# PaCkAgE DaTaStReAm less 1 1258 # end of header 0707010008d31a000081a40000000000000000000000014cad6b87000000fe000000b600010002ffffffffffffffff0000000d00000000less/pkginfoPKG=less NAME=less 436 i86pc Solaris 11 VERSION=436 PSTAMP=7th October 2010 VENDOR=Mark Nudelman EMAIL=http://www.greenwoodsoftware.com/less/index.html DESC=Less pager ARCH=i386 CATEGORY=utility CLASSES=none BASEDIR=/ ISTATES=S s 1 2 3 RSTATES=S s 1 2 3 0707010008d319000081a40000000000000000000000014cad6b87000002f2000000b600010002ffffffffffffffff0000000c00000000less/pkgmap: 1 1258 1 d none /usr ? ? ? 1 d none /usr/local ? ? ? 1 d none /usr/local/bin 0755 root root 1 f none /usr/local/bin/less 0755 root root 496512 46202 1286433567 1 f none /usr/local/bin/lessecho 0755 root root 18120 38402 1286433567 1 f none /usr/local/bin/lesskey 0755 root root 28428 60525 1286433567 1 d none /usr/local/share 0755 root root 1 d none /usr/local/share/man 0755 root root 1 d none /usr/local/share/man/man1 0755 root root 1 f none /usr/local/share/man/man1/less.1 0644 root root 64758 39463 1286433567 1 f none /usr/local/share/man/man1/lessecho.1 0644 root root 1225 37295 1286433567 1 f none /usr/local/share/man/man1/lesskey.1 0644 root root 9624 25944 1286433567 1 i checkinstall 790 2505 1286433686 1 i pkginfo 254 19873 1286433671 07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!0707010008d31a000081a40000000000000000000000014cad6b87000000fe000000b600010002ffffffffffffffff0000000800000000pkginfoPKG=less NAME=less 436 i86pc Solaris 11 VERSION=436 PSTAMP=7th October 2010 VENDOR=Mark Nudelman EMAIL=http://www.greenwoodsoftware.com/less/index.html DESC=Less pager ARCH=i386 CATEGORY=utility CLASSES=none BASEDIR=/ ISTATES=S s 1 2 3 RSTATES=S s 1 2 3 0707010008d319000081a40000000000000000000000014cad6b87000002f2000000b600010002ffffffffffffffff0000000700000000pkgmap: 1 1258 1 d none /usr ? ? ? 1 d none /usr/local ? ? ? 1 d none /usr/local/bin 0755 root root 1 f none /usr/local/bin/less 0755 root root 496512 46202 1286433567 1 f none /usr/local/bin/lessecho 0755 root root 18120 38402 1286433567 1 f none /usr/local/bin/lesskey 0755 root root 28428 60525 1286433567 1 d none /usr/local/share 0755 root root 1 d none /usr/local/share/man 0755 root root 1 d none /usr/local/share/man/man1 0755 root root 1 f none /usr/local/share/man/man1/less.1 0644 root root 64758 39463 1286433567 1 f none /usr/local/share/man/man1/lessecho.1 0644 root root 1225 37295 1286433567 1 f none /usr/local/share/man/man1/lesskey.1 0644 root root 9624 25944 1286433567 1 i checkinstall 790 2505 1286433686 1 i pkginfo 254 19873 1286433671 0707010008d328000041ed0000000000000000000000024cad6b8700000000000000b600010002ffffffffffffffff0000000800000000install0707010008d329000081ed0000000000000000000000014cad6b9600000316000000b600010002ffffffffffffffff0000001500000000install/checkinstall#!/bin/sh # expected_bits="64" expected_release="5.11" expected_platform="i386" # release=`uname -r` platform=`uname -p` bits=`isainfo -b` # if [ ${platform} != ${expected_platform} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_platform} architecture\n" echo "\tAborting installation.\n\n\n" exit 1 fi if [ ${release} != ${expected_release} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_release} machine\n" echo "\tAborting installation.