!`!j!oiwint_t __putwchar_xpg5! __putwc_xpg5!!%__getwchar_xpg5 __getwc_xpg52 ! __ungetwc_xpg5Y !!iY  __fputws_xpg5n !^ !c __fputwc_xpg5 !! __fgetws_xpg5` !`!n! __fgetwc_xpg5!! lockf64n*!!n!n!Nu*! truncate64nW!!/!!N tell64q!!nnssize_t}! pwrite64q!!!q!!!!!N} pread64q!!!q!!!!!N lseek64"!n!!n ftruncate64n,"!n!Nu," truncate64nY"!1"!N tell64_s"!n}s" pwrite64q!"!q!!x"!!N pread64q!"!q!!!!!N lseek64_"!n!_!n lockf64n#!n!n!N ftruncate64n@#!n!Nu@#uJ# attropen64n}#!E#!O#!n&u}# openat64n#!n!#!n&u# creat64n#!#!u# open64n$!#!n&u$u $ attropen64n?$!$!$!n&u?$ openat64np$!n!D$!n&up$ creat64n$!u$!u$ open64n$!$!n& ftello64$!$ fseeko64n %!c !N!nN % fsetpos64n7%!c !%N fgetpos64n^%!c !7%%tmpfile64uq%u{% freopen64%!v%!%!u%u% fopen64%!%!% ftello64_&!% fseeko64n'&!c !N!n filenonA&!c uA& snprintfnr&!\!!F&&Nr& fsetpos64n&!c !w& fgetpos64n&!c !7% fgets\&!\!n!c u& fprintfn'!c !&&u'u' freopen64I'!'!'!uI'uS' fopen64}'!N'!X' fclosen'!c %tmpfile64'fopen64''(fopen)fstat64'(fstat command.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g command.c -W0,-xp.XAKgoyL5sWrMEeN.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL5sWrMEeN.;backend;raw;cd;DBG_GEN 5.2.7IBchar"ungotp*;Lmshellcmd*=Hmcmd_execUUstart_mcaf%Uactiona*prompta mlistacmdflagsaintvoidin_mcap0fUmca_searchypUmca_opt_toggleUno_promptflagdash*exec_mcaŠPUcbuf* mca_char `U c p*! flag" buf# parg$ fB l l T , , o oname* lclong "long longLINENUMpargp_string*#p_int#p_linenum#PARG,optnameXoname*#onext'#] * uloption$oletter"#onames'#otype#odefault# ovarX#ofunc_#odescd#uclear_buffersDUmake_displaySU  T T ^ ^ save_top_scrolle save_ignore_eoifprompt{U p*|dispversion"U parggetcc0Uungetcc PUN c ungetscPU *s p*multi_search-U *pattern* n* nomore. save_ifile/ changed_file0commandsRU c action cbuf* newaction save_search_type extra* tbuf parg old_ifile new_ifile tagfile* *P *H *H H   ^ '^ '^ pos    pos "POSITIONpipec"Iqsave_hshiftGbottomposFoptgetnameEdoptflagD`optchar"CpfractionBtnumberAhsearch_type@\mca?X "d cungot :xgetchrntagsprevtag*nexttag*tagsearchcleantagspsignalsis_filteringset_filter_patternsearchclr_hiliteundo_searchclear_attnpr_string*eq_message*pr_expand*empty_screenpositionerrorputstrputchrflushfindopt_nameget_quit_at_eofopt_prompt*single_char_optiontoggle_optionget_swindowgomarksetmarkbadmarkpipe_marklsystemclr_linenumjump_locjump_line_locjump_percentrepaintjump_backjump_forwset_attnposget_filename*getoff_ifilenext_ifiledel_ifilebackwardforwardentire_file_displayedeof_displayedfexpand*reopen_curr_ifilereedit_ifileunsave_ifilesave_curr_ifileedit_indexedit_prevedit_nextedit_lastedit_firstedit_listedit_ifileediteditcharfcmd_decodeget_cmdbuf*cmd_intcmd_charcmd_acceptset_mlistlen_cmdbufcmd_putstrclear_cmdcmd_resetch_getflagsch_flushmatch_bracat_exitat_enterclear_botclear_eolbellcheck_winchquitsave*"runsigned|size_tstrlenw""strcmpmkstemp64*mkstemp64*free05tm$tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst# ?__wcsftime_xpg50:wchar_t$__wcstok_xpg5^).wint_t__putwchar_xpg5^^unsigned char__FILE_cnt#_ptr#_base#_flag# _file# __orientation|# __ionolock|#  __seekable|#  __extendedfd|#  __xf_nocheck|#  __filler|#  __putwc_xpg5^^__getwchar_xpg5^__getwc_xpg5^__ungetwc_xpg5^ ^ __fputws_xpg5?__fputwc_xpg5^e^__fgetws_xpg5e__fgetwc_xpg5^lockf64"truncate64off64_ttell640ssize_t>pwrite640s0C|pread6400s|lseek64ftruncate64"truncate64off_ttell64>>pwrite640s0C|pread6400s|lseek64lockf64ftruncate64 " "attropen64H "Hopenat64yM "yunsigned longcreat64~"open64 ""attropen64 "openat64L  "Lcreat64vQ"vopen64{ ftello64fseeko64fsetpos64fgetpos64:FILE:tmpfile64E"]"gfreopen64EblE""fopen64Eftello64fseeko64fsetpos64?fgetpos64a"a"kfreopen64EfpE""fopen64Etmpfile64E  cvt.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g cvt.c -W0,-xp.XAKgoyL5sWrMkfN.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL5sWrMkfN.;backend;raw;cd;DBG_GEN 5.2.7Zcvt_length0YUZZZlenZops intcvt_alloc_chpos,`UZlen*iZ-chpos.Zcvt_textAUodst;osrc; chpos;lenp;Zops;dstBsrcCsrc_endDchEYMMsrc_posZNdst_posZOcharunsigned long LWCHAR is_ansi_middleZ step_char put_wcharvoid) ecalloc1 Funsigned Psize_t strlen\K mkstemp64Z mkstemp64Zlong tm$mtm_secZ#tm_minZ#tm_hourZ#tm_mdayZ# tm_monZ#tm_yearZ#tm_wdayZ#tm_ydayZ#tm_isdstZ# m __wcsftime_xpg5\\rwchar_t  __wcstok_xpg5 wint_t __putwchar_xpg5#unsigned char#__FILE_cntZ#_ptr4#_base4#_flag## _file## __orientationP# __ionolockP#  __seekableP#  __extendedfdP#  __xf_nocheckP#  __fillerP#  9 __putwc_xpg5?__getwchar_xpg5 __getwc_xpg5x __ungetwc_xpg5 9 __fputws_xpg5Z __fputwc_xpg59 __fgetws_xpg5*Z __fgetwc_xpg5K towlowerg iswupperZlong long lockf64ZZZ  truncate64Z off64_t tell64 Z Zssize_t ) pwrite64 M P) pread64 | MP lseek64ZZ ftruncate64ZZ  truncate64Z off_t tell64 Z ) pwrite64 M   P pread64 w  MP lseek64 ZZ lockf64Z ZZ ftruncate64Z Z   attropen64Z"   Z " openat64ZS Z' Z S creat64Z} X  } open64Z  Z   attropen64Z   Z  openat64Z Z Z  creat64Z?   ? open64Zi D Z9 ftello64 i fseeko64Z Z  fsetpos64Z   fgetpos64Z  9FILE tmpfile64  & 0 freopen64 a + 5  a k fopen64  f p 9 ftello64  fseeko64Z Z  fsetpos64Z  fgetpos64Z*  * 4 freopen64 e / 9  e o fopen64  j t tmpfile64 S,decode.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g decode.c -W0,-xp.XAKgoyL5sWrMkgN.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL5sWrMkgN.;backend;raw;cd;DBG_GEN 5.2.7\unsigned charlong H1cmdtable9/Pm r1cmdtable_/Pmedittable9o Ƴ1edittableo char  tablelist  t_next# t_start# t_end#list_fcmd_tablesolist_ecmd_tablesolist_var_tablesolist_sysvar_tableso expand_special_keyscU; table ;len fmtoa;replklen;intinit_cmds$pUadd_cmd_tableE^U;tlistAbufA ;lenAtF add_fcmd_tableb`U buf_;len_ add_ecmd_tablenUPbufk;lenk add_var_table{Utlistwbufw ;lenwcmd_search U;>cmdtable endtable>sppqa; cmd_decode G U;tlistcmd >sptaction;fcmd_decodeP t U;cmd>sp ecmd_decode   U;Dcmd>sp lgetenv H Uvara;sgint-P  U;>sp+n;.old_lesskey<  U;buf9;len9 new_lesskeyR ]U;bufN;lenN ;sysvarNpSc;Tn;Ulesskey`XU;9filename;sysvar buflenFn1f;long long9POSITIONadd_hometable`Uenvnamedef_filename ;sysvarfilenameparg0 9LINENUMparg0 p_string# p_int;# p_linenum#PARGeditchar}U; ;c;flags action;nch;susercmd  1errorfilesizeFhomefileshell_unquoteungetscungetccgetcc;special_key_strsave o unsignedy size_tstrlen  t mkstemp64; mkstemp64;  getenv  void free+  calloc J y y 11 O tm$ tm_sec;# tm_min;# tm_hour;# tm_mday;# tm_mon;# tm_year;# tm_wday;# tm_yday;# tm_isdst;# Y __wcsftime_xpg5 . J  T  wchar_t . . > 9 __wcstok_xpg59 x 9 C H 1wint_t__putwchar_xpg5x  x __FILE _cnt;# _ptr # _base # _flag # _file # __orientationy # __ionolocky #  __seekabley #  __extendedfdy #  __xf_nochecky #  __fillery #  __putwc_xpg5x  x  __getwchar_xpg5x __getwc_xpg5x   __ungetwc_xpg5x x  1  __fputws_xpg5;H__fputwc_xpg5x nx  __fgetws_xpg59 9 ;n__fgetwc_xpg5x  lockf64;;;9 truncate64;99off64_ttell649;;ssize_t Gpwrite649|9Ly 9 pread6499|y 9lseek64;;ftruncate64;;9 truncate64;!99off_ttell64!G;read9i9|y  ipwrite6499ny 9pread6499|y 9lseek64!;!;lockf64;;;9ftruncate64;6;9close;O; O Yattropen64;T^;! openat64;;;! unsigned longcreat64; open64;";! " ,attropen64;_'1;! _openat64;;d;! creat64; open64;;! ftello64fseeko64;+9;9 +fsetpos64;W0 9fgetpos64;~W FILE ~ tmpfile64  freopen64  fopen64 ftello64!1fseeko64;W9;9 Wfsetpos64;\fgetpos64;W  freopen64  fopen64 tmpfile64"open647?#open$lseek64L#lseek6edit.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g edit.c -W0,-xp.XAKgoyL5sWrM0hN.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL5sWrM0hN.;backend;raw;cd;DBG_GEN 5.2.7yemknodUjj~_path_mode _devintcharqyunsigned longmode_tdev_tfd0joqcurr_altfilename/o init_textlist> Utlist;str; s? meta_quotedjA delim_quotedjB escC esclenjD textlist string# endstring# forw_textlistjU%tlistgprevg sk back_textlistLU|tlistprev sclose_filePU scrposlong longPOSITION scrpos  pos# lnj# edit eUj$filename edit_ifilep&Ujifile fj answerj no_displayj chflagsj filename open_filename qopen_filename alt_filename alt_pipe was_curr_ifile pargzzz`statbuf-rjvoidLINENUMparg p_string# p_intj# p_linenum#PARGlong 8unsigned long long8ino_tnlink_tuid_tgid_toff_ttime_t timespec tv_sec# tv_nsec#timestruc_tblksize_tblkcnt_tq - statN st_dev# st_pad1'# st_inoN# st_mode# st_nlinkZ# st_uidh# st_gidt#$ st_rdev#( st_pad2#, st_size#4 st_atim#< st_mtim#D st_ctim#L st_blksize#T st_blocks#X st_fstype #` st_pad4#pedit_list0Uj? filelistsave_ifilegood_filenamefilenamegfilelistgfilenametl_filestl_gfilesedit_firstUjedit_last Ujedit_istepUj hjn jdirnextedit_inextDUj hAjnA edit_nextKUjO jnIedit_iprevS0Uj hPjnP edit_prevZ0RUj jnXedit_indexd`Uj jnbhesave_curr_ifilexUunsave_ifile U` save_ifilereedit_ifileU save_ifilenextprevreopen_curr_ifileU save_ifileedit_stdin- Ujcat_file0 k UW cjuse_logfilep P"U filenameexistsjanswerjparg curr_altpipe0curr_inoN,curr_dev+jq _xmknodjT  % qT -lstat64j Y ^ q stat64j  ^ fstat64j j^ q fstatat64jj ^ jq 8ino64_t<off64_tblkcnt64_tql } stat64 st_dev# st_pad1 # st_ino# st_mode# st_nlinkZ# st_uidh# st_gidt#$ st_rdev#( st_pad2+#, st_size<#4 st_atim#< st_mtim#D st_ctim#L st_blksize#T st_blocksJ#X st_fstype[#` st_pad4l#p}fstatat64jjjqlstat64jqstat64j$fstat64jDjclr_hiliteget_scrpospos_clearqueryjerrorputchrjflusherrno_messagelastmarkclr_linenumheld_ifilejhold_ifileopenedjset_openget_posstore_posget_indexjget_filenameget_ifileprev_ifilenext_ifiledel_ifilebad_fileclose_altfileopen_altfilelglobbin_filejget_meta_escapeshell_unquoteungetsccmd_addhistch_getflagsjch_closech_initch_forw_getjend_logfilequitskipspsaveqqunsignedstrncmpjqsize_tstrlen&q&q0strcmpjY+5mkstemp64jvmkstemp64jfree tm$O tm_secj# tm_minj# tm_hourj# tm_mdayj# tm_monj# tm_yearj# tm_wdayj# tm_ydayj# tm_isdstj# O__wcsftime_xpg5Twchar_t__wcstok_xpg5wint_t__putwchar_xpg5unsigned char __FILE  _cntj# _ptr# _base# _flag# _file# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  __putwc_xpg5!__getwchar_xpg5__getwc_xpg5Z__ungetwc_xpg5__fputws_xpg5j__fputwc_xpg5__fgetws_xpg5 j__fgetwc_xpg5-lockf64jRjjqRtruncate64jWtell64<jjssize_tpwrite64pread64 lseek64<0j<jftruncate64jTjqTtruncate64jYtell64jpwrite64pread64lseek64jjlockf64jDjjisattyj^jftruncate64jjclosejjqqattropen64jj qopenat64j jj q creat64j3q3open64j]8j q]qgattropen64jblj qopenat64jjj qcreat64jqopen64jj ftello64<@fseeko64jfjffsetpos64jkfgetpos64jFILE tmpfile64qqfreopen64qq!fopen64K&ftello64lKfseeko64jjfsetpos64jfgetpos64jqqfreopen64qq%fopen64O *tmpfile64!open64rz"open!creat64"creat!lseek64"lseek#stat64"statifilename.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g filename.c -W0,-xp.XAKgoyL5sWrM0iN.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL5sWrM0iN.;backend;raw;cd;DBG_GEN 5.2.7pmknodP"x"Urr_path_mode _devintcharyunsigned longmode_tdev_tshell_unquoteE"#UVVVstrC nameVF pVG "# $## $## escVY esclenrZyget_meta_escapek##UV sVl metacharsy#6$UV mcharsVzo metachar@$l$Urycshell_quotep$!&UVVs pV newstrV lenr escV esclenr use_quotesr have_quotesr dirfile0&6'UV\VdirnameVfilename pathnameV qpathnameV lenr fr homefile @''UV Vfilename pathnameV  fexpand='*UV; Vs;frV>toV>nr?eV@ifileCAvoid; fcomplete **UV VsfpatVqsV <*~*lenr bin_file+,Ur rfnrbin_countrdatapVpendV +k, +Y, +Y,clongyLWCHARseek_filesize,,U rfsposlong longPOSITIONoff_treadfd ,&.UV fd lenrchrbufVpVunsigned charunsigned__FILE_cntr#_ptr#_base#_flag# _file# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  FILEshellcmd>0.N/U Vcmd<fd?shellVB K.@/ g.'/ g.'/scmdVGesccmdVH x.'/ .'/ .'/lenrT lglobqP/1UVk VfilenameogfilenameVrofilenameVs /1fdsVlessechoVcmdVescVlenr open_altfile113UVr Vfilename- r pf- w pfd-lessopenV5cmdV6lenr7fd8returnfdr: 033 833 833fricyjrCclose_altfile44U2 Valtfilename Vfilename CpipefdlesscloseVfdcmdVlenr is_dir55Ur Vfilenameisdirr !5s5rrstatbuf  unsigned long long ino_tnlink_tuid_tgid_t time_ttimespecX tv_sec #tv_nsec#( timestruc_tblksize_tblkcnt_ty  statst_dev#st_pad1 #st_ino #st_mode#st_nlink #st_uid # st_gid #$st_rdev#(st_pad2 #,st_size#4st_atimX #<st_mtimX #Dst_ctimX #Lst_blksizej #Tst_blocksz #Xst_fstype #`st_pad4 #p bad_file56UV VfilenamemV 56 56 56is_a_diro 66 66rrstatbuf  *66 H66 H66 \66 \66 n66 n66not_regpyy*) filesize 67UP rf statbuf  shell_coption! 747UVryx_xmknodrs}y lstat64rystat64rfstat64r$ry$fstatat64rZr)ryZ u ino64_toff64_tblkcnt64_ty stat64st_dev#st_pad1d#st_inou#st_mode#st_nlink #st_uid # st_gid #$st_rdev#(st_pad2#,st_size#4st_atimX #<st_mtimX #Dst_ctimX #Lst_blksizej #Tst_blocks#Xst_fstype#`st_pad4#pfstatat64r)r_ry)lstat64rS.ySstat64r|Xfstat64rrerrno_messageVis_ansi_middlerget_filenameVlgetenvVstep_charbinary_charrseekablerch_ungetcharecallocCsaveVySstrchrV|Xry|ystrncmprysize_tstrlenystrcpyVVyystrcmprByBstrcatVkVGmkstemp64rVmkstemp64rVfreeCcallocCtm$ tm_secr#tm_minr#tm_hourr#tm_mdayr# tm_monr#tm_yearr#tm_wdayr#tm_ydayr#tm_isdstr# __wcsftime_xpg5wchar_t__wcstok_xpg5wint_t __putwchar_xpg56__putwc_xpg5`6__getwchar_xpg5__getwc_xpg56__ungetwc_xpg56__fputws_xpg5r__fputwc_xpg56__fgetws_xpg5Kr__fgetwc_xpg5l6lockf64rrrytruncate64rtell64rrssize_t;pwrite64;pread64Jlseek64orrftruncate64rrytruncate64rtell64rread;pwrite641pread64[lseek64rrlockf64rrrftruncate64rrcloserryyattropen64rryopenat64rPr$ryPcreat64rzUyzopen64rryyattropen64rryopenat64rrrycreat64r<y<open64rfArftello64ffseeko64rrfsetpos64rfgetpos64rtmpfile64yyfreopen64N"yNyXfopen64S]ftello64fseeko64rrpcloseryypopenfilenor/y/snprintfr`V4__filbufr||fsetpos64rfgetpos64rysprintfrVyyfreopen640y0y:fopen64d5?tmpfile64 open64!open lseek64!lseek fstat64!fstat"stat64!stat8xforwback.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g forwback.c -W0,-xp.XAKgoyL6sWrMkjN.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL6sWrMkjN.;backend;raw;cd;DBG_GEN 5.2.7}intno_back_scroll$4peof_bell-@7[7Ueof_displayed9`77U$pos:long longPOSITIONentire_file_displayedT8v8U$posUsquish_checkh88U forw8;U $ny posy $forcey $only_lasty $nblankyeof$nlines$do_repaint$first_time$0p back$;<Uj $n pos $force $only_last nlines$% do_repaint$& forwardX<=U $nT $forceT $only_lastT posY backward=\>U5 $n $force $only_last posget_back_scroll`>>U$forw_prompt$$squished$screen_trashed$empty_lines$empty_screen$pos_clearadd_back_posadd_forw_pospositionputstrput_lineget_quit_at_eof$LINENUMcurrlineErepaintback_lineforw_lineedit_next$ch_getflags$ch_lengthclearbellvbelllower_leftadd_linehomequitcharmkstemp64$Amkstemp64$^long^unsignedksize_t^tm$'tm_sec$#tm_min$#tm_hour$#tm_mday$# tm_mon$#tm_year$#tm_wday$#tm_yday$#tm_isdst$# '__wcsftime_xpg5wcfw,wchar_tccsn__wcstok_xpg5nnx}^wint_t__putwchar_xpg5unsigned char__FILE_cnt$#_ptr#_base#_flag# _file# __orientationk# __ionolockk#  __seekablek#  __extendedfdk#  __xf_nocheckk#  __fillerk#  __putwc_xpg5__getwchar_xpg5__getwc_xpg52 __ungetwc_xpg5Y ^Y __fputws_xpg5$ ^ c __fputwc_xpg5 __fgetws_xpg5n n$ __fgetwc_xpg5 lockf64$* $$* truncate64$W / off64_ttell64W  $$ssize_tvoid  pwrite64    k pread64    klseek64W  $W $ftruncate64$B $B truncate64$o G off_ttell64o  $  pwrite64    kpread64    klseek64o  $o $lockf64$> $$ftruncate64$b $b l attropen64$ g q $ openat64$ $ $ unsigned longcreat64$    open64$5  $5 ? attropen64$r : D $r openat64$ $w $ creat64$    open64$  $ftello64W  fseeko64$>c $>fsetpos64$jc Cfgetpos64$c jFILEtmpfile64freopen64fopen64#ftello64o D#fseeko64$jc $jfsetpos64$c ofgetpos64$c jfreopen64fopen64'tmpfile64 help.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g help.c -W0,-xp.XAKgoyL6sWrMUkN.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL6sWrMUkN.;backend;raw;cd;DBG_GEN 5.2.7Ncharlong$+D)+helpdata1hint\size_helpdatac@0mkstemp64\ mkstemp64\ )unsigned size_t) tm$ tm_sec\# tm_min\# tm_hour\# tm_mday\# tm_mon\# tm_year\# tm_wday\# tm_yday\# tm_isdst\# __wcsftime_xpg5    wchar_t__wcstok_xpg5     )wint_t__putwchar_xpg5 ; unsigned char; __FILE- _cnt\# _ptrL# _baseL# _flag;# _file;# __orientation#  __ionolock#   __seekable#   __extendedfd#   __xf_nocheck#   __filler#  Q__putwc_xpg5 W  -__getwchar_xpg5 __getwc_xpg5  -__ungetwc_xpg5   -)Q__fputws_xpg5\  __fputwc_xpg5   -Q__fgetws_xpg5B  \ __fgetwc_xpg5 c -long longlockf64\ \ \ ctruncate64\  c coff64_ttell64 \ \ssize_tvoidpwrite645    cpread64d  5  clseek64 \  \ftruncate64\ \ ctruncate64\  c coff_ttell64 \pwrite645    cpread64_  5  clseek64 \  \lockf64\ \ \ cftruncate64\ \ cattropen64\    \ openat64\; \  \;unsigned longcreat64\v @ Evopen64\ { \attropen64\   \openat64\ \  \ creat64\8  E8 open64\b = \Qftello64 b fseeko64\  c \c fsetpos64\  cfgetpos64\  QFILE tmpfile64  ) freopen64 Z $ .  Z d fopen64  _ i Qftello64 fseeko64\  c \c fsetpos64\  fgetpos64\#  # - freopen64 ^ ( 2  ^ h fopen64  c m tmpfile64 ifile.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g ifile.c -W0,-xp.XAKgoyL6sWrMElN.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL6sWrMElN.;backend;raw;cd;DBG_GEN 5.2.7ifile(h_next#h_prev#h_filename#h_filestate# h_index#h_hold#h_opened#h_scrpos#charvoidintlong longPOSITIONscrpos pos#ln#anchor08pifiles2`p incr_index8>>U} p5 incr5 link_ifileD?i?U pA prevA unlink_ifile]p??U p[ new_ifilen?)@U9 filenamek prevk po del_ifile0@@Uu hp next_ifile@@U hp prev_ifileANAU hp getoff_ifilePAAUE ifilenewifilenifileɰAAU find_ifileA'BU filenamep get_ifile0BmBU filename prev p get_filenamepBBU3 ifile get_indexBBUf ifilestore_pos BBUifilescrpos Cget_posBBUifilescrpos Cset_open CCU+ifileopened*C%CU]ifile(hold_ifile20CDCUifile/incr/ held_ifile9PCdCUifile7get_filestate@pCCUifile>set_filestateHCCUXifileEfilestateE unmarkecallocsavestrcmpmkstemp64mkstemp64freelongunsignedsize_t'tm$tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst# 1__wcsftime_xpg5  ,wchar_t    __wcstok_xpg5 P    wint_t__putwchar_xpg5P  P unsigned char __FILEr _cnt#_ptr #_base #_flag # _file # __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#   __putwc_xpg5P  P r __getwchar_xpg5P __getwc_xpg5P  r __ungetwc_xpg5P  P r   __fputws_xpg51   __fputwc_xpg5P W P r  __fgetws_xpg5   W __fgetwc_xpg5P  r lockf64  truncate64  off64_ttell64 " ssize_t0 pwrite64" e " 5 pread64"  " e lseek64   ftruncate64  truncate64  off_ttell64 0 0 pwrite64" e " 5 pread64"  " e lseek64   lockf64 ftruncate64  attropen64: :openat64k?kunsigned longcreat64puopen64attropen64  openat64>>creat64hCuhopen64m ftello64 fseeko64 fsetpos64 fgetpos64,  FILE,tmpfile647OYfreopen647T^7fopen647 ftello64 fseeko64 fsetpos641  fgetpos64S S]freopen647Xb7fopen647tmpfile6470input.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g input.c -W0,-xp.XAKgoyL6sWrM0lN.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL6sWrM0lN.;backend;raw;cd;DBG_GEN 5.2.7forw_line0CHUcurr_pos.base_pos1new_pos2c3blankline4endline5backchars6long longPOSITIONintback_lineHUMUcurr_posnew_posbegin_new_posbase_poscendlinebackcharsset_attnpos`MCNUpos c is_filtering prep_hilite is_hilited is_filtered null_line set_status_col pdone pflushmbc pappend pshift_all plinenum prewind ch_back_get ch_forw_get ch_tell ch_seekchar  mkstemp649 mkstemp64Vlong Vunsignedcsize_tV |tm$tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst#   __wcsftime_xpg5o[^o$wchar_t [[ k f __wcstok_xpg5ffpuVwint_t __putwchar_xpg5unsigned char __FILE_cnt#_ptr#_base#_flag# _file# __orientationc# __ionolockc#  __seekablec#  __extendedfdc#  __xf_nocheckc#  __fillerc#   __putwc_xpg5__getwchar_xpg5 __getwc_xpg5* __ungetwc_xpg5QV Q  __fputws_xpg5V[ __fputwc_xpg5  __fgetws_xpg5ff __fgetwc_xpg5 lockf64" " truncate64O'off64_t tell64Owssize_tvoid  pwrite64wwc  pread64wwc lseek64O O ftruncate64:  : truncate64g ? off_t tell64g   pwrite64w w c pread64w wc lseek64g  g  lockf646  ftruncate64Z  Z  d attropen64 _ i  openat64   unsigned long creat64     open64-   -  7 attropen64j 2 <  j openat64 o  creat64    open64    ftello64O  fseeko646 [ 6 fsetpos64b [;  fgetpos64 [b FILE tmpfile64   freopen64       fopen64     ftello64g <  fseeko64b [ b fsetpos64 [g fgetpos64 [b   freopen64       fopen64   tmpfile64 jump.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g jump.c -W0,-xp.XAKgoyL6sWrMknN.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL6sWrMknN.;backend;raw;cd;DBG_GEN 5.2.7jump_forwPN OUeposr end_posr!long longePOSITIONjump_backFOOUlinenumDposrGparg9HeLINENUMcharintparg9 p_string# p_int# p_linenum#PARGrepaintfP/PUwscrposwg scrpos  posr# ln#jump_percentx0PQU percentu fractionu posrylenrylongjump_line_locQQUdrposslinecjump_locQTUrposslinenlinetposrbposr repaint_hilite adjsline get_scrpos onscreen pos_clear add_back_pos positionr ierror error percent_posr lastmark find_posr set_attnpos back_liner forw_liner back forw ch_back_get ch_forw_get ch_tellr ch_lengthr ch_beg_seek ch_end_seek ch_seek clear home mkstemp64 mkstemp64 unsignedsize_t  tm$n tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# n __wcsftime_xpg5swchar_t __wcstok_xpg5 wint_t __putwchar_xpg5$unsigned char$ __FILE _cnt# _ptr5# _base5# _flag$# _file$# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  : __putwc_xpg5@__getwchar_xpg5 __getwc_xpg5y __ungetwc_xpg5 : __fputws_xpg5 __fputwc_xpg5: __fgetws_xpg5+  __fgetwc_xpg5L  lockf64q eq truncate64 v eeoff64_t tell64  ssize_tvoid  pwrite64    e pread64 @   e lseek64 e   ftruncate64 e truncate64  eeoff_t tell64    pwrite64    e pread64 ;   e lseek64 `   lockf64 e ftruncate64 e  attropen64    openat64   unsigned long creat64R  ! R open64| W |  attropen64    openat64   creat64  !  open64>  : ftello64 _ > fseeko64 ee fsetpos64  e fgetpos64  :FILE tmpfile64   freopen64 6  6@ fopen64 j;E: ftello64 j fseeko64ee fsetpos64 fgetpos64   freopen64 : :D fopen64 n?Itmpfile64 line.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g line.c -W0,-xp.XAKgoyL6sWrMkpN.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL6sWrMkpN.;backend;raw;cd;DBG_GEN 5.2.7charlinebuf$dpattr$hpintsize_linebufRlplongRutabstops}|pntabstopsRxptabdefaultRplast_overstrikeR#ppmbc_buf_lenRAtpmbc_buf_indexRBqinit_lineJTuUU expand_linebuf]UpVURnew_sizeR_new_buf$fnew_attr$g is_ascii_charpVVUR chunsigned long LWCHARprewindVWU plinenumWYU poslinenumiRWXWXWXbufnRlong long POSITION LINENUMupshift Y@^U) Rshiftprev_chc)shiftedRtoRfromRlenRwidthRprev_attrRnext_attrRY]Y]Y]Z[Zw[Zw[chunsigned charpshift_allg@^U^Uattr_swidthr`^^URRapwRsattr_ewidth^u_URRawRpwidth_ aUR>chRa prev_chwRbackca3bURprev_chp$chwidthRin_ansi_esc_seq@bbURp$Fbb_bb_bbchis_ansi_endbcURPchis_ansi_middle# ccURch!store_char9c,fURch4Ra4 $rep4pos4wR:replenR;cs<ccmatchesRDcedddddd4dd4ddp$UbchVdedededep$gprev_chhstore_tab0fegURa Rattrpos to_tabRiRstore_prcharpgHhUR cpos s$flush_mbc_bufPhhUR posiRpappendh lURM cpos rRdo_appendMlpUR chI$repI posIaRNprev_chOFnppnppnppXoppXoppo?po?ps$pflushmbcppURT rRpdonep sU RendlineRforw aqq|qq|qqp$set_status_col1s0sU c/gline?0ssUR0 Ri<0 ap< Rnull_line]ssUforw_raw_linelsuU curr_posh lineph0 line_lenphnRmcRnnew_poso$back_raw_line uwUcurr_pos linep0 line_lenpnRcRnew_posuvuvuv vvvvvvold_size_linebufRfm$to$mbc_posC(;umbc_buf*@mid_ansi_chars$)end_ansi_chars$(pendpos' pendc&lmarginR%is_null_lineR$overstrikeR"columnR currRhshiftR`cshiftRlinenumtoais_hilitedRfind_linenumlgetenv$is_combining_charRis_wide_charRis_ubin_charRis_composing_charRstep_charget_wcharis_utf8_well_formedRutf_lenRprutfchar$prchar$control_charRch_back_getRch_forw_getRch_tellch_seekRapply_at_specialsRis_at_equivRvoidecallocstrchr$9R9unsigned Csize_tstrlenOv>vmemcpy{Cmkstemp64R$mkstemp64R$freecallocCCuutm$tm_secR#tm_minR#tm_hourR#tm_mdayR# tm_monR#tm_yearR#tm_wdayR#tm_ydayR#tm_isdstR#  __wcsftime_xpg5OOwchar_t__wcstok_xpg5?  uwint_t__putwchar_xpg5?o?)__FILEP_cntR#_ptro#_baseo#_flag)# _file)# __orientationC# __ionolockC#  __seekableC#  __extendedfdC#  __xf_nocheckC#  __fillerC#  t__putwc_xpg5?z?P__getwchar_xpg5?