\n\n\n" exit 1 fi #if [ ${bits} != ${expected_bits} ]; then # echo "\n\n\n\tThis package must be installed on a ${expected_bits} bit machine\n" # echo "\tYour machine is running a ${bits} bit O.S. currently\n" # echo "\tAborting installation.\n\n\n" # exit 1 #fi exit 0 0707010008d31b000041ed0000000000000000000000034cad6b8700000000000000b600010002ffffffffffffffff0000000500000000root0707010008d31c000041ed0000000000000000000000034cad6b8700000000000000b600010002ffffffffffffffff0000000900000000root/usr0707010008d31d000041ed0000000000000000000000044cad6b8700000000000000b600010002ffffffffffffffff0000000f00000000root/usr/local0707010008d31e000041ed0000000000000000000000024cad6b8700000000000000b600010002ffffffffffffffff0000001300000000root/usr/local/bin0707010008d320000081ed0000000000000000000000014cad6b1f000046c8000000b600010002ffffffffffffffff0000001c00000000root/usr/local/bin/lessechoELF 4PA4 (#"44o    <@@`/usr/lib/ld.so.1)) !"#%&(  $' %1<  E  P' Y akrX y@Px HDH h H  $H,!5 8 :@CR  l   +  "   P ;CPVh4( y0 { lessechocrti.scrt1.ocrt1.sfsr.svalues-Xa.clessecho.cpr_usagepr_versionpr_errorlstrtolversion.ccrtn.sstrcmp.XAKk4DrfsWrMlAE.metachars__iobstrlen.XAKk4DrfsWrMlAE.meta_escape_buf_GLOBAL_OFFSET_TABLE__initstrchrfprintf.XAKk4DrfsWrMlAE.closequote.XAKk4DrfsWrMlAE.quote_all_edata_environ_exit_DYNAMIC__environ_lock_PROCEDURE_LINKAGE_TABLE_.XAKk4DrfsWrMlAE.version__fpstart.XAKk4DrfsWrMlAE.meta_escape_startatexit_get_exit_frame_monitor__1cG__CrunMdo_exit_code6F_v__etextmain_end.XAKk4DrfsWrMlAE.num_metachars.XAKk4DrfsWrMlAE.openquote___Argv_lib_version_fini__longdouble_used__fsr_init_value__fsrlibc.so.1SUNWprivate_1.1SYSVABI_1.3libz.so/usr/local/libqN 7!%6 +21 03"$/-.,P  $'(, 04 8<5%%h%h% h%$h%(h %,h(%0h0%4h8p%8h@`%<hHPjjR@tchYtt P;Eu TRU RPPjURQt`|$у D$td$у`tƒ 3fd$f T$tfd$f L$l$YZ]ÐUhhpvÐUEEEE@ t'E@uE@EE@ uًE@EE@$tWE@ tKE@t?E@UBE@EE@EE@$tE@ t E@uUBEPh0ÐUEPh0hp jjFÐUEEE@ t E@ uE@EE@ tE@ tE@-uEE@EE@+uE@EE uIE E@0u6E E@E$E E@EE@xtߐE@0|E@9E@0EUE@a|E@fE@WE-E@A|E@FE@7E*E;E |EE U‰EE@E]Et@E@ t E@ uE@EE@ tE@ tEUPEt E؉EEEEÐU EEHEE%E E E @EE@-uEtE@EE@E@EEPjEP E;Eujh4B|E@EhLEPuP EAE@EEPjEP HHE;EujhTE@EE@E@EEPjEP E;EujhljE@E@EEU@bE@E@EEPjEP' U舂E;EujhEE@EE@u EhEP2uE>hEP uUEjh,jhZE@EEPm}8c}$?} -Jǃ?+aB볍Bw$Bw$EHEEEEEHEEEEbEE @EE E EEE@t8E@Pht EE@EE@uȡuEt?jPu*jjPEPRhjEEE@tUE@Ph|tPhDE@Ph/E@EE@uE~jhjhEEEHEEEEEE,h@UWVS[][^_UWVS[A[^_usage: lessecho [-ox] [-cx] [-pn] [-dn] [-mx] [-nn] [-ex] [-fn] [-a] file ... %s Missing number after -d-Missing number after -fMissing number after -pMissing number after -nversionhelpInvalid option after --Invalid option letter%c%s%c%s%c $Revision: 1.13 $\@   . > N ^ n ~     H `h`p`` `poo oP  `o`o``>  ""436hH         @HH !" <OU `lwH   '  wHlwHlDX @Px D H. DJh RH YuH! Q8 @      & "> \ c hmP( 0 { lessechocrti.scrt1.ocrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptrfsr.strap_tablevalues-Xa.cDdata.dataBbss.bssDrodata.rodatalessecho.cpr_usagepr_versionpr_errorlstrtolversion.ccrtn.s_END__START_strcmp.XAKk4DrfsWrMlAE.metachars__iobstrlen.XAKk4DrfsWrMlAE.meta_escape_buf_GLOBAL_OFFSET_TABLE__initstrchrfprintf.XAKk4DrfsWrMlAE.closequote.XAKk4DrfsWrMlAE.quote_all_edata_environ_exit_DYNAMIC__environ_lock_PROCEDURE_LINKAGE_TABLE_.XAKk4DrfsWrMlAE.version__fpstart.XAKk4DrfsWrMlAE.meta_escape_startatexit_get_exit_frame_monitor__1cG__CrunMdo_exit_code6F_v__etextmain_end.XAKk4DrfsWrMlAE.num_metachars.XAKk4DrfsWrMlAE.openquote___Argv_lib_version_fini__longdouble_used__fsr_init_value__fsr%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03acomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ld: Software Generation Utilities - Solaris Link Editors: 5.11-1.1689%lessecho.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g lessecho.c -W0,-xp.XAKk4DrfsWrMlAE.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DrfsWrMlAE.;backend;raw;cd;DBG_GEN 5.2.7char2version:intquote_allU!openquote2"closequote2#meta_escape:$long2@?metachars&num_metacharsU'pr_usage+  Upr_version2 U{p:3buf{4pbuf:52  pr_errorCU :sA lstrtolMU5 :sI UradixI 5pendIvUNnegUOnP: mainUU Uargc 5argv arg:s:no_more_optionsU v W Whas_metaU2meta_escape_buf%H 2strchr:H$U 2HunsignedRsize_tstrlen^M 2 2strcmpUmkstemps64U:Umkstemp64U:mkstemps64U:Umkstemp64U8:exitLU Qtm$tm_secU#tm_minU#tm_hourU#tm_mdayU# tm_monU#tm_yearU#tm_wdayU#tm_ydayU#tm_isdstU# [__wcsftime_xpg5^0L^Vwchar_t0 0@;__wcstok_xpg5;z;EJwint_t__putwchar_xpg5zzunsigned char__FILE_cntU#_ptr#_base#_flag# _magic# __orientationR# __ionolockR#  __seekableR#  __extendedfdR#  __xf_nocheckR#  __fillerR#  __putwc_xpg5zz__getwchar_xpg5z__getwc_xpg5z__ungetwc_xpg5z'z '__fputws_xpg5U\,1__fputwc_xpg5zz__fgetws_xpg5;;U__fgetwc_xpg5zlong longlockf64U UU 2 truncate64U2  off64_ttell642 Z UUssize_tvoid h p pwrite64Z  Z u Rh pread64Z  Z  Rlseek642  U2 Uftruncate64U U 2 truncate64UJ " off_ttell64J p U h p pwrite64Z  Z u Rpread64Z  Z  Rlseek64J  UJ Ulockf64U UUftruncate64U= U 2= 2G attropen64Uz B L U 2z openat64U U Uposix_fallocate64U Uposix_fadvise64U UU 2 unsigned longcreat64UG   2G open64Uq L U 2q 2{ attropen64U v  U 2 openat64U U Uposix_fallocate64U Uposix_fadvise64U@ UU 2@ creat64Uj E  2j open64U o Uftello642   fseeko64U 1U  fsetpos64U1 fgetpos64U.1FILE.tmpfile649 2Q 2[freopen649V`9 2 2fopen649ftello64J fseeko64U1U fsetpos64U31 fgetpos64UU1 2UprintfUzZ 2zfprintfU1 2 2freopen6499 2 2fopen649tmpfile649gJversion.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g version.c -W0,-xp.XAKk4DrfsWrMF_D.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DrfsWrMF_D.;backend;raw;cd;DBG_GEN 5.2.7+charlong0Q8version@D' /var/tmp/less-436/usr/include/sys/usr/include/isolessecho.ctypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h  ,    4      ~B V         ' . 8 D KS Z f ho v x  x         $ 3 : @ H` g             ' , J R a h            " * 9 @ j {             . 3 @ V [ h w @{  - ? Y ` d{w    |/7 H Wfv} 5/ /var/tmp/less-436version.c DD%$> I4I : ;  I !I/ . : ; @ D . : ; @ D  I: ;  . : ; @ ID  .?  6 : ; @ ID   &I.? < ' ID II: .? < ' D  :  I8  I8 .? < ' ID  DD%$> I !I/ 4I?  : ; ):main)kQversionC) pr_usage$pr_versionpr_errorlstrtola)^size_t[tmzwint_t__FILE2 off64_tZ ssize_tJ off_t.FILE)?version\quote_alltopenquoteclosequotemeta_escapemetacharsnum_metacharsmeta_escape_buf.interp.SUNW_cap.hash.SUNW_ldynsym.dynsym.dynstr.SUNW_version.SUNW_versym.SUNW_dynsymsort.SUNW_reloc.rel.plt.text.init.fini.rodata.rodata1.got.dynamic.data.bssf.bss.symtab.strtab.comment.debug_loc.debug_info.debug_line.debug_abbrev.debug_pubnames.debug_funcnames.debug_typenames.debug_varnames.shstrtab oPohh' HH/"7o  0Eo  RRo  pc   o B  P s  x   ~,  4@@`HHHHH`> "o&&7d<>9>G% ?e6q?F ?P0707010008d321000081ed0000000000000000000000014cad6b1f00006f0c000000b600010002ffffffffffffffff0000001b00000000root/usr/local/bin/lesskeyELF 4i4 ("!44oH+H+H+H+d++`/usr/lib/ld.so.1ON  "#&'(*+-1245679:=ABCDFGK !