__getwc_xpg5?P__ungetwc_xpg5??Put__fputws_xpg5R__fputwc_xpg5?5?Pt__fgetws_xpg5eR5__fgetwc_xpg5?Plockf64RRRtruncate64R off64_ttell64R Rssize_tpwrite64CCpread64rCClseek64RRftruncate64RRtruncate64R off_ttell64Rpwrite64CCpread64mCClseek64RRlockf64RRRftruncate64RRattropen64RR openat64RIRR Icreat64RsNsopen64RxR attropen64RR openat64R RR  creat64R55open64R_:R tftello64_fseeko64RRfsetpos64Rfgetpos64R tFILEtmpfile64&freopen64W!+Wafopen64\ftftello64fseeko64RRfsetpos64Rfgetpos64R  sprintfRK$% KUfreopen64PZfopen64tmpfile64linenum.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g linenum.c -W0,-xp.XAKgoyL6sWrMUqN.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL6sWrMUqN.;backend;raw;cd;DBG_GEN 5.2.7clr_linenumNwwUTpTOlong longYPOSITIONYLINENUMlinenum_info nextT#prevT#posf#gapf#lineu# calcgapkwxU Tpiadd_lnumxyU ulinenum} fpos}pTnewTnextpTprevpTmingapf longloopmessageyyU longishy@zU abort_long@zrzU find_linenum zN~Uue fpos pT linenumucposf find_posP~]Uf ulinenum}pTcposfclinenumu currline`fUuO OwhereposflenflinenumuintlongstartimeV\loopcountOXspareTB4VpoolA0freelistT@0anchor?8positionfierrorerrorget_timeVback_raw_linefforw_raw_linefch_lengthfch_seekOcharxmkstemp64Omkstemp64OVunsignedsize_tVtm$tm_secO#tm_minO#tm_hourO#tm_mdayO# tm_monO#tm_yearO#tm_wdayO#tm_ydayO#tm_isdstO# __wcsftime_xpg5wchar_t__wcstok_xpg5Vwint_t__putwchar_xpg56unsigned char6__FILE(_cntO#_ptrG#_baseG#_flag6# _file6# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  L__putwc_xpg5R(__getwchar_xpg5__getwc_xpg5(__ungetwc_xpg5(VL__fputws_xpg5O__fputwc_xpg5 (L__fgetws_xpg5= O __fgetwc_xpg5^ (lockf64O OOYx truncate64O  YYoff64_ttell64  OOssize_tvoid  pwrite64 #   Y pread64 R  # Ylseek64 w O Oftruncate64O OYx truncate64O  YYoff_ttell64  O  pwrite64 #   Ypread64 M  # Ylseek64 r O Olockf64O OOYftruncate64O OYx x attropen64O   Ox openat64O) O Ox) unsigned longcreat64Od . 3 xd open64O i Ox x attropen64O   Ox openat64O O Ox creat64O&  3 x& open64OP + OLftello64 q P fseeko64O YOY fsetpos64O  Yfgetpos64O  LFILE tmpfile64 x xfreopen64 H xHxRfopen64 |MWLftello64 |fseeko64OYOYfsetpos64Ofgetpos64O xxfreopen64 L  xLxVfopen64 Q[tmpfile64 kLlsystem.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g lsystem.c -W0,-xp.XAKgoyL6sWrMEsN.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL6sWrMEsN.;backend;raw;cd;DBG_GEN 5.2.7lsystem-pU5=cmd*=donemsg* inpB.shell=0p=1save_ifileQ3;iiiesccmd=lenBchar5intvoidIpipe_markaUBBc=cmd mpos tpos bposlong long POSITIONpipe_data$pUB =cmd  spos  epos  f% cB& popen  unsigned charunsigned__FILE}_cntB#_ptr#_base#_flag# _file# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  FILE}55 B Bsignal B init_signalswinchpositionerrorget_returnputstrputchrBflushmarkposshell_coption=shell_quote=reedit_ifilesave_curr_ifileQedit_ifileBlgetenv=ch_forw_getBch_seekBclear_botdeinitinitraw_modeecallocQsave=5C size_tstrlenMt Hmkstemp64B =mkstemp64B =5systemB free Qlongtm$tm_secB#tm_minB#tm_hourB#tm_mdayB# tm_monB#tm_yearB#tm_wdayB#tm_ydayB#tm_isdstB# __wcsftime_xpg5M  M  wchar_t__wcstok_xpg5    wint_t__putwchar_xpg5L __putwc_xpg5v  L__getwchar_xpg5__getwc_xpg5 L__ungetwc_xpg5  L__fputws_xpg5B  __fputwc_xpg51  L__fgetws_xpg5a  B 1 __fgetwc_xpg5 Llockf64B B B 5 truncate64B  off64_ttell64  B Bssize_tI pwrite64 ?   Ipread64 n ?  lseek64  B Bftruncate64B B 5 truncate64B  off_ttell64  BI pwrite64 ?   pread64 i ?  lseek64  B Blockf64B B B ftruncate64B B dupB BcloseB B5 5 attropen64BD  B5D openat64Bu B I B5u unsigned longcreat64B z  5 open64B B5 5 attropen64B B5 openat64BH B  B5H creat64Br M  5r open64B w Bftello64  fseeko64B   B fsetpos64B  fgetpos64B6  tmpfile645I5Sfreopen64 N X 55fopen64  ftello64  fseeko64B   BpcloseB popen7  57snprintfBh =  <__flsbufB B fsetpos64B  fgetpos64B  55freopen64   55fopen64F  !tmpfile64open64eopenmark.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g mark.c -W0,-xp.XAKgoyL6sWrM0sN.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL6sWrM0sN.;backend;raw;cd;DBG_GEN 5.2.7init_mark(ՉULiL)intgetumark5GULc3voidlong longPOSITION scrpos  pos# lnL# mark m_ifile# m_scrpos#getmarkHPUOLcFmIsmJ badmarkUL|LcsetmarkEULcmscrpos ClastmarkPU scrpos CgomarkUaLcmscrpos C markpos琍 ULcmunmarkfUifileiLlongP4marks!`get_scrposerrorjump_locedit_ifileLch_getflagsLch_tellch_end_seekLchar{mkstemp64Lmkstemp64Lunsignedsize_t tm$ tm_secL# tm_minL# tm_hourL# tm_mdayL# tm_monL# tm_yearL# tm_wdayL# tm_ydayL# tm_isdstL# __wcsftime_xpg5wchar_t__wcstok_xpg5 wint_t__putwchar_xpg5 9 unsigned char9 __FILE+ _cntL# _ptrJ# _baseJ# _flag9# _file9# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  O__putwc_xpg5 U +__getwchar_xpg5 __getwc_xpg5 +__ungetwc_xpg5  +O__fputws_xpg5L__fputwc_xpg5  +O__fgetws_xpg5@L__fgetwc_xpg5 a+lockf64LLL{truncate64Loff64_ttell64LLssize_tpwrite64 pread64M  lseek64r LLftruncate64L L{ truncate64L  off_ttell64  L pwrite64  pread64H  lseek64 m L Llockf64L LLftruncate64L L{ { attropen64L   L{ openat64L$ L L{$ unsigned longcreat64L_ ) . {_ open64L d L{ { attropen64L   L{ openat64L L L{ creat64L!  . {! open64LK & LOftello64l K fseeko64L L fsetpos64L  fgetpos64L  OFILE tmpfile64 { { freopen64 C    {C {M fopen64 w H R Oftello64  w fseeko64L L fsetpos64L  fgetpos64L  { {freopen64 G {G{Qfopen64 {LVtmpfile64  !optfunc.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g optfunc.c -W0,-xp.XAKgoyL6sWrMUuN.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL6sWrMUuN.;backend;raw;cd;DBG_GEN 5.2.7߲char"tagoption*<qopt_oPpuUtypeM*sM pargQintlong longLINENUM parg p_string*# p_int# p_linenum#PARGopt__OU4type}*s} opt_lUtype*s errnt*opt_j Ustype*s pargbuf{lenerr & ,p ,p , | |slinelong " scalc_jump_slineݐUopt_shift!Utype*s pargbuflenerr Ƒ ̑ ̑ ̑b b bhs " scalc_shift_count0[Uopt_k(`Utype%*s% parg)opt_t@wUjtype=*s= save_ifilerAposwBvoidjPOSITIONopt__TiUtypef*sf pargjopt_pFUtype*s opt__PPUstype*s protosparg*opt_bUtype*s opt_iUtype*s opt__V0ٗU$type*s opt_xdUtypea*sa msghiipj  p p   ns "sopt_quoteqU[type*s buf[parg "l sopt_queryUtype*s get_swindowЛUedit_tagfiletagsearchwfindtagchg_caselesserrorputstrgetfractionsgetnumjump_loclglob*use_logfilereedit_ifileunsave_ifilesave_curr_ifilerlesskeyungetscdispversionch_getflagsch_setbufspacesync_logfilequitskipsp*save*"4 unsigned> size_tstrlenJ q 9 "q strcpy* *v " strcat* * mkstemp64 *mkstemp64 *free rss tm$ tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst#   __wcsftime_xpg5J   J   wchar_t    __wcstok_xpg5 ?    swint_t__putwchar_xpg5? o ? unsigned charo __FILEa _cnt# _ptr # _base # _flago # _fileo # __orientation> # __ionolock> #  __seekable> #  __extendedfd> #  __xf_nocheck> #  __filler> #   __putwc_xpg5?  ? a __getwchar_xpg5? __getwc_xpg5?  a __ungetwc_xpg5?  ? a s  __fputws_xpg5   __fputwc_xpg5? F? a  __fgetws_xpg5 v F__fgetwc_xpg5? a lockf64"truncate64off64_ttell64ssize_tjpwrite64T$> jpread64T> lseek64ftruncate64"truncate64off_ttell64jpwrite64T$> pread64~T> lseek64lockf64ftruncate64""attropen64)")openat64Z."Zunsigned longcreat64_d"open64""attropen64"openat64-"-creat64W2d"Wopen64\ ftello64fseeko64 fsetpos64 fgetpos64  FILEtmpfile64&">"Hfreopen64&yCM&"y"fopen64&~ ftello64fseeko64 fsetpos64  fgetpos64B "Bsprintfm*G"m"wfreopen64&r|&""fopen64&tmpfile64&?"option.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g option.c -W0,-xp.XAKgoyL6sWrMUvN.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL6sWrMUvN.;backend;raw;cd;DBG_GEN 5.2.7intplusoption qscan_option+$U)1s)o,optc -optname1.printopt1/str10set_default 1lc 2err 3parga4char);optnameg oname1# onext6#  llong 1  sloption$ oletter)# onames6# otype # odefault # ovarg# ofuncn# odesc{#long long LINENUMparga p_string1# p_int # p_linenum# #PARGtoggle_option PU) c1s  how_toggleo num no_prompt err pargaflip_tripleХ)U k val lc propt0eU1 cbufĞ ) ssingle_char_optionpU  coopt_promptU1K coisoptpending ,U nostring0OU1printoptparganopendoptPtUoptstring.U1L1s)Lp_str) 1printopt)1validchars)p1/1num_errorVU 1printoptSgerrpS pargaWgetnumr U 8Lspn1printoptn gerrpns1sn tneg ugetfraction UsLsp1printopt gerrps1fracsfraclen get_quit_at_eofҫU pendoptchg_hiliterepaint_hiliteerrorfindopt_namefindoptungetscprchar1quitskipsp1voidecallocsave1)strchr1 )unsignedstrncpy1 1mkstemp64 9 1mkstemp64 V 1s size_tsh tm$ tm_sec # tm_min # tm_hour # tm_mday # tm_mon # tm_year # tm_wday # tm_yday # tm_isdst # r  __wcsftime_xpg5[ G V [ m  wchar_tG G W R __wcstok_xpg5R  R \ a swint_t__putwchar_xpg5   unsigned char __FILE _cnt # _ptr # _base # _flag # _file # __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#   __putwc_xpg5    __getwchar_xpg5 __getwc_xpg5   __ungetwc_xpg5 =   s=  __fputws_xpg5 r B G __fputwc_xpg5     __fgetws_xpg5R  R   __fgetwc_xpg5   lockf64    ) truncate64 ;   off64_ttell64; c   ssize_tq pwrite64c  c v pread64c  c  lseek64;   ;  ftruncate64  )truncate64 K# off_ttell64Kq qpwrite64c c vpread64c c  lseek64K K lockf64   ftruncate64 > )>)Hattropen64 {CM ){openat64   )unsigned longcreat64 )open64  ))attropen64 N  )Nopenat64  S )creat64 )open64   ftello64; fseeko64 G  fsetpos64 FG fgetpos64 mG F FILEmtmpfile64x))freopen64xx))fopen64x ftello64K fseeko64 FG  Ffsetpos64 rG Kfgetpos64 G F)sprintf 1))freopen64xx))fopen64x. tmpfile64x$opttbl.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g opttbl.c -W0,-xp.XAKgoyL6sWrM0wN.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL6sWrM0wN.;backend;raw;cd;DBG_GEN 5.2.7Elongjump_sline_fraction +@wshift_count_fraction ,Dwintless_is_moreo< qcharoptnameoname#onext#a_optnameAHwb_optnameBPwB__optnameCXwc_optnameD`wd_optnameEhwe_optnameIpwf_optnameJxwF__optnameKwg_optnameMwh_optnameOwi_optnamePwj_optnameQwJ__optnameRwk_optnameTwK__optnameVwL__optnameWwm_optnameXwn_optnameYwo_optname[wO__optname\wp_optname^wP__optname_wq2_optname`wq_optnameaxr_optnamebxs_optnamecxS__optnamedxt_optnamef xT__optnameg(xu_optnamei0xV__optnamej8xw_optnamek@xx_optnamelHxX__optnamemPxy_optnamenXxz_optnameo`xquote_optnamephxtilde_optnameqpxquery_optnamerxxpound_optnamesxkeypad_optnametxoldbot_optnameuxfollow_optnamevxo   loption$oletter#onames#otypeo#odefaulto# ovar#ofunc #odesc#  optionq 0 +optionqinit_option{U(o(p findoptU(noco(is_optchar`Uocfindopt_name`)U(p_optname p_oname  p_err optnameo(onamelenouppercaseomaxo(maxonamemaxlenoambigoexactohilite_searcho9oldboto7hfollow_modeo6Dquit_on_intro5use_lessopeno4status_colo3shift_counto2Ȫshow_attno1Ttwiddleo0no_keypado/(no_inito. choplineo-$jump_slineo*,swindowo)تforce_openo(ctldispo'Ԫbufspaceo&autobufo%linenumso$caselesso#forw_scrollo"\back_scrollo!Xtabstopo ̪squeezeoЪquit_if_one_screeno quit_at_eofo know_dumboPbs_modeopr_typeoptop_scrollo8how_searcho<quietoopt_queryopt_quoteopt_xopt__Vopt_iopt_bopt__Popt_popt__Topt_topt_kopt_shiftopt_jopt_lopt__Oopt_olgetenvsprefixo unsigned size_tstrlen   mkstemp64o2 mkstemp64oO   T tm$ tm_seco#tm_mino#tm_houro#tm_mdayo# tm_mono#tm_yearo#tm_wdayo#tm_ydayo#tm_isdsto# ^  __wcsftime_xpg5 3O  Y  wchar_t33C>__wcstok_xpg5>}>HM wint_t__putwchar_xpg5}}unsigned char__FILE_cnto#_ptr#_base#_flag# _file# __orientation # __ionolock #  __seekable #  __extendedfd #  __xf_nocheck #  __filler #  __putwc_xpg5}}__getwchar_xpg5}__getwc_xpg5}__ungetwc_xpg5})} )__fputws_xpg5o^.3__fputwc_xpg5}}__fgetws_xpg5>>o__fgetwc_xpg5}long longlockf64oootruncate64o4 off64_ttell644\oossize_tvoidjrpwrite64\\w jpread64\\ lseek644o4oftruncate64ootruncate64oL$off_ttell64Lrojrpwrite64\\w pread64\\ lseek64LoLolockf64oooftruncate64o?o?Iattropen64o|DNo|openat64ooounsigned longcreat64oopen64ooattropen64oO!oOopenat64ooTocreat64oopen64ooftello644fseeko64o3ofsetpos64oG3 fgetpos64on3GFILEntmpfile64yfreopen64yyfopen64yftello64L!fseeko64oG3oGfsetpos64os3Lfgetpos64o3Gfreopen64yyfopen64ytmpfile64y7&os.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g os.c -W0,-xp.XAKgoyL6sWrM0xN.