$%),./038;<>?@EHIJLM $0:DKS`F _ j-yH-` //` P- H+ <%7 ","h )0@6 <9A `/hP# m$-[$&/&L-@  / / 0    / //,/$3.570# /=/HLOU\5d] nPH u  |+,!/H+-u \l`x /{ r !  ",75b lesskeycrti.scrt1.ocrt1.sfsr.svalues-Xa.clesskey.cversion.ccrtn.sstrncmpinit_tablesfindaction__environ_lockoutfilefwriteparse_argseditsectionstrcmp_edataskipnspcmdnames_exit_GLOBAL_OFFSET_TABLE_fopen64fputintperrorfprintf_initerrors_get_exit_frame_monitorparse_lineatexitadd_cmd_str_end_PROCEDURE_LINKAGE_TABLE__lib_versionmain__longdouble_usedendsection_finiinfileparse_cmdline.XBKk4DrfsWrMV$D.tstr.buf__iobclean_line_startcurrtableeditnamescmdsection_environ.XBKk4DrfsWrMV$D.tstr.tstr_control_kedittablecmdtableusagevarsectionstrlenfgetsgetenvlinenumfputbytesskipspcontrol_line__1cG__CrunMdo_exit_code6F_v_strcat_DYNAMICfileheader_etext___Argvhomefilecallocstrcpymkpathnamefiletrailer__fsr__fsr_init_valuetstrparse_varline__fpstartvartableadd_cmd_charlibc.so.1SUNW_1.1SUNWprivate_1.1SYSVABI_1.3libz.so/usr/local/libB'= LqN U7e%2P:NK RB1V#CA 0-S!'+)FGJ(,473H5<*O&.;8@9U$ -:/1T+JX+ \+`+d+h+3l+Bp+Ct+;x+5|++ +M++++4+5L+%P+%T+h%X+h%\+h%`+h%d+h %h+h(%l+h0%p+h8p%t+h@`%x+hHP%|+hP@%+hX0%+h` %+hh%+hp%+hx%+h%+hjjR+th&-t -t PE,u T,RU -RPnTPfjURQt`|$у(- D$td$у`tƒ 3fd$f T$tfd$f L$l$YZ]ÐUh(&h0jjÐU ]jEPjE PjDPEEPEPhL&EPE PEPEEE]ÐU jhP&EEt$E@tEPEPGE)hX&h0 EPh&EEEEÐUH-EHEEE E E @EE@-tuE@ubE@-u$E@uEHEE E 2jh&EP u@E@uEH-$E@=uE H-3h&EPRuTE @H-H-@u(EHEEE E E @H-Rh/h&jj9U+E@V} -ߐVtoj΋EHEEhE~E~E @L-jh&L-ÐUP-555 /333777ÐUE@EE@E0EEUE@DЈEE@EE@0|E@7E@EE|EUPE tE u/EE///EEU@B&EEU@B///EmEU@B&EUEU@B&E=EU@B&E%E E3E#EEEEEE Ejh&hEU@B&EZE@EE@h}-d}DwU^묃d#ez똃r}hZl!|u}riuxFQEU@B /E///////EtEU@BE@//E t/ u/E//EEPb}BЃw$"n},e}b>yeGkar}nVMr_tn5EUBE@/// u /Ei/E^E@\^tEU@BE@//E t/ u /E /EEUE@ t E@ uE@EE@ tE@ tEEEÐUE@tCE@ t7E@ t+E@EE@tE@ t E@ uՋEEEUjEP?EEEE@ t{EE@ tlEE@t]EE@#uEtEE@\t5E@EEE@ tEE@ tEE@uUUBEEEÐU//H;rjh&jj/EE@EEU@BEUBÐUE@t%E@jPrE@EE@uÐUjh'Ph'EP u3/Ejh'|Ph'EP u5/Ejh '<Ph 'EPz u7/EQjh('Ph('EP> u"jjajjgUEEEÐUEEEHEEEE~:jjEPjjE PE @E EEEHEEEEÐUE =r+jjhE Ph0'h0jjE ?EjjEPjjEPsE EjjEPjjEPRÐUE/U@ЃtN/MPEPPu/U@DE0E@E/U@ЃujhT'EdEÐUjjEP5Phd'h0 7@7UEjEPXEjEPU‰EE~jht'jEPE@ tE@ t E@ujjjEPwEE@ujh'EEjEPEE@EUBjEPIEEUBjEPEE@ujEPaPE jPLE@t%jEPjPE@ujjÐU jEPEjEPNE@ t$E@ tE@=t E@ujjjEPEE@EE@EEEE=tjh'ejhPjEPEE@t+jEPEjEPE@ujjÐUjEPtKjEPEE@u+/=7ujEPjEPÐU E PEPh'L-P.u/E6h'L-P8EEujL-P-i75EPhP t95@5jPEPhP uǡ7~$7Ph'h0 jjH-ujh'H-H-ujh'MH-h'H-P1EEujH-P&jj:jh/EP jh/EP 5-5PEP5-5Ph5EPu jh/EPb 3-3PEP3-3Ph3EP/ jh/EP 7-7PEPe7-7Ph7EP jh/EP jh/EP EEUWVS[Q[^_UWVS[5[^_usage: lesskey [-o output] [input] /HOMEcannot find $HOME - using current directory .--output--versionlesskey version %s .lesskey illegal char after \ktoo many commands#line-edit#command#env#stoperror: integer too big (%d > %d) unknown actionline %d: %s command too longmissing actionmissing =-r%d errors; no output produced LESSKEY.lesswbback-bracketback-lineback-line-forceback-screenback-scrollback-searchback-windowdebugdigitdisplay-flagdisplay-optionendexaminefilterfirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-lineforw-line-forceforw-screenforw-screen-forceforw-scrollforw-searchforw-windowgoto-endgoto-linegoto-markhelpindex-fileinvalidleft-scrollnext-filenext-tagnoactionpercentpipeprev-fileprev-tagquitremove-filerepaintrepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markshellstatustoggle-flagtoggle-optionundo-hiliteversionvisualback-completebackspacedeletedownexpandforw-completehomeinsertkill-lineleftliteralrightupword-backspaceword-deleteword-leftword-right+"2BRbrqB % &yy  4 ````x`o;oo\Lo`o``>H+ '$'' (($(0("<(D(L(\(l(p( x(7( ( ( (#(2( (( (()))!