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL6sWrM0xN.;backend;raw;cd;DBG_GEN 5.2.75ireadJ03UfdFbufF  lenFnK6JJTrmaskHfconsecutive_nullsxintcharunsignedlong .  H __sigbits# .sigset_t intread@TUget_time`Ut time_terrno_message뀰UfilenamepmlenpercentageUxnumdennum100long long xPOSITIONpercent_posѲUpospercentfractionperdentemp(-  jmp_bufread_label-<̞reading:longjmpksetjmpk..sigprocmasksigemptysetflushquitvoidecalloc- size_tstrlen7^2strerrorzmkstemp64mkstemp64tm$\ tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# \__wcsftime_xpg577awchar_t__wcstok_xpg5 wint_t__putwchar_xpg5unsigned char__FILE _cnt# _ptr## _base## _flag# _file# __orientation # __ionolock #  __seekable #  __extendedfd #  __xf_nocheck #  __filler #  (__putwc_xpg5.__getwchar_xpg5__getwc_xpg5g__ungetwc_xpg5(__fputws_xpg5__fputwc_xpg5(__fgetws_xpg5 __fgetwc_xpg5: lockf64_ x_ truncate64 d x xoff64_ttell64   ssize_t pwrite64     xpread64 &    xlseek64 K  ftruncate64o xo truncate64 t x xoff_ttell64  read      pwrite64     xpread64 C    xlseek64 h  lockf64 xftruncate64 x  attropen64    openat64   unsigned longcreat64Z $ ) Z open64 _   attropen64    openat64   creat64  )  open64F ! (ftello64 g F fseeko64 xx fsetpos64  xfgetpos64  (FILE  tmpfile64  freopen64 > >Hfopen64 rCM(ftello64 rfseeko64xsnprintf xfsetpos64fgetpos648 8Bfreopen64 s=G s}fopen64 xtmpfile64 time'output.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g output.c -W0,-xp.XAKgoyL6sWrM0yN.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL6sWrM0yN.;backend;raw;cd;DBG_GEN 5.2.7put_line0Uqcq1iq2aq3intcharxobNxflushbUnqcfdqdputchr>qUqqc<putstrtŴU,srpostoaдƵUnumbuf negq tbuf slong long POSITIONlong x linenumtoaеƶUQQnumbuf negq tbuf_ s LINENUM xp inttoaжlUqnumbuf negq tbuf s x   iprint_intpUq>qnum buf> x O  iprint_linenumUqQnum buf x  less_printfEUqfmt^parg s colqpargSp_string#p_intq#p_linenumQ# PARGSget_returnPU cqerrorqUfmt^parg colq return_to_continuex x x' intr_to_abort#x xU  intr_to_abortD#xierror/κUfmt,^parg, queryBкbUqfmt?^parg? cqC colqDx&obufMat_promptq0final_attrqneed_clrqerrmsgsqgetchrqglineqsquish_checkungetccputbsat_switchat_exitat_enterclear_botlower_leftx#unsigned -size_tstrlen9`(x`strcpyemkstemp64qmkstemp64qtm$k tm_secq#tm_minq#tm_hourq#tm_mdayq# tm_monq#tm_yearq#tm_wdayq#tm_ydayq#tm_isdstq# k __wcsftime_xpg59 9p wchar_t    __wcstok_xpg5     wint_t__putwchar_xpg5 !  unsigned char! __FILE _cntq#_ptr2 #_base2 #_flag! # _file! # __orientation-# __ionolock-#  __seekable-#  __extendedfd-#  __xf_nocheck-#  __filler-#  7 __putwc_xpg5 =   __getwchar_xpg5 __getwc_xpg5 v  __ungetwc_xpg5     7 __fputws_xpg5q   __fputwc_xpg5    7 __fgetws_xpg5 (  q __fgetwc_xpg5 I  lockf64qn qqxn truncate64q s  off64_ttell64  q qssize_tvoid  pwrite64    - pread64 =   -lseek64 b q qftruncate64q q  write    -x truncate64q   off_ttell64 q pwrite64 ;  -pread64 e  -lseek64 q qlockf64qqqftruncate64qqxxattropen64qqxopenat64qAqqxAunsigned longcreat64q|FKx|open64qqxxattropen64qqxopenat64qqqxcreat64q>Kx>open64qhCq7 ftello64 hfseeko64q qfsetpos64q fgetpos64q  7 FILEtmpfile64 x%x/freopen64 `*4 x`xjfopen64 eo7 ftello64 fseeko64q qfsetpos64q fgetpos64q) x)x3freopen64 d.8 xdxnfopen64 istmpfile64 b)pattern.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g pattern.c -W0,-xp.XAKgoyL6sWrMU0N.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL6sWrMU0N.;backend;raw;cd;DBG_GEN 5.2.7Mcompile_pattern2p Upatternsearch_type comp_patternvcomp pcomp!intcharvoidunsignedsize_t _regex_ext_t  re_nsub# re_comp# re_cflags# re_erroff# re_len# re_sc#$regex_t compile_patternmU>patternisearch_typei comp_patternicvt_patternnresulto uncompile_patternԼUpatternpcomp is_null_patternUpatternmatchϽUpatternpattern_len bufbuf_lenpfoundpendpplppattern_endbuf_end match_patternнUpatterntpattern lineline_lenspepnotbol search_type$matchedspatternܽrmLflagsregoff_t L rm_sp# rm_ep# rm_so# rm_eo# rm_ss# rm_es#regmatch_t$regfreey]$yregexec~regcomp]errorcvt_textcvt_lengthecalloc*strlenN/mkstemp64kmkstemp64freelongtm$L tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# L__wcsftime_xpg5Qwchar_t__wcstok_xpg5wint_t__putwchar_xpg5 unsigned char __FILE _cnt# _ptr # _base # _flag # _file # __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#   __putwc_xpg5  __getwchar_xpg5__getwc_xpg5W  __ungetwc_xpg5~  ~  __fputws_xpg5   __fputwc_xpg5   __fgetws_xpg5  __fgetwc_xpg5*  long longlockf64\ * \ truncate64 a * * off64_ttell64  ssize_t pwrite64    * pread64 #   * lseek64 H  ftruncate64l * l truncate64 q * * off_ttell64   pwrite64    * pread64    * lseek64 C  lockf64h * ftruncate64 *   attropen64    openat64   unsigned longcreat645 5open64_:_iattropen64dnopenat64creat64open64! ftello64 B!fseeko64h * * hfsetpos64 m* fgetpos64  FILEtmpfile64freopen64#fopen64M( ftello64 nMfseeko64 * * fsetpos64 fgetpos64 freopen64'fopen64Q",tmpfile64**position.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g position.c -W0,-xp.XAKgoyL6sWrME1N.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL6sWrME1N.;backend;raw;cd;DBG_GEN 5.2.79long long$POSITION1table@xposition*GU1where(intadd_forw_pos?`ҿU1pos=i@add_back_posPFU1posNiQpos_clear`PUDiapos_initlOUxscrposxm scrpos  pos1# ln#onscreenPU1posi empty_screenUempty_linesGUNse iget_scrposPUscrposixadjsline)Uslinetable_sizevoid ecallocchar mkstemp64' mkstemp64DfreeXlongXunsignedesize_tX~ tm$! tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# ! __wcsftime_xpg5q]`q&wchar_t]]mh __wcstok_xpg5hhrwXwint_t __putwchar_xpg5unsigned char __FILE _cnt# _ptr# _base# _flag# _file# __orientatione# __ionolocke#  __seekablee#  __extendedfde#  __xf_nochecke#  __fillere#   __putwc_xpg5__getwchar_xpg5 __getwc_xpg5, __ungetwc_xpg5SXS __fputws_xpg5X] __fputwc_xpg5 __fgetws_xpg5hh __fgetwc_xpg5 lockf64$$$ truncate64Q)$$off64_t tell64Qyssize_t pwrite64yye$ pread64yye$ lseek64Q Q ftruncate644 $4 truncate64a 9 $$off_t tell64a   pwrite64y y e$ pread64y ye$ lseek64a  a  lockf640 $ ftruncate64T $T ^ attropen64 Y c  openat64   unsigned long creat64    open64'  ' 1 attropen64d , 6 d openat64 i  creat64    open64   ftello64Q  fseeko640 ]$$0 fsetpos64\ ]5 $ fgetpos64 ]\ FILE tmpfile64   freopen64       fopen64     ftello64a 6  fseeko64\ ]$$\ fsetpos64 ]a fgetpos64 ]\   freopen64       fopen64   tmpfile64  ,prompt.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g prompt.c -W0,-xp.XAKgoyL6sWrMk2N.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL6sWrMk2N.;backend;raw;cd;DBG_GEN 5.2.7char long(D-s_proto5+1(4k-3s_protoZ+1 -m_proto-1M-Lm_proto-1 -M_proto/1f -eM_proto/1 #7-e_proto(162#T^-Se_protoM162 t-h_protoy32tP-Oh_proto32 -w_proto52-w_proto52 *-more_proto7H1;T-:more_protoC7H1  m eqprotor;x   hproto<x   wproto=x init_promptG0U ap_strV9U$ $sTlen)W int ap_charg@eUk cebufkh |- ap_posupU possbufvlong longPOSITION - ap_linenumU) )linenumbuf7LINENUM H- ap_intU )numbuf  - ap_questUcurr_byte U )whereposcondU)> c )where len protochar jU  )c )where )iseditprotoposlenn)linenum)last_linenum)hvoid skipcond9U$_$piflevel)wherechar@IU$$pwp )pr_expandPjU$%$proto)maxwidth p$c)where)eq_message(pU$pr_string42U$prompt$5type)6wait_messageE@qU$mp$@ -message?$  - prproto:tinttoalinenumtoapostoacurr_tag)ntags)adjsline)positionpercentage)currline)find_linenum)get_index)get_filename$nifile)next_ifileeof_displayed)ch_getflags)ch_lengthsave$  I unsignedstrncpy$ $N S   S size_tstrlen       strcmp)   mkstemp64) $mkstemp64)" $ -- ' tm$ tm_sec)#tm_min)#tm_hour)#tm_mday)# tm_mon)#tm_year)#tm_wday)#tm_yday)#tm_isdst)# 1 __wcsftime_xpg5  "  ,  wchar_t     __wcstok_xpg5 P    -wint_t__putwchar_xpg5P  P unsigned char __FILEr _cnt)#_ptr #_base #_flag # _file # __orientationS # __ionolockS #  __seekableS #  __extendedfdS #  __xf_nocheckS #  __fillerS #  __putwc_xpg5P  P r __getwchar_xpg5P __getwc_xpg5P  r __ungetwc_xpg5P  P r - __fputws_xpg5)1__fputwc_xpg5P WP r __fgetws_xpg5  )W__fgetwc_xpg5P r lockf64)))  truncate64)off64_ttell64"))ssize_t  0pwrite64"e"5S  pread64""eS lseek64))ftruncate64))  truncate64) off_ttell64 0)  0pwrite64"e"5S pread64""eS lseek64 ) )lockf64)))ftruncate64))    attropen64): )  :openat64)k)?)  kunsigned longcreat64)pu  open64))    attropen64) )  openat64)>))  >creat64)hCu  hopen64)m) ftello64fseeko64)) fsetpos64) fgetpos64), FILE ,tmpfile647  O  Yfreopen647T^7    fopen647 ftello64 fseeko64)) fsetpos64)1 fgetpos64)S  S  ]freopen647Xb7    fopen647tmpfile647-search.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g search.c -W0,-xp.XAKgoyL6sWrMU3N.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL6sWrMU3N.;backend;raw;cd;DBG_GEN 5.2.7"hilitedhl_nextd#hl_startposv#hl_endposv#  long longiPOSITIONhilite_anchor 7xfilter_anchor 8xset_patternQ8U (infoM patternM search_typeMintunsignedsize_tvoid8 _regex_ext_tE re_nsub+#re_comp@#re_cflags#re_erroff+# re_len+#re_scT#Yregex_tcharpattern_info (compiled#text#search_type# clear_patterni@yU^ (infog init_patternvU (infot init_searchUget_cvt_opsmUopsis_ucasepU9 strstr_endchJunsigned long9LWCHARprev_pattern>U (inforepaint_hilite@7U onslinenumposveposvsave_hide_hiliteclear_attn@Uslinenumold_start_attnposvold_end_attnposvposveposvmovedundo_search Uclr_hlist3 UHdanchor1hld4nexthld5clr_hiliteBUclr_filterHUis_hilited_rangeSUUvposPveposPhldTis_filteredh`U$vposfhldiis_hilitedUvposveposnohidep_matchesmatchadd_hiliteUdanchordhl ihldhilite_lineUvlineposlineline_lenchposspep cvt_ops$searchpline_endhldchg_caseless=Uhilite_screen'@U2 scrpos2 (scrpos X posv#ln#chg_hilite6Usearch_posKUv search_typeIposvLlinenumMsearch_rangeU" vposvendpossearch_typematchesmaxlines " plinepos$" pendpos(lineclineline_lenlinenum' spepline_matchcvt_opscvt_lenchposlineposvoldposv**line_filter]eehldviLINENUMhist_patternLU search_typeJpatternNsearchw'U search_typespatterns nsposvxprep_hilite0Uvsposveposmaxlinesnprep_startposv nprep_endposv new_eposv max_eposv result iZZZsearch_typesset_filter_patternUppatternsearch_type is_filtering#Ufilter_infoGԣsearch_infoFȣis_ucase_pattern/is_caseless.prep_endposv-prep_startposv,hide_hilite+adjslineget_scrposempty_screenpositionvmatch_patternis_null_patternuncompile_patterncompile_patternerrorput_linefind_linenum' add_lnumback_raw_linevforw_raw_linevjump_locrepaintforw_linevcvt_textcvt_alloc_chposcvt_lengthcmd_lastpatternset_mliststep_charJch_getflagsch_lengthvch_end_seekgoto_linelower_leftecalloc@Xstrlen+|]|strcpymkstemp64mkstemp64free@abs long  tm$tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst# !__wcsftime_xpg5++wchar_t__wcstok_xpg5@  wint_t__putwchar_xpg5@p@unsigned charp__FILEb_cnt#_ptr#_base#_flagp# _filep# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  __putwc_xpg5@@b __getwchar_xpg5@__getwc_xpg5@b__ungetwc_xpg5@@b __fputws_xpg5!__fputwc_xpg5@G@b__fgetws_xpg5wG__fgetwc_xpg5@biswupper lockf64itruncate64iioff64_ttell64.ssize_t8<pwrite64.q.Ai8pread64..qilseek64ftruncate64itruncate64iioff_ttell64<8<pwrite64.q.Aipread64..qilseek64lockf64iftruncate64 i attropen64F!Fopenat64wK!wcreat64|9open64!attropen64!openat649 !9creat64c>9copen64h!ftello64fseeko64iifsetpos64ifgetpos64'FILE' tmpfile642JTfreopen642OY2fopen642ftello64fseeko64iifsetpos64,fgetpos64NNXfreopen642S]2fopen642 tmpfile642 0signal.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g signal.c -W0,-xp.XAKgoyL6sWrME4N.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL6sWrME4N.;backend;raw;cd;DBG_GEN 5.2.7Vu_interrupt.0eUOOtype,intstopJpU~OtypeHwinchZUOtypeXinit_signalsJUOonpsignalsPU^tsignalsObbbold_widthOold_heightOsigsOlong killO r O  O   O  signal O  flush intread calc_shift_count calc_jump_sline clear_bot bell deinit init get_term raw_mode quitchar g mkstemp64O o mkstemp64O o runsignedsize_tr tm$otm_secO#tm_minO#tm_hourO#tm_mdayO# tm_monO#tm_yearO#tm_wdayO#tm_ydayO#tm_isdstO#  o __wcsftime_xpg5    twchar_t    __wcstok_xpg5   rwint_t __putwchar_xpg5% unsigned char %__FILE_cntO#_ptr6#_base6#_flag%# _file%# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  ; __putwc_xpg5A  __getwchar_xpg5 __getwc_xpg5z  __ungetwc_xpg5  r  ; __fputws_xpg5O   __fputwc_xpg5   ; __fgetws_xpg5,  O  __fgetwc_xpg5M long long lockf64O O O Mg  truncate64O  MMoff64_t tell64 OOssize_tvoid  pwrite64    M  pread64N    M lseek64s O  O ftruncate64O O Mg  truncate64O  MMoff_t tell64 O  pwrite64    M pread64I    M lseek64n O  O lockf64O O O Mrpid_tgetpid  ftruncate64O O Mg g attropen64O Og  openat64OA O  Og A unsigned long creat64O| F K g | open64O Og g attropen64O Og openat64O O Og  creat64O>  K g > open64Oh C O ; ftello64 h fseeko64O  M OM fsetpos64O  M fgetpos64O  ;FILE  tmpfile64 g % g / freopen64 ` * 4 g ` g j fopen64  e o ; ftello64 fseeko64O  M OM fsetpos64O  fgetpos64O)  g ) g 3 freopen64 d . 8 g d g n fopen64  i s tmpfile64 41tags.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g tags.c -W0,-xp.XAKgoyL6sWrM04N.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL6sWrM04N.;backend;raw;cd;DBG_GEN 5.2.7)chartags$y]long longBLINENUMtagnext=#prev=#tag_file$#tag_linenumO# tag_pattern$#tag_endline#taglisttl_first=#tl_last=#taglistC y cleantags\UFtp=] maketagentwU= $nameq $fileq Olinenumq $patternq endlineqtp=xint gettagtypeU f findtageU` $tagtyperesult` tag_resultTAG_FOUNDTAG_NOFILETAG_NOTAGTAG_NOTYPETAG_INTRtagsearch̀UBPOSITION nexttagFU$  ntagfile$ prevtagPU$d ntagfile$ntagsUcurr_tagUfindctagDU`$tag p$ftaglentaglinenumOtagfile$tagpattern$tagendlinesearch_charerrtlinetp=unsigned charunsigned__FILE_cnt#_ptr#_base#_flag# _file# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  FILElongedit_tagfile}PUctagsearch8UposlineposlinenumOlenline$findgtag@}U`S $tagtype bufS fptp=///command$flag$qtag$cmd$/,>,>,>bbname$ file$ line$ len!c0f circularXynextgtagaU$ tp=bprevgtagU$ tp=gtagsearchUgetentryUy $bufy tag y filey linep$$curtag=Kcurseqtotalerrorgetnumfind_posfind_linenumOadd_lnumforw_raw_lineshell_quote$shell_unquote$editlgetenv$skipsp$voidt ecalloc|   strncmp    size_tstrlen    strcpy$$ $ $ . strcmpW ) 3 mkstemp64t $mkstemp64 $free |  atoi   tm$o tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst#  o __wcsftime_xpg5     t wchar_t    __wcstok_xpg5     wint_t__putwchar_xpg5 % __putwc_xpg5 O % __getwchar_xpg5 __getwc_xpg5 %__ungetwc_xpg5  %__fputws_xpg5__fputwc_xpg5   %__fgetws_xpg5 :  __fgetwc_xpg5 [%lockf64Btruncate64BBoff64_ttell64ssize_tt pwrite64Bt pread64GBlseek64lftruncate64Btruncate64BBoff_ttell64t pwrite64Bpread64BBlseek64glockf64Bftruncate64Bcloseattropen64!openat647 !7unsigned longcreat64r<Aropen64w!attropen64!openat64 ! creat644A4open64^9!ftello64^fseeko64BBfsetpos64Bfgetpos64 tmpfile64 freopen64FFPfopen64zKUftello64zfseeko64Bpclosepopen B fsetpos649fgetpos64[fgets$~$fgetcsprintf$!freopen64fopen641 fcloseK tmpfile64"fopen64ox#fopen$open64#open [3ttyin.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g ttyin.c -W0,-xp.XAKgoyL7sWrMk5N.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL7sWrMk5N.;backend;raw;cd;DBG_GEN 5.2.7open_getchr$Uclose_getchrZUgetchrf^Ucgresulthintchartty ireadquit  mkstemp64  mkstemp64 long unsigned #size_t  <tm$tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst# F  __wcsftime_xpg5/  / A wchar_t   + & __wcstok_xpg5&e & 0 5 wint_t __putwchar_xpg5e eunsigned char __FILE_cnt#_ptr#_base#_flag# _file# __orientation## __ionolock##  __seekable##  __extendedfd##  __xf_nocheck##  __filler##   __putwc_xpg5e e __getwchar_xpg5e __getwc_xpg5e  __ungetwc_xpg5e e     __fputws_xpg5F   __fputwc_xpg5el e   __fgetws_xpg5& &  l __fgetwc_xpg5e long long lockf64      truncate64   off64_t tell64D  ssize_tvoid R Z pwrite64D D _ #  R pread64D D  #  lseek64    ftruncate64     truncate644   off_t tell644Z  R Z pwrite64D D _ #  pread64D D  #  lseek644  4  lockf64    ftruncate64'    '  1 attropen64d , 6   d openat64  i   unsigned long creat64     open64       attropen647    7 openat64h  <   h creat64 m   open64   ftello64 fseeko64      fsetpos64/    fgetpos64V  / FILE V tmpfile64a   y  freopen64a  ~ a   fopen64a   ftello644 fseeko64/     / fsetpos64[  4 fgetpos64}  /  }  freopen64a  a   fopen64a  tmpfile64a open64 openYx4version.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g version.c -W0,-xp.XAKgoyL7sWrMU6N.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL7sWrMU6N.;backend;raw;cd;DBG_GEN 5.2.7charlong"C*version2y /var/tmp/less-436/usr/include/sys/usr/include/isomain.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.hppp p p p p pp q q  q q q q qEq Wq \q}nqq q q q q q&r 8r ?r Ur Xr frzr rr rr rr  s s 6s As Us ms xss s s ss s s s s td t"*t4t >t Ht RtWt ht ttt t t t t ttt t u u u *u:u Uu au puzu u uu uu u u u uuu v  v vv)v 1v  H N `c {     ؈     ) 3 L V h t       Ӊ ݉    (03 L.PShpsNJЊӊ  5 #- 4 9 @C\ `cx1   ƋЋ ؋ ݋       #4? T _ t     ÌЌ     ) 6 KU `fw ~    Ǎ ؍      ! * 0 @CX /var/tmp/less-436/usr/include/sys/usr/include/isobrac.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h`f-  Ǝ ؎       / 4 KS X{      t    /var/tmp/less-436/usr/include/sys/usr/include/isoch.cstat_impl.htypes.hless.hstat.htime_impl.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h3 @U_ l|   Ԑې ' - L _d lv  Ց  # . 4 R l v ˒ 7D dw   Ɠ ˓ ؓ       3 Q \    ǔ 1 @L d rz ؕ   $. <Mk  $, A `cu     ϗ ٗ    ~ ( 2 @IP   ǘ ͘    y ,; Bokpv   Й ܙ|   , 7 o |     - 7 D Q \{u  ƛ Л֛   ) 4 J `j w ~  ̜ל     }0K Z a pv    ǝ     , n      ʞ  ! ' 06@ L \ |     - 5 @CK Xp z    ؠ   ~He    ϡ  / @FX ` l    Ѣ     )8 Z |}  ϣ ݣ|  L `f{   ʤ ٤   " 1 N \ a    ʥ ϥ      2E [ l s {    ̦ ڦ W  /var/tmp/less-436/usr/include/sys/usr/include/isocharset.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h       ( 0 8 <W \k |m ͧ ٧  ]& + 5 pv  Ĩ ͨ Ш{   ! , 9 DyX ` o {    ̩ ީ  y  &8> J b h p wy     ( 4 @zdm v   « ֫     b ά Ь լ    2 D Z `fp     ѭ   8 @ Tt   Ю֮ޮ   + P t    ̯U c k x   }Ͱܰ     , < H X d t     ɱ ر       ,H k t  ~ Ʋ̲8|̳ (WK+pv   *W   µ  I x     : l Ʒ    M w   ظ   % 0 7 @Q \w ~    ù ̹ ҹ       # 2 < J T `xh o  Ϻ   %C L|[b L /var/tmp/less-436/usr/include/sys/usr/include/isocmdbuf.cstat_impl.htypes.hless.hstdio_impl.hstdio_iso.hstat.htime_impl.htime_iso.hwctype_iso.hpv   ƻ л ڻ     &- C S Y n v     ȼ   & 3 9oIPV_ u |   } ƽν ߽      (9 M ` h r z      ɾ ؾ      ,4` h rx   ۿ   / @FK Y a v     w       x # - 06CX s x  y     |BNT f n p vy         |.; C H V `ft              ( , : BzPW `fr     |      ! ( 06QV d       "08 = IQ a m p|w|      0J O l       5< PVbl v {           & < P^ f o          . 7 C O Xd ps}         " 0 : V [ w             , 6 @ E U d n |               , 6 DN dx   &< N T f |   x       8 R^ l  ~       0 8 J Tf p | m       + FR ` r      ({5> PVhm w |       / <Q Xm             $2< D Q ` ~        " ' 8B G LT ^hr    z    ; x        & 0 < M `i {      6 G g m         1 B H l    {  ( 0 Cjgx           | 0 D PY ` h p x           " ) 1 Mc y   ; /var/tmp/less-436/usr/include/sys/usr/include/isocommand.cless.hoption.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h       # 06a ps             ' 6 E Tc t           ! + 9 A P Tc h w |y         / 9 I U d w |          # ( 4 > N ak p z       N`flx           * / <zL Tw |        j, <H P a p z       1 F R^ ~         z 9 @ L T\ |            % ,6 = @ J Q T [ `g lj    ~BRW `s|         4 T ^ f n x        & 2h t~               06@P \x  m    & 2 N PVv            /< DR X`d sx          # *4 9 O Yc h r ~           m  = D P V ^ d k ~        $ 9 K Pi s        , > D] s x        - C H Z `y             }%< C Ha k p z          + 0 E Le {           $) B X s x             $. G ] b j pz         ! (7      $ Z i           ) 0 K S X b q x          $ . = D] s       $= S h          ' 2 H ^d}         - C X g ly                 ( - 5 <S [ `j y            " (? G x             * 0 8 S [ `y      0 : @Y h          zHP # /var/tmp/less-436/usr/include/sys/usr/include/isocvt.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h06@M T `f-w            ! <C     ~   + A M^Y%x        /var/tmp/less-436/usr/include/sys/usr/include/isodecode.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h     5 D M h q }  k      1 1 PWa-ps     ( 1 = I R Y `c}          .  >  T  \  r  z                  '  '  F  R  Y  e  v                      |- 5  <  B  P V o                    )  1  <  C  P V y                  3  @  I Z  ` q                       $hPX `fp |         1 ? L {        $ < S `f           , 8 C PW _ g q }      {  {  z -5 O~\d r x 8  /var/tmp/less-436/usr/include/sys/usr/include/isoedit.cstat_impl.htypes.hless.hstat.htime_impl.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h     % :B P         l , B M X d k w               # * A G PV` hv         &. @ ` py         (/ F d u |          ( 0 D R ` n |       5; O _ m t |            3 > U `j z            ! 06> EU \ {      }v4< J T n|        K Z m p x      + 06M `fm         $ 5 F Y \w |          (  0 6 F  T  d  i  p v               !!  !3! d! t! ~! !! ! !! !_ "$"" -" ;" @" N" I  /var/tmp/less-436/usr/include/sys/usr/include/isofilename.cstat_impl.htypes.hless.hstdio_impl.hstdio_iso.hstat.htime_impl.htime_iso.hwctype_iso.hP"V"s" """ " " " " " " " #x$# ,# =# I# j# s# #|## # ### # # # ##$ $ $ )$ 1$ @$F$g$ p$v$~$ $ $ $$ $ $ $ $ $ %%%m,%4% <%H% \%s% {% %% %% % %v & & & 0&9&M& \&& & & & && & & '  '' (' .' @'F'g' o' x'' ''' ' ''' '3( ;( D( e(h( o( t(c(~(#(( ( (( ) &) g) o) )) )) ) )k)~** *  *&*0* <*P* a* ~** * ** * * * * + ++#+ 0+ _+ l+ + + + + +, <, R, Y,wk,z, ,,, , , , ,,, - - - - -- - - - - - - .n .. . !. 0.9.K. g. x. . .. . . / / ,/@/F/ P/\/m/ w/ / // / / / / / / / 0 0^0 o0 0 0 0 0 0 %1 61 D1 L1Z1 d1 u1 1 1 1 1 1 1 1 1 1122  2 ,2 F2 T2 `2 g2 n2z22 2 22 2 2  3 3 !30383 I3 `3n3 x3 3 3 3 33 3 33 3 4 44 4 $4 24 L4 T4 4 4 4 4 4 4 4 5 55 !575 s55 5 555 5 55 5 6*6 26 H6 R6 \6 n66 6 66 6 666 7 7  7&7/7 H /var/tmp/less-436/usr/include/sys/usr/include/isoforwback.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h@7C7-M7 T7 Y7 `7i7;s7 |7 777 7 888 8.8 q8 888 8 8 8 888 88 9 %9 Q9V9 f9 m9 r9 w999 9 9 9 9 9 9 99:: ,:B: X:_: : :: :: : : :*; 4; 8; =;G;Z;b; l; t; y; ; ; ;;;; ; ;< $<,< 0<@< G< O< T< Y< ^<hm<u< |< < < < < < <<<< < <= F= P=Z= p== = == == === 2> 7> <> Z> `>f>p> |> > > > > >  /var/tmp/less-436/usr/include/sys/usr/include/isohelp.ctypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h /var/tmp/less-436/usr/include/sys/usr/include/isoifile.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h>>8> > > ?? ? ?  ? )? 5? >?K? \? g? p?s?? ? ? ? ??? ? ? ? @ @ @ $@ 0@6@>@ @@N@ Y@ n@ t@ @ @ @ @@@ @ @ @ AA(A 5A @A IA PAVAoA xA A A A AAA AAA B B~B"B 0B6BOB bB hB pBvB~B B B BBB BBB BBB CCC CC C 0C3CBC PCVC_C pCvCC CCC  /var/tmp/less-436/usr/include/sys/usr/include/isoinput.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.hCC8C C CC FD [D `D xDDD D D D D D D D D D DD E E E /E L EL OL TLYL tL yL L}LL L LLL L2M >MJM `MfM|M M MM M M M M M M MM N (N ,N 0N AN ! /var/tmp/less-436/usr/include/sys/usr/include/isojump.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.hPNVN"`N oN tNyN~N N N N NN O  O OO,O WO aO qO O O O OO O PPP P -P 0P6PWP fP kP P P P P P P P QQQKQ SQ XQ cQ mQ }Q Q QQQ QQ Q R *R 4R @R HR]R lR tRR R RR RS (S 4S ^ @^C^S^ `^f^m^ ~^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^^^ _ _ %_ 0_ <_ G_ S_ ^_ j_ p_ ____ _ _ `4` @`G` Z` a` ` ` ` a a aa$a Aa~a a a a a a a ax'b .b @bFb_b vb b b b bzbb bbb b c  c&c9c Dc Wc `c c ccc c ccc cd 4d BdYd vd d d d d d d dd d e3e@e He Ne Te `eue ee ee e e e|ff $f 0fqKq aq |qq q q q}qr %r 9r Lr orr r r r r s ss s .s 0s6s@sJs Rs \s hs osys ss s sss s ss1t Ht Otlt wt |t t tt tt t t t t t t u u  u)u su u u uu uu u uv  v v  v*vEv Hvcv nv {v v v v v v v v v v  /var/tmp/less-436/usr/include/sys/usr/include/isolinenum.