()4)@)L)T)&`)fh))t))5)e))%))6))4)) )+),*- *.4**D*P*X*`*/l*/|*'** ****l( *** *`)f**+++ + $+ 0+<+ (5M+GcevxEnd4364 x L \   %&$&(&H++,// !9 -; -NT(- _k,v/$&v/kH-$&v/k/$&`F  -H-` / /` !P-+ 0H+FN V]<e%k7r "*,"h @6 9 /P# $-$&/&L-@  / ,/W 0 1 <  C/M /W/b,k/350# +//L5] PH   |+c,!/'H+.-6u ?\FlM`x X/d{ j{r !  7b ^lesskeycrti.scrt1.ocrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptrfsr.strap_tablevalues-Xa.cDdata.dataBbss.bssDrodata.rodatalesskey.cversion.ccrtn.s_END__START_strncmpinit_tablesfindaction__environ_lockoutfilefwriteparse_argseditsectionstrcmp_edataskipnspcmdnames_exit_GLOBAL_OFFSET_TABLE_fopen64fputintperrorfprintf_initerrors_get_exit_frame_monitorparse_lineatexitadd_cmd_str_end_PROCEDURE_LINKAGE_TABLE__lib_versionmain__longdouble_usedendsection_finiinfileparse_cmdline.XBKk4DrfsWrMV$D.tstr.buf__iobclean_line_startcurrtableeditnamescmdsection_environ.XBKk4DrfsWrMV$D.tstr.tstr_control_kedittablecmdtableusagevarsectionstrlenfgetsgetenvlinenumfputbytesskipspcontrol_line__1cG__CrunMdo_exit_code6F_v_strcat_DYNAMICfileheader_etext___Argvhomefilecallocstrcpymkpathnamefiletrailer__fsr__fsr_init_valuetstrparse_varline__fpstartvartableadd_cmd_char%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03acomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ld: Software Generation Utilities - Solaris Link Editors: 5.11-1.16891lesskey.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g lesskey.c -W0,-xp.XAKk4DrfsWrMV\$D.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DrfsWrMV$D.;backend;raw;cd;DBG_GEN 5.2.7char1intcmdnamevcn_name9#cn_action>#longEv9cmdnames~^P- Eveditnames /E1 v table%names#pbuffer9#buffer#currtable%/ 1TvfileheaderC/ 1vfiletrailern/ 1vcmdsection/ 1veditsection/ 1vvarsection/ 1-vendsection/infile9L-outfile9H- usage0SU mkpathname`U99dirname9filename pathname9 homefileUU9I9filenamep9pathname9parse_args `VU>argc argv  arg9 9init_tablesU`Utstrg"U9fppd>xlated p9hch1ii>jbuffk/tstr_control_kwl/ 1 wv 1vskipspPU99sskipnspU99sclean_lineU9)9si>add_cmd_char2UY>cadd_cmd_str@vU9scontrol_lineU>9sfputbytesAUfd=9buf= >len=unsigned charunsigned__FILE_cnt>#_ptr#_base#_flag# _magic# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  *FILEfputintPUdfdMvalM c1Qfindactione U>9actnameci>ferrorr @ U9spparse_cmdline{@ !Ur 9pycmdlen>|actname9}action>~s9c1parse_varline!"U 9ps9parse_line"H#U 9linep9mainP#%U>v >argcargv descoutlinev 1 verrors>7linenum>5vartable7edittable3cmdtable51 1 strncmp>8   18 size_tstrlenB i = 1i strcpy9 9n 1 1 strcmp>   1 strcat9 9 mkstemps64> 9>mkstemp64>. 