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.hww)w 5w Hw Rw ]w hw~w w w w www w  x xx9x Lx Tx}xx~x x xx xx xx x x x x x y y &y 4y Ey Zy ky sy y{yy y yyy yyz z /z 4z >z @zCzMzWz az pz zzzz zz z{'{ '{ K{ ^{ t{~{ {{ { { { &|D| Q| V| l| | | |t||| }(} @} J} z}} } } } } } }t~7~C~ P~Y~l~~~ ~ ~ ~ ~ )2 J `     w0H `   Ԁ  w*F R `fz   Ɂ    * : R ^ E /var/tmp/less-436/usr/include/usr/include/iso/usr/include/syslsystem.cless.hstdio_impl.hstdio_iso.htypes.htime_iso.hwctype_iso.hpy;    ɂ Ղڂ ߂  & 4 ; i u   ʃ ۃ   " 8 I W eq      ʄ τ ۄ      * @ L ^ t    ȅ օ   8 \ pv  Ć ӆ        ' 3?F     $w     z0 >JV b g q}   /var/tmp/less-436/usr/include/sys/usr/include/isomark.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h* ĉ Ӊ 5   , ; B PV\e y      Ŋ Պ       ) 0A I L e t  M5 Ƌ    " 7 C PVc h v     ƌ׌ ߌ   ' 3H Vl p   č ҍ    % 6 U~d%  /var/tmp/less-436/usr/include/sys/usr/include/isooptfunc.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.hpv      Ȏ Ў ڎ     $ ) , 6 HP a dcs   ֏      t &,8 ? Y a t |   Ȑ Ґ ڐ   - 4 I U [ l pX*   Ƒ̑ؑ ߑ    4 < PX bh r z   ͒ Ԓ      X*03= @ Y `fh{   x   Ɠ Փ ܓ  (6 8 F \ `fu     Ĕ Ք ؔt  * 9 <pDPV\d |    ԕ  x8 I _ d s  iȖ ̖ Жvߖ  y 038= DN ] l {     × ȗmח # 4 L t    Ҙ  v    + I P d r    ߙ| N Z n pZ(  Ě ܚ      $ ( 2 < D J [ `fo  y Л֛   9  /var/tmp/less-436/usr/include/sys/usr/include/isooption.coption.hless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h5    4 8 O n px    ̜ ٜ      8 D ` n t{     L; $ 5 ] tz   Ğ ˞   / ; DKS Y a t        " ( 4< DP W c       ĠW. ~"PV_ hy     ϡ    " ( ,@ G Lz_ w  â Ȣ ע ܢ  v   (l p  ţ ȣtأ z % - 9 < K P_ dstx   + 0< O TXk~  Х֥ޥ  $ 06W ` pv    Ʀצ    ' 06< M PSr     ˧  2 L ` dtm ƨΨ ب        &: A M T [ s    ͩ         &- 4 H ` x   }Ѫ٪    ; K f o w     ͫ  /var/tmp/less-436/usr/include/sys/usr/include/isoopttbl.coption.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h    +6 E U dxy    ͬ ج{  $ 6 @ I T [ `fov }   ӭ   $0 8> D J Q p ~ by{.ɮѮ ۮ     $  /var/tmp/less-436/usr/include/sys/usr/include/isoos.cselect.htypes.hless.hsetjmp_iso.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h06JTb r    ȯ ү ܯ      ( . @CR `ft z  Ұ   . R p    9 [  \ /var/tmp/less-436/usr/include/sys/usr/include/isooutput.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h4  0 > F N X fy    ѳ      * /; @ \ f l   ô дٴеٵжֶpv   ʷ ط      > LS Xa j v  } ɸ Ҹ Ը   n*w:@ PV^ ~    ƹ ˹ й չ    % (7 < K P U `j o       º ̺ кֺݺ     " . 8= H R W ]  /var/tmp/less-436/usr/include/usr/include/sys/usr/include/isopattern.cregex.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.hpv    ̻ ػ   8   (O g ~      ȼ Ҽ  $ B R T~z     uýʽ нֽܽ = u } 3վ ۾ y /var/tmp/less-436/usr/include/sys/usr/include/isoposition.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h*    w* ? `l~   ʿ   , > PYk           3 J PYm x   ~   # ,~;B PVh    {       $ h /var/tmp/less-436/usr/include/sys/usr/include/isoprompt.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h06J |         ) 7 @FM U c pv        &: e       4 L \ < 0: H lS/  )0D Z l q x         1 < R `      & 8S X l        $ ,4 < L\ d x      n x          # (2 DS X k s   e       Z.'4 @FLP ` p |   y}> D PVa m |          # 4 < M T \ u  X~.' 4 O\ e pv  ' - @Fl 0 /var/tmp/less-436/usr/include/usr/include/sys/usr/include/isosearch.cless.hregex.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h         # , 3 @CN _ i w            ' 1 < F O Y b h pv   |    9 @FP U ] e o t ~          x( - 5 @FM h p           % ( = o    t       &7 @ N}\f    . 8|IP `fs |  }  JT s {        }$ , r }      / 4 : B Q t         ,; @FT j l         % * 5 HR] h o        |0F U X l|   ' 4 < C NZ |     & 5 @ j        * ] et     4 CMR ~          $ > H [ o |    ' 6 DNZ nx }         !&: P] h w    " 09J [ y      <A F \ u  $ A Pa        N Z k |             /var/tmp/less-436/usr/include/sys/usr/include/isosignal.ctypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h03.8G T ^ c ps        $0<HPVf l v            " ' ; N S X bm w  Y  /var/tmp/less-436/usr/include/usr/include/iso/usr/include/systags.cless.hstdio_impl.hstdio_iso.htypes.htime_iso.hwctype_iso.h  }  % G Z i r z         8 D \ h            ' , ; @ O Tsc         ; A PV] x          . 6 D I S d         6 = a s           ' . 5|M` h o z     $ . 8 ? PV` l       " 9 O^ t~      $ 0 @Ue t y             $ ( 4qFZ e n      /> bly      >D|  \&   # ,7 D P [ e l              , 7 A K T ^ lt       F R ` r    J    # / < N      ' 0 ;   K /var/tmp/less-436/usr/include/sys/usr/include/isottyin.ctypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h       (4(= E M Y 5/ /var/tmp/less-436version.c DD%$> I4I?  : ;  I: .?  6 : ; @ ID I: ;  4I : ;   .?  : ;@ ID  I: ; 4I : ; .?  : ;@ D  :  I8 .? < D .? < ID &I.? < ' ID I.? < ' D  I8 .? < ' ID  DD%$> 4I : ;  4I?  : ;  .?  : ;@ D I: ; 4I : ;   D D I: I  !I/  :  I8 . : ;@ ID  I.? < ID .?  : ;@ ID I !I/. : ;@ D .?  : ;@ D . : ;@ D .? < ' ID I&I.? < D  I8 .? < ' ID  DD%.?  : ; @ D I: ;  4I : ;  .? < ID $> I: ID I .? < D .? < ' ID  I &I :  I8  I8 .? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: 4I : ;  .?  : ; @ ID   4I : ;   I8 II !I/  : I !I/  : .?  : ;@ D I: ; . : ;@ ID .?  : ;@ ID .?  : ;@ ID . : ;@ D 4I?  : ;  .? < ' ID I.? < ID .? < D !.? < ' D " I8 #.? < ' ID $%&.< ' DD%$> 4I?  : ;  I  I8 I !I/ I  4I : ;  . : ; @ D  I: ;  . : ; @ ID . : ;@ D  4I : ; .?  : ;@ D .?  : ;@ ID I: ; I: I!I!I/. : ;@ ID .? < ' ID I&I.? < D .? < ID  :  I8 .? < ' ID ! DD%. : ; @ ' ID I: ;  $> &III: 4I : ;  4I?  : ;    I8 .?  : ; @ D .?  : ; @ D  .?  : ; @ ID . : ; @ ID . : ;@ ID I: ; 4I : ; . : ;@ D . : ;@ ID .?  : ;@ D .?  : ;@ D .?  : ;@ ID .?  : ;@ ID I !I/ :  I8 I !I/ .? < ' ID !I".? < D #.? < ID $.? < ' D %.? < ' ID &'(.< ) DD%$> I4I : ;  . : ; @ D . : ; @ D I: ;  .?  : ; @ ID . : ;@ ID  I: ; 4I : ;  I !I/ I:  :  I8  : D . : ;@ D . : ;@ D .?  : ;@ D .?  : ;@ ID .? < ID .? < D &I.? < ' ID I.? < ' D  I8 .? < ' ID  DD%.?  : ; @ ID I: ;  $> 4I : ;  I.?  : ; @ D   I: .? < ID .? < D &I .? < ' ID I :  I8  I8 .? < ' ID  DD%$> I!I4I : ;  I !I/I  I   I8 . : ; @ D  I: ;  .?  : ;@ D . : ;@ ID I: ; 4I : ; .?  : ;@ D . : ;@ D .?  : ;@ ID I:  : !I/ .? < D .? < ID &I.? < ' ID I.? < ' D  :  I8 .? < ' ID !"#.< $ DD%. : ; @ ' ID I: ;  $> &III: 4I?  : ;  .?  : ; @ D  4I : ;   :  I8 .?  : ; @ ID . : ; @ D  4I : ;  : I !I/ .?  : ;@ ID I: ; .?  : ;@ ID . : ;@ ID .?  : ;@ D .? < ' ID I.? < D .? < ID .? < ' D  I8 .? < ' ID !".< # DD%. : ; @ ' ID I: ;  $> &III: .?  : ; @ ID  4I : ;   . : ; @ ID  .?  : ;@ ID  I: ; 4I : ; I !I/. : ;@ ID  :  I8  I8 .?  : ;@ D I !I/ .?  : ;@ ID .? < ' ID I.? < ID .? < D .? < ' D .? < ' ID  !.< " DD%$> 4I?  : ;  . : ; @ D .?  : ; @ ID 4I : ;  I: .?  : ; @ D .?  : ; @ D  I: ;  .?  : ;@ D  I: ; 4I : ; .?  : ;@ ID .? < ID .? < D I.? < ' ID I&I :  I8  I8 .? < ' ID  DD%$> &II !I/4I?  : ;  I.? < ' ID  I I:  :  I8 I8 .? < ' ID  DD%  I8 I$> I:  : 4I : ;  . : ; @ D  I: ;  . : ; @ ID  .?  : ; @ D  .?  : ; @ ID .?  : ; @ ID .?  : ;@ D I: ; D D .?  : ;@ ID .? < D .? < ID &I.? < ' ID I.? < ' D  I8 .? < ' ID  DD%.?  : ; @ ID I: ;  4I : ;  $> I: .?  : ;@ D I: ; 4I : ; .? < ID .? < D I .? < ' ID I&I :  I8  I8 .? < ' ID  DD%.?  : ; @ D 4I : ;  $> I: I: ;  I :  I8  :  .? < D .? < ID .? < ' ID I&I I8 .? < ' ID  DD%$> I4I : ;  4I?  : ;  I !I/ .?  : ; @ D . : ; @ ID  .?  : ; @ ID  I: ;  I: .?  : ; @ D  . : ; @ D 4I : ; .?  : ;@ D . : ;@ ID I: ; .?  : ;@ ID .?  : ;@ D .? < D .? < ID &I.? < ' ID I.? < ' D  :  I8  I8 .? < ' ID  DD%.?  : ; @ D 4I : ;  I$> I:   I8 . : ; @ D  I: ;  . : ; @ D .?  : ;@ ID  I: ; 4I : ; I !I/.? < ID .? < D .? < ' ID I&I :  I8 .? < ' ID  DD%.?  : ; @ D I: ;  4I : ;   $> I.?  : ;@ ID  4I : ; I: I: ; .? < ID I :  I8  I8 &I' D .? < ' ID .? < D .? < ID .? < ' D .? < ' ID .<  DD%.?  : ; @ D 4I : ;  $> . : ; @ ID I: ;  II:  :  I8   .?  : ; @ ID  D D I !I/ .? < D .? < ID .? < ' ID I&I I8 .? < ' ID  DD%$> I4I?  : ;  .?  : ; @ D I: ;  4I : ;  I:  :  I8  I  !I/ .?  : ; @ D .?  : ;@ D .?  : ;@ D I: ; 4I : ; !I/.?  : ;@ ID .? < ID .? < D &I.? < ' ID I.? < ' D  :  I8 .? < ' ID  DD%$> 4I?  : ;  .?  : ; @ D I: ;  4I : ;  I :  I8 D I  !I/ I:  : .?  : ;@ D I: ; 4I : ; . : ;@ ID .?  : ;@ ID .?  : ;@ ID . : ;@ D .?  : ;@ D .? < D .? < ID &I.? < ' ID I I8 .? < ' ID  DD%$> 4I?  : ;  I :  I8 4I : ;  D I  !I/ I !I I .?  : ;@ D 4I : ; .?  : ;@ ID I: ; . : ;@ ID .? < D .? < ID &II: .? < ' ID I I8 .? < ' ID  DD%.?  : ; @ ID I: ;  4I : ;   $> II  !I/  :  I8 I: .?  : ; @ D .?  : ;@ ID I: ; 4I : ; 4I?  : ;  .? < ' D I.? < ' ID &I.? < D .? < ID  :  I8 .? < ' ID .? < ' ID  DD%.?  : ; @ D 4I : ;  $> I.?  : ;@ ID I: ; .?  : ;@ D  4I : ; I: I  !I/ . : ;@ ID  :  I8 I!II !I/4I?  : ;  .? < ID .? < D &I.? < ' ID I :  I8 .? < ' ID  DD%. : ; @ ID I: ;   4I : ;  $> II: <  :  I8 .?  : ; @ ID  .?  : ; @ D 4I : ; &I.? < ' D I.? < ' ID .? < D .? < ID  :  I8 .? < ' ID  DD%$> I: I4I : ;  .?  : ; @ ID I: ;  .?  : ; @ D   :  I8 .?  : ; @ ID .? < ID .? < ' ID I.? < ' D &I I8 .? < ' ID  DD%$> &II!I4I : ;  I !I/ I 4I?  : ;  .?  : ; @ D . : ; @ D  I: ;  I: . : ; @ D . : ; @ ID 4I : ; . : ;@ ID I: ; .?  : ;@ ID .?  : ;@ ID !I/.? < D .? < ID .? < ' ID I :  I8  I8 .? < ' ID  DD%  I8 I$> I: 4I : ;  . : ; @ ID  I: ;  <  :  . : ; @ D  .?  : ; @ D .?  : ; @ D .?  : ;@ D .?  : ;@ D I: ; 4I : ; . : ;@ ID .?  : ;@ ID . : ;@ D  :  .?  : ;@ ID .? < ID .? < D &I.? < ' ID I.? < ' D  I8 .? < ' ID ! DD%. : ; @ D I: ;  $> .?  : ; @ D 4I : ;   4I?  : ;  .? < ' ID  I ' D  I .? < D I: &I :  I8  I8 .? < ' ID  DD%$> I4I?  : ;  I:   I8 4I : ;  .?  : ; @ D  . : ; @ ID  I: ;  .?  : ; @ ID   ( .?  : ; @ ID . : ;@ ID I: ; 4I : ;  :  I8 I !I/.?  : ;@ ID  . : ;@ ID .? < D .? < ID &I.? < ' ID I.? < ' D  .? < ' ID !"#.< $ DD%.?  : ; @ D .?  : ; @ ID 4I : ;  $> 4I?  : ;  .? < ID .? < D I .? < ' ID  I I: &I :  I8  I8 .? < ' ID .<  DD%$> I !I/ 4I?  : ; n)every_first_cmdUcurr_ifileoold_ifileany_displaystart_attnposend_attnposlogfileforce_logfile2namelogfileMmainsave)ecallocskipspsprefixCquiteditprotoeditorless_is_moredohelpsecurequittingprogname2wscrolloinitial_scrposis_ttynew_filep?missing_capqraw_modescrsizespecial_key_str=get_termkinitdeinithomeadd_linelower_left line_left5 check_winchR goto_line vbell bell clear clear_eol clear_botu at_enter at_exit at_switch' is_at_equivo apply_at_specials putbs clear_bg) can_goto_lineF below_mem_ above_memx bl_e_width bl_s_width so_e_width so_s_width ul_e_width ul_s_width bo_e_width. bo_s_widthH sc_heighta sc_widthy werase_char kill_char erase2_char erase_char ignaw auto_wrapZ0 match_brac=ch_getch_ungetcharend_logfile sync_logfile:ch_seekch_end_seekch_beg_seek$ ch_lengthC ch_tell` ch_forw_get ch_back_get ch_setbufspace ch_flush seekable ch_init@ ch_closey ch_getflagsb ignore_eoi*WS)utf_modecharsetscs_aliases@binattr init_charsetBbinary_charcontrol_charprcharprutfcharutf_lenis_utf8_well_formedget_wcharput_wcharstep_char is_composing_char is_ubin_charL is_wide_char is_combining_charM*n'openquoteclosequoteamlist_searchml_searchmlist_examineml_examinemlist_shellml_shell5cmd_resetOclear_cmdicmd_putstrYlen_cmdbuf set_mlist] cmd_addhist cmd_acceptcmd_charcmd_intvget_cmdbufcmd_lastpattern init_cmdhistAsave_cmdhistXin_mcadispversiongetcc#ungetccNungetsccommands> cvt_lengthacvt_alloc_chposcvt_textWBinit_cmdsadd_fcmd_table add_ecmd_tablefcmd_decodeecmd_decodeDlgetenvlesskeyUadd_hometable; editcharafd0curr_altfilenameinit_textlistforw_textlist%back_textlistedit$edit_ifileNedit_list? edit_first_ edit_last edit_next edit_prev edit_index save_curr_ifile' unsave_ifile` reedit_ifile reopen_curr_ifile edit_stdin& cat_fileW use_logfile curr_ino curr_devshell_unquote[get_meta_escapeshell_quote\homefilefexpandHfcompletebin_file lglobk open_altfile| close_altfile2 is_dirbad_filefilesizePshell_coption<+no_back_scrollaeof_displayedentire_file_displayedsquish_checkforwbackjforwardbackward5get_back_scrollZforw_promptusquishedscreen_trashed-  