9mkstemps64>Q 9>mkstemp64>n 91n getenv9 s exit >void calloc  vv tm$z tm_sec>#tm_min>#tm_hour>#tm_mday># tm_mon>#tm_year>#tm_wday>#tm_yday>#tm_isdst>#  z __wcsftime_xpg5B   B   wchar_t    __wcstok_xpg5    vwint_t__putwchar_xpg50*__putwc_xpg5Z0__getwchar_xpg5__getwc_xpg50__ungetwc_xpg50v*__fputws_xpg5>__fputwc_xpg50*__fgetws_xpg5 E >__fgetwc_xpg5f0long longlockf64>>>f1truncate64>ffoff64_ttell64>>ssize_t pwrite640f pread64_0flseek64>>ftruncate64>>f1truncate64>ffoff_ttell64> pwrite640fpread64Z0flseek64>>lockf64>>>fftruncate64>>f11attropen64>>1openat64>6> >posix_fallocate64>e>ffposix_fadvise64>>ff>1unsigned longcreat64>1open64>>11attropen64>9 >19openat64>j>>>posix_fallocate64>>ffposix_fadvise64>>ff>1creat64>1open64>>*ftello64@fseeko64>ff>fffsetpos64>kffgetpos64>tmpfile6411freopen6411fopen64; *ftello64\;fseeko64>f>1perrorffsetpos64>fgetpos64> *fwriteB (B B fgets9K9>1Kprintf>pP1pfprintf>u11freopen6411fopen64 tmpfile64fopen64* fopengversion.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g version.c -W0,-xp.XAKk4DrfsWrMF_D.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DrfsWrMF_D.;backend;raw;cd;DBG_GEN 5.2.7L charlong0Q8version@/H  /var/tmp/less-436/usr/include/usr/include/iso/usr/include/syslesskey.cstdio_impl.hstdio_iso.htypes.htime_iso.hwctype_iso.h03E Q `i       $6 J P `fp             ( 4 D I L b d i p ~       ^p5# (0 @ T `cn y           ( 9 H Q [ l v                , < L \ l |     rLV ` i s }         x            PVn u        K q t~      0 @CO a t       * 5 @ f r ~     }/ ; D \ e }   ~     3  >  @ F M ^  t  |              ! ! ! !! ,!=!G! X! d! t!! ! ! ! ! !!! ! %"1" B" a" p" t"" " " " "}"" """ " # # # (# 8# F# P#Y#i# n## # #### # # $ $}1$ ;$ S$ _$i$ }$ $ $ $$$$$ % .% A% X% t%% % %% % % 5/ /var/tmp/less-436version.c DD%$> I  I8 I !I/ 4I?  : ;  I  !I/   .?  : ; @ D .?  : ; @ ID I: ;  4I : ;  .?  : ;@ D I: ; 4I : ; .?  : ;@ D .?  : ;@ ID  :  I8 I: .?  6 : ;@ ID &I.? < ' ID I.? < ' D .? < ' ID  .<  DD%$> I !I/ 4I?  : ; 5cmdnameseditnames*currtableTfileheaderfiletrailercmdsectioneditsectionvarsection-endsectionGinfile]outfiletusagemkpathnamehomefileIparse_argsinit_tableststrskipspskipnspclean_line)add_cmd_charYadd_cmd_strcontrol_linefputbytesfputintdfindactionerrorparse_cmdliner parse_varline parse_line main errors linenum vartable edittable cmdtable5kQversionw5Ecmdnametable*__FILEFILEB size_t tmwint_toff64_tssize_toff_t)54bufGtstr_control_k.interp.SUNW_cap.hash.SUNW_ldynsym.dynsym.dynstr.SUNW_version.SUNW_versym.SUNW_dynsymsort.SUNW_reloc.rel.plt.text.init.fini.rodata.rodata1.got.dynamic.data.bssf.bss.symtab.strtab.comment.debug_loc.debug_info.debug_line.debug_abbrev.debug_pubnames.debug_typenames.debug_varnames.shstrtab o|o ' 44/"  7o@EoRoxxc LLo B\\ s0x  ~%%&&$&$&(&(& H+H+T++`,,//// /`9 @8;o]?]?W c2e g{%Oh-5 |h?0707010008d31f000081ed0000000000000000000000014cad6b1f00079380000000b600010002ffffffffffffffff0000001800000000root/usr/local/bin/lessELF044 (#"44ozzzz$V{{x/usr/lib/ld.so.1  !%'(*+./0124568:;<=>?@BCDFHIKLNOPQRTUVWY[\]^`acdfhiklpqstuvwxyz{}~   "%'()*+,./01234678=?@ACDEHJLOQSVXZ]^bcdfhiklmnpqtuwx{|~   "%&'()+-245679;=>ACEFGJNQRSTUVZ[\_`bdefghiklmnoqstuvwxyz}~"#$&),-379AEGJMSXZ_begjmnor|   !#$&-59:;<>BFGIKMNPRTUWY[\_`aegjorsvyz}   !#$*,./0138:<?@BDHIKLMOPWXY]^acjpr{| #)5<E7 O z Y^ bT k rp z 04  0; (   p @s W  @ X 0f  ) ( 2p B0` QT _ k t }p `    6  p l  `!   ` `8 S ) 70 BL U5 _ E jp yP P` T p%  `N p+ -~ p.- . 0w 2_ `2L $2] 0@8( 7; BB MpC  XC  cH( nIF xI, K 0Rh R6 S \ pd1 di  e? `ey gW 0{ -~  4 @ L0 S# Y i@ t5 ~  f u ?  P 2 g k  5 02 Y ) 2p[ <E` PU^ : i`> xU    i %  * P* &    J @   0 9 +0# 8 D l M^ Zu k' v \  PE   5  0  T = @$G @ @# # $ '/9@DY0W c\op    `B$ PD أE;  V  % -c| 6C" @Г- I`! U(`H hfN sA |h3WM8 J @p(@v  (     8 R p^ О T U " < 1 T  X T <@ WT& 4> es H p hT 0\ w   L 8 p  0 `I4   ! @' p 1 h 9 }C | K 4c  i q x @ `/  & x @ @ 0 g   (, D9 xS Y Уr  }  H}! p 8 0$  $ `   ; $F }R p8J `  g H0 h  cu/  |  0d p#V *XE RP: `h@+ xL}P }Ȟ8O BlYD f)M v,)|h U `\L  F   p}ܣ%DБL] ]@r c`kPw$ t }0 s x @ z@i   q v "l1Y U\}jd B (4   hPa  P D 6 01@ 8p?}MI T0 a@|t i0i pP4  `1 l  X0@  H} -b R V4I (h [ 00 OXpR b p;E uW `$ @M  @ <"4+|GaC" H }  / @[7 W ,p   (hCPJܞ^%t z P(|  t $PD 2 8{A`M Un   x\ z }0,FF ^`fnuP` r P Pb 0 m  $0 +3p ;p- Ea:XP *+z@`n Q mdZ@ l` w H1@ =E9 S. `i kT\>   @B  Ph   :u G RpI ~ " n Py@..  `fN   h&  0t :PF DLL`(- X@v`}   V;| Ppa 8[ <   9,BDJ}HULD ^0H0 l`^ wDY @| d () ԣ؝! > 4  (d}0.. ?<Hc6 j v pD- ~XPp l< ' H .6m 7R4? ]]v s}Z ,p%     )  #*)58 h R7 _(i# s1$ @< HpF  N U r P x " c* P# 5 B$ ? }O e Аl Hu ,   i 5  @ Pi   Н P   !p}!P '!z=!ȣW!_!w!!X!0! 1 !`1 !!L!! !}"% "P."p F"a"еa g"n"> t"3 " "`n "@{ "`0 "W "  "`& "F "" ##a #t*#0#0^! =#P C#_#0g#Дo#}# # P) @#H#V #ģ#$ | $`# $` 01$ 6$ / A$H$S$P$p X$(u$+ $В$<#H$ ${ $X$ $R$$$ %d!%$ -%0 l )<%HS%P X%8p%X.M %E % %0N %%%(@$S %@ %DaH !%&`&8-&3&;& F&$O&p] [&u&I }&}&@E t &EM && &,Z&`b0 & &H)&dT &X7P0 &ȝ ''8 Z/'ph &D9'2 I'̣b'n'б w'0'}''`'h '<' (0y (X"(`>(Јd M(@ h(s(((0(@( )(gX ( )Q )\)0)=)TV)Wfo)y)))`E# ))g= ) ))К )h*$ *`< *"*?*P+ X*^*q k*@Q ~*e *$y$0E * *P*Н*l *+ +#+ +09 0+@3+`)  <+4&U+0q+|+ +0Q(n +f +(+4++`g +lа ,} ,0 0, (,0,`Q,4 j,(chg_caselesscrti.scrt1.ocrt1.sfsr.svalues-Xa.cmain.cscreen.cltget_envltgetflagltgetnumltgetstrtmodescheaperinc_costcountcostbeepclear_eol_botbrac.csearch.c_xmknodch_addbufbufferedinit_hashtblch_delbufscharset.cichardeficharsetilocalesetbinfmtset_charsetis_in_tablecmdbuf.ccmd_step_commoncmd_step_rightcmd_step_leftcmd_repaintcmd_leftcmd_homecmd_lshiftcmd_rshiftcmd_rightcmd_icharcmd_erasecmd_deletecmd_werasecmd_wdeletecmd_killcmd_updowncmd_editcmd_completecmd_istrdelimit_wordinit_complnext_complhistfile_namesave_mlistcommand.ccmd_execstart_mcamca_searchmca_opt_toggleexec_mcamulti_searchmca_charclear_buffersmake_displayat_promptcvt.cdecode.cexpand_special_keysadd_cmd_tableadd_var_tablecmd_searchecmd_decodegintold_lesskeynew_lesskeyedit.cclose_fileedit_istepedit_inextedit_iprevfilename.cmetacharsmetachardirfileseek_filesizereadfd.XAKk4DrdsWrMlqD.shellcmdforwback.ceof_bellhelp.cifile.cincr_indexunlink_ifilenew_ifilefind_ifileinput.cjump.cline.cexpand_linebufpshiftattr_swidthattr_ewidthpwidthbackcin_ansi_esc_seqstore_charstore_tabstore_prcharflush_mbc_bufdo_appendlinenum.ccalcgaplongloopmessagelongishabort_longlsystem.cmark.cgetumarkgetmarkoptfunc.coption.cproptoptstringflip_triplenostringnum_erroropttbl.cis_optcharos.coutput.ciprint_intiprint_linenumless_printfpattern.ccompile_pattern2matchposition.cprompt.cap_strap_charap_posap_linenumap_intap_questcurr_byteskipcondprotocharwherecharset_patternclear_patterninit_patternget_cvt_opsis_ucaseprev_patternis_hilited_rangeadd_hilitehilite_linehilite_screensearch_possearch_rangehist_patternsignal.cu_interrupttabstoptags.cmaketagentfindctagfindgtaggtagsearchctagsearchnextgtagprevgtaggetentryttyin.cversion.ccrtn.s.XAKk4DresWrMl8D.tagliststep_charforw_prompt.XAKk4DrdsWrM1mD.costcountclr_filterinit_promptpipe_dataedit_firsttcsetattrbinary_char.XAKk4DrdsWrM1mD.sc_u_incat_file.XAKk4DrdsWrM1mD.sc_returnprevtagpr_expand__fpstartch_seekbackwardedit_prev__filbufpercent_posbo_e_width__ctypeprev_ifileseekable.XBKk4DresWrMVuD.forw.first_time.XAKk4DresWrMV6D.m_proto.XAKk