Dhelpdatahsize_helpdatap,9del_ifileunext_ifileprev_ifilegetoff_ifileEnifileget_ifileget_filename3get_indexfstore_posget_posset_open+opened]hold_ifileheld_ifileget_filestateset_filestate:G>4forw_lineback_lineset_attnposf{Ljump_forwjump_backDrepaintjump_percentjump_line_locdjump_loc2[Ysize_linebuftabstopsntabstopstabdefault-init_lineis_ascii_charprewindplinenum:pshift_allis_ansi_endPis_ansi_middle pappend pflushmbcT pdone set_status_col gline5 null_lineP forw_raw_line back_raw_line'hshiftVw"clr_linenumadd_lnumfind_linenumefind_poscurrline6bo"lsystemVpipe_markpipe_datacїinit_markObadmark|setmarklastmark gomarkamarkposunmarka/tagoptionHopt_oopt__O4opt_lopt_jcalc_jump_slineopt_shiftcalc_shift_countopt_kopt_topt__Topt_popt__Pxopt_bopt_iopt__V$opt_xopt_quotelopt_queryget_swindowRC'plusoptionAscan_optionltoggle_optionsingle_char_optionopt_promptKisoptpendingnopendoptgetnum8getfractionget_quit_at_eofB(jump_sline_fractionKshift_count_fractionvless_is_moreinit_option-findoptfindopt_namehilite_search oldbot follow_mode1 quit_on_intrM use_lessopeni status_col shift_count show_attn twiddle no_keypad no_init chopline jump_sline0 swindowG force_opena ctldispx bufspace autobuf linenums caseless forw_scroll back_scroll tabstop$ squeeze; quit_if_one_screen] quit_at_eofx know_dumb bs_mode pr_type top_scroll how_search quietnireadWintreadoget_timeerrno_messagepercentagepercent_posTreading put_lineflushputchrputstr,postoalinenumtoapinttoacget_returnerrorrierrorquery9at_promptRfinal_attrlneed_clrerrmsgs^0fcompile_pattern>uncompile_patternis_null_patternmatch_pattern.Ypositionadd_forw_posadd_back_pospos_clearDpos_initonscreenempty_screenempty_linesNget_scrposadjsline'weqprotohprotowprotoinit_promptpr_expand%eq_messageEpr_stringwait_message prproto<init_searchrepaint_hiliteclear_attnundo_searchclr_hlistHclr_hilitedclr_filteris_filtered$is_hilitedchg_caselessX chg_hilite search prep_hiliteset_filter_patternpis_filtering?mX ~winchinit_signalspsignals^sigsf)tagscleantagsgettagtype findtagtagsearchnexttag prevtagdntags~curr_tagedit_tagfileB| open_getchr:close_getchrWgetchrtty]CversionyPOSITIONIscrpos size_t tm/ wint_tu __FILE off64_t ssize_t off_t%FILE%tcflag_tEcc_titermioshwinsizeQrlim64_t`rlimit64rlim_trlimitspeed_tnsize_ttmwint_t__FILEJoff64_trssize_tZoff_tFILEnZ0 POSITIONsize_t tm(wint_tn__FILEoff64_tssize_toff_t FILEl=mode_tdev_t-bufnodeBLOCKNUMbufPOSITION(LINENUM6pargtPARGino_tnlink_tuid_tgid_toff_ttime_ttimespec2timestruc_tDblksize_tTblkcnt_tstat filestate~ ino64_t off64_t blkcnt64_t stat64size_ttmwint_t#__FILEssize_tFILEWSScharsetcs_aliasLWCHARwchar_rangew size_t tm wint_t __FILENoff64_tvssize_tfoff_twFILE@*n'mode_tdev_tmlistLLWCHAR[LINENUM__FILEFILEino_t(nlink_t6uid_tBgid_t_off_tktime_txtimespectimestruc_tblksize_tblkcnt_tstattextlistino64_toff64_tblkcnt64_tBstat64~size_ttmwint_tq!ssize_tLINENUMpargPARG,optnameuloptionPOSITIONsize_t?tm^wint_t__FILEoff64_t0ssize_toff_t:FILEl LWCHAR\size_ttmwint_t9__FILEoff64_t ssize_toff_t FILEWtablelistFPOSITIONLINENUMparg0 PARG size_tY tmx wint_t __FILEoff64_t9ssize_t!off_t~FILEUmode_tdev_ttextlistPOSITIONscrposLINENUMpargPARGNino_tZnlink_thuid_ttgid_toff_ttime_ttimespectimestruc_tblksize_tblkcnt_t-statino64_t<off64_tJblkcnt64_t}stat64size_ttmwint_t__FILEssize_tFILE*mode_tdev_tLWCHARPOSITIONoff_t__FILEFILE ino_t nlink_t uid_t gid_t time_t( timespecX timestruc_tj blksize_tz blkcnt_t statuino64_toff64_tblkcnt64_tstat64size_ttmwint_tssize_tz<POSITIONELINENUMwsize_ttmwint_t__FILEW off64_t ssize_to off_tFILEa  size_ttm wint_tQ__FILEoff64_tssize_toff_t FILEp,POSITIONscrposifilesize_t1tmP wint_t __FILE off64_t" ssize_t off_t,FILEnG>4POSITIONosize_ttmwint_t__FILEOoff64_twssize_tg off_t FILE{LrPOSITIONLINENUMparg9PARGwscrpossize_ttmwint_t:__FILE off64_t ssize_t off_t FILE[LWCHARPOSITIONLINENUMOsize_t tm?wint_tt__FILEoff64_tssize_toff_tFILEwfPOSITIONuLINENUMlinenum_infosize_ttmwint_tL__FILE off64_t ssize_t off_t FILEnboPOSITION__FILE}FILEMsize_ttmwint_t off64_t ssize_t off_tїPOSITIONscrposmarksize_ttm wint_tO__FILEoff64_tssize_t off_t FILEaLINENUMpargPARGwPOSITIONJ size_t tm? wint_t __FILEoff64_tssize_toff_tFILERC;optnameloptionLINENUM#pargaPARG[ size_tr tm wint_t __FILE; off64_tc ssize_tKoff_tmFILEyoptname loption size_t^ tm}wint_t__FILE4off64_t\ssize_tLoff_tnFILE.Hsigset_ttime_tPOSITION-jmp_buf7size_ttmwint_t(__FILE off64_t ssize_t off_t FILEPOSITIONQLINENUMpargSPARG9size_ttm wint_t7 __FILE off64_t ssize_t off_tFILE0fsize_t$regex_tregoff_tLregmatch_ttmwint_t __FILE off64_t ssize_t off_tFILEy.1POSITIONxscrposqsize_ttmwint_t__FILEQoff64_tyssize_ta off_t FILEz'POSITION)LINENUM size_t1 tmP wint_t __FILEoff64_t"ssize_t off_t,FILE<vPOSITION hilite+size_tYregex_tpattern_infoJLWCHAR2 scrpos' LINENUM!tm@wint_t__FILEoff64_t.ssize_toff_t'FILEkmX size_ttmwint_t;__FILEoff64_tssize_toff_t pid_t FILEfOLINENUM]tagtaglist`tag_resultPOSITION__FILEFILE size_t tm wint_toff64_tssize_toff_ta| /size_tFtmewint_t__FILEoff64_tDssize_t4off_tV FILEosave_status'init_doneZattrmodecurr_onsave_termsaved_termlenvstbufsbuf costcount hardcopysc_deinit(sc_init>sc_e_keypadXsc_s_keypadrsc_backspacesc_visual_bellsc_bl_outsc_bl_insc_b_outsc_b_insc_u_outsc_u_in3sc_s_outJsc_s_in`sc_eos_clear{sc_eol_clearsc_clearsc_movesc_returnsc_lower_leftsc_addlinesc_home&sc_padB=ch_ungotcharmaxbufstriedK thisfileWSbinfmt(utfbinfmtbufJbufcomp_tablecomp_table<comb_tablegcomb_tableubin_tableubin_tablewide_table wide_table chardef*n'in_completioncurr_mlistcmd_mbc_buf_index<cmd_mbc_buf_lenkcmd_mbc_bufcurr_cmdflagstk_tlisttk_trialtk_ipointtk_original3tk_textIliteral_cmd_offsetxcpprompt_colcmd_colcmdbuf/ungotpDshellcmd pipec save_hshift. bottomposF optgetname_ optflagu optchar fraction number search_type mca ungotWHcmdtablercmdtableedittableedittablelist_fcmd_tables:list_ecmd_tablesYlist_var_tableswlist_sysvar_tables curr_altpipe2mchars/is_a_dirnot_reg<first_time$p,anchor.ifiles[)linebuf?attrlast_overstrikembc_buf_lenmbc_buf_indexmbc_pos;mbc_bufQmid_ansi_charsnend_ansi_charspendpospendclmarginis_null_lineoverstrikecolumncurr=cshiftTw^startimeuloopcountsparepoolfreelistanchorї=smmarks"RCbufpendopta_optnameb_optnameB__optnamec_optname1d_optnameIe_optnameaf_optnameyF__optnameg_optnameh_optnamei_optnamej_optnameJ__optname k_optname#K__optname<L__optnameUm_optnamemn_optnameo_optnameO__optnamep_optnameP__optnameq2_optnameq_optnamer_optname0s_optnameHS__optnameat_optnameyT__optnameu_optnameV__optnamew_optnamex_optnameX__optname y_optname$z_optname<quote_optnameXtilde_optnametquery_optnamepound_optnamekeypad_optnameoldbot_optnamefollow_optnameoptionoption3consecutive_nulls;read_labelYobreturn_to_continue'intr_to_abortUintr_to_abort&obuf'.Etabletable_size'Ds_protoks_protom_protom_protoM_proto M_proto7e_proto^e_protoh_protoh_protow_protow_proto*more_protoTmore_protompmessage<hilite_anchorfilter_anchorfilter_infosearch_infois_ucase_patternis_caselessprep_endposprep_startpos5hide_hiliteGftaglistf circular~ curtag curseq totalltget_envltgetflagltgetnumiltgetstrinc_costcountJcostcheapertmodes beep clear_eol_botS=mknodbuffered$ ch_addbufm init_hashtbl ch_delbufsbWSWichardeficharset#ilocalePsetbinfmtset_charset+ is_in_table*n' mknodcmd_step_common2cmd_step_rightcmd_step_left6cmd_repaintcmd_homecmd_lshifta cmd_rshift cmd_rightT cmd_left cmd_ichar cmd_eraseU cmd_deletet cmd_werase cmd_wdelete cmd_kill cmd_updown cmd_edit* cmd_istr delimit_word~init_complnext_compl?cmd_completehistfile_namesave_mlist[cmd_execsstart_mcamca_searchmca_opt_toggleexec_mcamca_charclear_buffersmake_displaypromptmulti_searchWexpand_special_keys]add_cmd_tablePadd_var_tablecmd_searchCcmd_decodegintold_lesskeynew_lesskeyTmknod|close_file~ edit_istep edit_inextO edit_iprevi$mknodmetacharsmetachardirfileseek_filesize readfdshellcmd<Ieof_bellZp,Cincr_index}link_ifileunlink_ifilenew_ifile`find_ifile[Gexpand_linebufpshiftVattr_swidthattr_ewidthpwidth>backcin_ansi_esc_seqstore_charstore_taba store_prchar flush_mbc_bufM do_appendIwcalcgaplongloopmessagelongishabort_long'їSgetumarkgetmarkQRC)flip_triplekproptmnostringoptstringQnum_errornis_optchar@iprint_intOiprint_linenumless_printf-0f"compile_pattern2match'ap_str0ap_char|ap_posap_linenumHap_intap_questcurr_bytecond>protocharskipcond_wherechar<set_pattern-clear_pattern^init_patternget_cvt_opsis_ucaseWprev_patternis_hilited_rangeadd_hilitehilite_linehilite_screent search_pos search_range5 hist_pattern'mX u_interruptVstop|fFmaketagentfindctagctagsearchfindgtag~ nextgtag prevgtag gtagsearch getentry.interp.SUNW_cap.hash.dynsym.dynstr.SUNW_version.rel.data.rel.bss.rel.plt.text.init.fini.rodata.rodata1.got.dynamic.bssf.symtab.strtab.annotate.comment.debug_loc.debug_info.debug_line.debug_abbrev.debug_pubnames.debug_typenames.debug_varnames.debug_funcnames.shstrtab o +!"AAC&)ogg`7 BPhPhA BXhXh(J BhhP NjjSooޓY``_||e/m4343!vTT4{VV;WW" y yE y y2 yP?F p,od, {  %:394mjb +   *070701000732f0000081ed0000000000000000000000014cad6b3b00006c24000000b500010002ffffffffffffffff0000001b00000000root/usr/local/bin/lesskeyELF 4f4 (! 44o&&&& ,','/usr/lib/ld.so.1ON !#$&'(*+-0134569:=ABCDFGK  "%),./278;<>?@EHIJLMF (  (/P(7X > I*n*z8 *0` X(& h x  |! "2 ph 6  4x  ;*6!C,(U Z! `*kT(s*!x 0    *(**(# 0.r**   00] * $H + 8 ?,'H f (n*(!y&pu   *x @{ `  @r  H `b 2init_tablesstrncmpfindaction__environ_lockoutfilefwriteparse_args.XBKgoyL7sWrM07N.tstr.tstr_control_keditsectionstrcmp_edataskipnspcmdnames_GLOBAL_OFFSET_TABLE__exitfopen64perrorfputintfprintf_init_get_exit_frame_monitorerrorsparse_lineadd_cmd_stratexit_end_PROCEDURE_LINKAGE_TABLE__lib_version__longdouble_usedmain_finiendsectioninfile__iobparse_cmdlineclean_line_startcurrtableeditnamescmdsection_environusagecmdtableedittablevarsectionstrlenfgetsgetenvlinenumfputbytes.XBKgoyL7sWrM07N.tstr.bufskipspcontrol_linestrcat_DYNAMIC__1cG__CrunMdo_exit_code6F_v____Argvfileheader_etexthomefilecallocstrcpyfiletrailermkpathname__fsr__fsr_init_valueparse_varlinetstr__fpstartadd_cmd_charvartablelibc.so.1SUNW_1.1SUNWprivate_1.1libz.so/usr/local/lib'= qN ((<*0&J&&&&&2&B'C':'4 '' 'K'' '$'3('5&%&%&h%&h%&h%&h%&h %&h(%&h0%'h8p%'h@`%'hHP% 'hP@%'hX0%'h` %'hh%'hp% 'hx%$'h%('hjjR,'th!$(t((t PE(u T(RU  (RPjTPbj{URQt`|$у0( D$td$у`tƒ 3fd$f T$tfd$f L$l$YZ]Uh!h+jjÐU ]jEPjE PjDPEEPEPh!EPE PEPEEE]ÐU jh!EEt$E@tEPEPGE)h!h+EPh"EEEEÐUP(EHEEE E E @EE@-tuE@ubE@-u$E@uEHEE E 2jh"EP u@E@uEP($E@=uE P(3h("EPNuTE @P(P(@u(EHEEE E E @P(Rh*h4"jj5U+E@V} -ߐVtoj΋EHEEhE~E~E @T(jhL"T(ÐUX(000(*...222ÐUE@EE@E0EEUE@DЈEE@EE@0|E@7E@EE|EUPE tE u*EE***EEU@BX"EEU@B***EmEU@B\"EUEU@B`"E=EU@Bd"E%E E3E#EEEEEE Ejhh"hEU@B"EZE@EE@h}-d}DwU^묃d#ez똃r}hZl!|u}riuxFQEU@B *E*******EtEU@BE@**E t* u*E/*EEPb}BЃw$n},e}b>yeGkar}nVMr_tn5EUBE@*** u *Ei*E^E@\^tEU@BE@**E t* u *E *EE````````UE@ t E@ uE@EE@ tE@ tEEEÐUE@tCE@ t7E@ t+E@EE@tE@ t E@ uՋEEEUjEP?EEEE@ t{EE@ tlEE@t]EE@#uEtEE@\t5E@EEE@ tEE@ tEE@uUUBEEEÐU**H;rjh"jj*EE@EEU@BEUBÐUE@t%E@jPrE@EE@uÐUjh"Ph"EP u.*Ejh"xPh"EP u0*Ejh"8Ph"EPv u2*EQjh"Ph"EP: u"jjajjgUEEEÐUEEEHEEEE~:jjEPjjE PE @E EEEHEEEEÐUE =r+jjhE Ph"h+ jjE ?EjjEPjjEPoE EjjEPjjEPNÐUE*U@ЃtN*MPEPPu*U@DE0E@E*U@Ѓujh"EdEÐUjjEP0Ph"h+2@2UEjEPXEjEPU‰EE~jh#jEPE@ tE@ t E@ujjjEPwEE@ujh#EEjEPEE@EUBjEPIEEUBjEPEE@ujEPaPE jPLE@t%jEPjPE@ujjÐU jEPEjEPNE@ t$E@ tE@=t E@ujjjEPEE@EE@EEEE=tjh(#ejhPjEPEE@t+jEPEjEPE@ujjÐUjEPtKjEPEE@u+*=2ujEPjEPÐU E PEPh4#T(P*u*E6h8#T(P4EEujT(P)i20EPhP t90@0jPEPhP uǡ2~$2Ph<#h+ jjP(ujh\#P(P(ujhd#MP(hl#P(P-EEujP(P"jj6jh*EP jh*EP 0-0PEP0-0Ph0EPu jh*EPb .-.PEP.-.Ph.EP/ jh*EP 2-2PEPe2-2Ph2EP jh*EP jh*EP EEUWVS[Q[^_UWVS[5[^_usage: lesskey [-o output] [input] /HOMEcannot find $HOME - using current directory .--output--versionlesskey version %s .lesskey illegal char after \ktoo many commands#line-edit#command#env#stoperror: integer too big (%d > %d) unknown actionline %d: %s command too longmissing actionmissing =-r%d errors; no output produced LESSKEY.lesswbback-bracketback-lineback-line-forceback-screenback-scrollback-searchback-windowdebugdigitdisplay-flagdisplay-optionendexaminefilterfirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-lineforw-line-forceforw-screenforw-screen-forceforw-scrollforw-searchforw-windowgoto-endgoto-linegoto-markhelpindex-fileinvalidleft-scrollnext-filenext-tagnoactionpercentpipeprev-fileprev-tagquitremove-filerepaintrepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markshellstatustoggle-flagtoggle-optionundo-hiliteversionvisualback-completebackspacedeletedownexpandforw-completehomeinsertkill-lineleftliteralrightupword-backspaceword-deleteword-leftword-right,'          . > N ^ n ~    |! !##t 2 oo o  o`o& p#$######"#####$ $7$ $ ($ 8$#H$2X$ d$t$ $($$$!$$$$$&$f$)%%5%e(%0%%8%D%6P%X%4d%l% |%+%,%-%.%*%%%%/%/ &'& & (&8&D&L&# T&\&l& t&$f|&&&&& & & && (0M+GcevxEnd436t     x   |! ! !!&,'(** 4 $(;((NT0( _k(v*!v*kP(!v*k*!F (  (P(X  *$*08 7*>0` FX(O&f kh sx z  |!  "2e ph 6  4x  *!,(  ! *!T()*!. t0 < G  N*X(*b*m(v# |0.(**   00] * H   ,'  ($*n(!/&6pu ? F M*Yx d@{ j{`  @r  H `b 2lesskeycrti.scrt1.ocrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptrfsr.strap_tablevalues-Xa.cDdata.dataBbss.bssDrodata.rodatalesskey.cversion.ccrtn.s_END__START_init_tablesstrncmpfindaction__environ_lockoutfilefwriteparse_args.XBKgoyL7sWrM07N.tstr.tstr_control_keditsectionstrcmp_edataskipnspcmdnames_GLOBAL_OFFSET_TABLE__exitfopen64perrorfputintfprintf_init_get_exit_frame_monitorerrorsparse_lineadd_cmd_stratexit_end_PROCEDURE_LINKAGE_TABLE__lib_version__longdouble_usedmain_finiendsectioninfile__iobparse_cmdlineclean_line_startcurrtableeditnamescmdsection_environusagecmdtableedittablevarsectionstrlenfgetsgetenvlinenumfputbytes.XBKgoyL7sWrM07N.tstr.bufskipspcontrol_linestrcat_DYNAMIC__1cG__CrunMdo_exit_code6F_v____Argvfileheader_etexthomefilecallocstrcpyfiletrailermkpathname__fsr__fsr_init_valueparse_varlinetstr__fpstartadd_cmd_charvartableanotate anotate0 ,( ,' !I$(((anotateP LH````````@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03acomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.497lesskey.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g lesskey.c -W0,-xp.XAKgoyL7sWrM07N.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL7sWrM07N.;backend;raw;cd;DBG_GEN 5.2.7char"intcmdnamegcn_name*#cn_action/#long6g9cmdnameso^X( 6geditnames(*6" g tablenames#pbuffer*#buffer#currtable* "Egfileheader4* "pgfiletrailer_* "gcmdsection* "geditsection* "gvarsection* "gendsection *infile*T(outfile*P( usageU mkpathnamehU**dirname*filename pathname* homefilepU*:*filenamep*pathname*parse_args U/argc argv  arg* *init_tablesU6Utstrg@U*Wppd/xlated p*hch"ii/jbufWk*tstr_control_khl* " hg "ygskipsp(U**sskipnsp0U**sclean_lineQU**si/add_cmd_char`UJ/cadd_cmd_strUy*scontrol_line$U/*sfputbytesA0Ufd=*buf= /len=unsigned charunsigned__FILE_cnt/#_ptr #_base #_flag# _file# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  FILEfputintPUTfdMvalM c"QfindactioneU/*actnameci/ferrorrU*spparse_cmdline{VUb *pycmdlen/|actname*}action/~s*c"parse_varline`iU *ps*parse_linepU *linep*main|!U/f /argcargv descoutlinef "y gerrors/2linenum/0vartable2edittable.cmdtable0" " strncmp/(   "( size_tstrlen2 Y - "Y strcpy* *^ " " strcmp/   " strcat* * mkstemp64/ *mkstemp64/ *" getenv*<  exitP /voidP callocX | gg tm$$ tm_sec/#tm_min/#tm_hour/#tm_mday/# tm_mon/#tm_year/#tm_wday/#tm_yday/#tm_isdst/#  $ __wcsftime_xpg52 ` | 2  ) wchar_t` ` p k __wcstok_xpg5k  k u z gwint_t__putwchar_xpg5   __putwc_xpg5   __getwchar_xpg5 __getwc_xpg5 = __ungetwc_xpg5 d  gd__fputws_xpg5/in__fputwc_xpg5   __fgetws_xpg5k k /__fgetwc_xpg5  long longlockf64/B//"Btruncate64/oGoff64_ttell64o//ssize_tP pwrite64P pread64 lseek64o./o/ftruncate64/R/"Rtruncate64/Woff_ttell64/P pwrite64pread64lseek64)//lockf64/N//ftruncate64/r/"r"|attropen64/w/"openat64///"unsigned longcreat64/"open64/E /"E"Oattropen64/JT/"openat64///"creat64/"open64//ftello64o(fseeko64/Nn/Nfsetpos64/znSfgetpos64/nztmpfile64""freopen64""fopen64#ftello64D#fseeko64/jn/"jperrorofsetpos64/nfgetpos64/nzP fwrite2 2 2 fgets*3*/n"3printf/X8"Xfprintf/n]""freopen64""fopen64tmpfile64fopen64 fopenYversion.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g version.c -W0,-xp.XAKgoyL7sWrMU6N.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL7sWrMU6N.;backend;raw;cd;DBG_GEN 5.2.7L charlong"C*version2*H  /var/tmp/less-436/usr/include/usr/include/iso/usr/include/syslesskey.cstdio_impl.hstdio_iso.htypes.htime_iso.hwctype_iso.h  ) 9 J Z ` pv      % 1 8 D L dk t |              + 0 D HZ f p^p5         ) 4 @FO T[ `h o            ( 2 @ J X b p z             , ; E Tr       ! + <F R \ p   # - 9 D Peo {        # 06Z a      ~8F L `f~       < G T z           06Q i p}       0 P d~~          . R^o {          # < H T `fw       $ 0 A O}[g pv         $ BRWa k   }        +  I Y e x           !! .! J!]! p! w! 5/ /var/tmp/less-436version.c DD%$> I  I8 I !I/ 4I?  : ;  I  !I/   .?  : ; @ D .?  : ; @ ID I: ;  4I : ;  .?  : ;@ D I: ; 4I : ; .?  : ;@ D .?  : ;@ ID  :  I8 I: .?  6 : ;@ ID &I.? < ' ID I.? < ' D .? < ' ID  .<  DD%$> I !I/ 4I?  : ; cmdnameseditnamescurrtableEfileheaderpfiletrailercmdsectioneditsectionvarsectionendsection8infileNoutfileeusage{mkpathnamehomefile:parse_argsinit_tableststryskipspskipnspclean_lineadd_cmd_charJadd_cmd_strycontrol_linefputbytesfputintTfindactionerrorparse_cmdlineb parse_varline parse_line mainy errors linenum vartable edittable cmdtable]Cversionw6cmdnametable__FILEFILE2 size_t tm wint_tooff64_tssize_toff_t)%buf8tstr_control_k.interp.SUNW_cap.hash.dynsym.dynstr.SUNW_version.rel.data.rel.bss.rel.plt.text.init.fini.rodata.rodata1.got.dynamic.bssf.symtab.strtab.annotate.comment.debug_loc.debug_info.debug_line.debug_abbrev.debug_pubnames.debug_typenames.debug_varnames.shstrtab o| !"tt2)o  07 B  A B  J B   Nx x 0S  Y|!|!_!!e!!m!! v&&T{,',';((**E** *P8 83o67K==zaU `2c 8e{e- e070701000732ef000081ed0000000000000000000000014cad6b3b00004448000000b500010002ffffffffffffffff0000001c00000000root/usr/local/bin/lessechoELF4>4 ("!44o|00/usr/lib/ld.so.1))  !"%&( #$'dD#hBdJ!Ojrl@ T4!$`0\  #- 4;t"SXn   xI$eT 0 { .XAKgoyL7sWrMU$N.openquotestrcmp.XAKgoyL7sWrMU$N.num_metacharsstrlen__iob_GLOBAL_OFFSET_TABLE__lib_version.XAKgoyL7sWrMU$N.metachars_initstrchrfprintf_edata_environ_exit.XAKgoyL7sWrMU$N.meta_escape_DYNAMIC.XAKgoyL7sWrMU$N.closequote_PROCEDURE_LINKAGE_TABLE___environ_lock__fpstart_startatexit_get_exit_frame_monitor.XAKgoyL7sWrMU$N.quote_all__1cG__CrunMdo_exit_code6F_v__etextmain_end.XAKgoyL7sWrMU$N.meta_escape_buf___Argv.XAKgoyL7sWrMU$N.version_fini__longdouble_used__fsr_init_value__fsrlibc.so.1SYSVABI_1.3SUNWprivate_1.1libz.so/usr/local/lib7qN $, & $ (,5%%h% h%h%h%h %h(% h0%$h8p%(h@`%,hHPjjR0t_hU(t,t P7Eu TRU $RPPjURQt`|$у4 D$td$у`tƒ 3fd$f T$tfd$f L$l$YZ]UhhrÐUEETEE@ t'E@uE@EE@ uًE@EE@$tWE@ tKE@t?E@UBE@EE@EE@$tE@ t E@uUBEPh ÐUEPh h~ jjBÐUEEE@ t E@ uE@EE@ tE@ tE@-uEE@EE@+uE@EE uIE E@0u6E E@E$E E@EE@xtߐE@0|E@9E@0EUE@a|E@fE@WE-E@A|E@FE@7E*E;E |EE U‰EE@E]Et@E@ t E@ uE@EE@ tE@ tEUPEt E؉EEEEÐU EEHEE%E E E @EE@-uEtXE@EE@\E@EEPjEP \E;Eujh$B|E@Eh<EPu@` E`AE@EEPjEP `E;EujhDE@EE@dE@EEPjEP dE;Eujh\jhEh@hE@EEU@lhlbhEh@hE@EEPjEP' U舂lE;EujhthlEE@EE@u EhEP.uE>hEPuUEjh,jhZE@EEPm}8c}$?} -Jǃ?+aB볍Bw$rBw$EHEEEEEHEEEEbEE @EE E EEE@t8E@Phlt EE@EE@uȡXuEt?j`Pu*d\jjPEPRhjEEE@tUE@Phlxt`Ph@E@Ph+E@EE@uE~jhjhEEEHEEEEEE  X  0p  UWVS[][^_UWVS[A[^_usage: lessecho [-ox] [-cx] [-pn] [-dn] [-mx] [-nn] [-ex] [-fn] [-a] file ... %s Missing number after -d-Missing number after -fMissing number after -pMissing number after -nversionhelpInvalid option after --Invalid option letter%c%s%c%s%c $Revision: 1.13 $\0 *:JZjz4  << Kh ortoDoPt`o`ot""436hDt|     0 !x (<,OU4 `lw   '  wlTwldDhd'!,Bl@] cTk4rz!j$`0\   y t"#X> \c  hx&m$T 0 { lessechocrti.scrt1.ocrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptrfsr.strap_tablevalues-Xa.cDdata.dataBbss.bssDrodata.rodatalessecho.cpr_usagepr_versionpr_errorlstrtolversion.ccrtn.s_END__START_.XAKgoyL7sWrMU$N.openquotestrcmp.XAKgoyL7sWrMU$N.num_metacharsstrlen__iob_GLOBAL_OFFSET_TABLE_.XAKgoyL7sWrMU$N.metachars_initstrchrfprintf_edata_environ_exit.XAKgoyL7sWrMU$N.meta_escape_DYNAMIC.XAKgoyL7sWrMU$N.closequote_PROCEDURE_LINKAGE_TABLE___environ_lock__fpstart_startatexit_get_exit_frame_monitor.XAKgoyL7sWrMU$N.quote_all__1cG__CrunMdo_exit_code6F_v__etextmain_end.XAKgoyL7sWrMU$N.meta_escape_buf___Argv_lib_version.XAKgoyL7sWrMU$N.version_fini__longdouble_used__fsr_init_value__fsranotate anotate0 ,(0) (,anotateX TPrr v zX ~ 0p  @(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03acomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.497lessecho.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g lessecho.c -W0,-xp.XAKgoyL7sWrMU\$N.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL7sWrMU$N.;backend;raw;cd;DBG_GEN 5.2.7char%version-Tintquote_allH!Xopenquote%"dclosequote%#\meta_escape-$`long%@?metachars&lnum_metacharsH'hpr_usage+  Upr_version2  Unp-3bufn4pbuf-5%  pr_errorC  U -sA lstrtolM  U( -sI HradixI (pendIvHNnegHOnP- main rUH Hargc (argv arg-s-no_more_optionsH f G Ghas_metaH%meta_escape_buf% %strchr-;H %;unsignedEsize_tstrlenQx@ %x %strcmpH}mkstemp64H-mkstemp64H-exitH tm$tm_secH#tm_minH#tm_hourH#tm_mdayH# tm_monH#tm_yearH#tm_wdayH#tm_ydayH#tm_isdstH# __wcsftime_xpg5QQwchar_t __wcstok_xpg5'wint_t__putwchar_xpg5'W'unsigned charW__FILEI_cntH#_ptrh#_baseh#_flagW# _fileW# __orientationE# __ionolockE#  __seekableE#  __extendedfdE#  __xf_nocheckE#  __fillerE#  m__putwc_xpg5's'I__getwchar_xpg5'__getwc_xpg5'I__ungetwc_xpg5''I m__fputws_xpg5H__fputwc_xpg5'.'Im__fgetws_xpg5^H.__fgetwc_xpg5'Ilong longlockf64HHH %truncate64Hoff64_ttell64 HHssize_tvoid   pwrite64 Q  ! E pread64   Q Elseek64 HHftruncate64H H % truncate64H  off_ttell64  H   pwrite64 Q  ! Epread64 {  Q Elseek64  H Hlockf64H HHftruncate64H H % % attropen64H&   H %& openat64HW H+ H %W unsigned longcreat64H \ a % open64H  H % % attropen64H   H % openat64H* H H %* creat64HT / a %T open64H~ Y Hmftello64 ~ fseeko64H H  fsetpos64H  fgetpos64H  mFILE tmpfile64#  %; %E freopen64# v @ J # %v % fopen64#  {  mftello64   fseeko64H H  fsetpos64H fgetpos64H? %?printfHdD %dfprintfHi % %freopen64# # % %fopen64# tmpfile64# YJversion.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g version.c -W0,-xp.XAKgoyL7sWrMU6N.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKgoyL7sWrMU6N.;backend;raw;cd;DBG_GEN 5.2.7+charlong"C*version2' /var/tmp/less-436/usr/include/sys/usr/include/isolessecho.ctypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h  ,    4       ~ 2  F  q  |                        (  4  ; C  J  V  X _  f  h  o  t x                   #  *  0  8 P  W  o  x                             :  B  Q  X  u                        ) 0 Z k p            # 0 F K X g x@{    / I P T{g     |' 8 Gffm 5/ /var/tmp/less-436version.c DD%$> I4I : ;  I !I/ . : ; @ D . : ; @ D  I: ;  . : ; @ ID  .?  6 : ; @ ID   &I.? < ' ID II: .? < ' D  :  I8  I8 .? < ' ID  DD%$> I !I/ 4I?  : ; -main]CversionCpr_usagepr_versionpr_errorlstrtolaQsize_ttm'wint_tm__FILEoff64_t ssize_t off_t FILE2versionOquote_allgopenquoteclosequotemeta_escapemetacharsnum_metacharsmeta_escape_buf.interp.SUNW_cap.hash.dynsym.dynstr.SUNW_version.rel.data.rel.bss.rel.plt.text.init.fini.rodata.rodata1.got.dynamic.bssf.symtab.strtab.annotate.comment.debug_loc.debug_info.debug_line.debug_abbrev.debug_pubnames.debug_funcnames.debug_typenames.debug_varnames.shstrtab oP hh!"K)oDD07 BttA B||J BP NS Y_em,v4{00;EP= oK$$pc5d:Y<9<G<e>=  =*07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!