4DresWrMl8D.totalshell_quote__flsbuf.XAKk4DresWrM1vD.anchorcleantagsclose_getchrclear_eol.XAKk4DresWrMF7D.search_info.XAKk4DresWrMFsD.cmdtablesigprocmask.XAKk4DresWrMl2D.follow_optnamedispversionsize_helpdata_get_exit_frame_monitorclosequotewait_messagewscrollfcloseget_quit_at_eofsc_height.XAKk4DrdsWrMFpD.comp_table.XAKk4DresWrMV6D.e_proto.XAKk4DresWrMFyD.columndel_ifilecmd_addhistfprintf.XAKk4DresWrMl2D.f_optnameknow_dumb.XAKk4DresWrMl2D.o_optname.XBKk4DresWrMV0D.getmark.smtwiddleiswupper.XAKk4DresWrMl2D.keypad_optnamech_forw_getget_meta_escape.XBKk4DrdsWrMFpD.prchar.buffsyncget_wcharopenedhold_ifilech_tell.XAKk4DresWrMl8D.curtagquietlseek64.XAKk4DresWrMl2D.w_optnamecurr_inoch_getflagssigsforw_raw_linejump_sline_fractionplusoptionopt_quotecharsetspositionintread.XAKk4DresWrMFyD.linebuf.XAKk4DresWrMl2D.P__optnameless_is_more.XAKk4DrdsWrM1pD.tk_tlistignaw.XAKk4DrdsWrM1mD.sc_s_in.XAKk4DrdsWrM1mD.sc_s_keypad.XAKk4DrdsWrM1mD.init_doneget_scrpos_environ__rem64.XAKk4DrdsWrMFpD.utfbinfmtis_composing_charcurrlinefd0is_utf8_well_formedget_time.XAKk4DrdsWrM1mD.sc_eol_clearbl_e_widthany_displayinit_textlistpostoa.XAKk4DresWrMl2D.option.XAKk4DresWrM1yD.freelist.XAKk4DrdsWrMlqD.mcanl_langinfoadd_lnumshift_count_fractioncmd_charwerase_char.XAKk4DrdsWrM1pD.tk_ipoint.XAKk4DresWrMl2D.g_optnameunmark.XAKk4DresWrMl2D.t_optnameempty_screenback_textlistautobufcalc_jump_sline.XAKk4DrdsWrM1mD.sc_bl_in.XAKk4DresWrMl2D.tilde_optname__environ_lockbin_filesave_curr_ifiletgoto.XAKk4DresWrMF7D.is_caseless.XAKk4DresWrMl2D.oldbot_optname.XAKk4DresWrMl2D.O__optnamefcomplete.XAKk4DresWrM1yD.sparereedit_ifilecvt_alloc_chpos_finiset_openlglobis_ansi_enduse_logfile.XAKk4DresWrMF7D.prep_startposch_close.XAKk4DrdsWrM1mD.sc_backspacetop_scrollnamelogfile.XAKk4DrdsWrM1mD.sc_u_outul_s_width.XAKk4DresWrMl2D.quote_optnametgetenteof_displayedch_flushsprintfjump_locso_e_width.XAKk4DrdsWrMVoD.ch_ungotcharerrno_messageset_attnpospr_stringstrerror_etextset_filestate.XAKk4DresWrMl2D.d_optnameclr_linenumputbsch_initjump_line_locno_back_scrollclose_altfile.XAKk4DrdsWrMlqD.save_hshiftstart_attnpos.XAKk4DrdsWrMlqD.ungotsingle_char_optionpercentageinit_option.XAKk4DrdsWrM1pD.curr_cmdflagsjump_backtoggle_optionpopenunsave_ifileadd_hometable.XAKk4DresWrMV6D.mp.XAKk4DrdsWrM1mD.sc_b_outopt__Ostrcatforce_logfileopt__Pinit_cmdhistprewindopt__Tuncompile_patternopt__Vlgetenvgetfractionspecial_key_strmlist_shellsetlocale.XAKk4DresWrMF7D.filter_anchorfilenoch_lengthinit_cmdscommands.XAKk4DresWrMV6D.s_protoadjslineget_pos.XBKk4DrdsWrMFpD.prutfchar.buftowlowerclear_botlinenumtoaregfreeis_combining_charis_ubin_char.XAKk4DresWrMF7D.hilite_anchorfexpandfindtagget_term.XAKk4DresWrMFyD.overstrike__fsr_init_value.XAKk4DresWrMl2D.m_optnamepr_typech_setbufspace.XAKk4DrdsWrMFpD.ubin_table.XAKk4DrdsWrM1pD.tk_trial.XAKk4DresWrMFyD.last_overstrikereadingedit_next.XAKk4DrdsWrM1mD.sc_padend_logfilelsystemsquishedvbellabsbad_fileempty_lines.XAKk4DresWrMl5D.table_sizegomark.XAKk4DresWrMF7D.filter_info.XAKk4DresWrMl2D.u_optnamesetjmp.XAKk4DresWrMF4D.ob.XBKk4DresWrMF4D.error.return_to_continuejump_forwinit_signals.XBKk4DrdsWrM1mD.special_key_str.tbufplinenum__1cG__CrunMdo_exit_code6F_v_.XAKk4DrdsWrM1pD.tk_original.XAKk4DrdsWrMlqD.bottompospflushmbcpos_clear_DYNAMICsigemptysetprproto.XAKk4DrdsWrM1mD.sc_initput_wchar.XAKk4DresWrMFsD.list_var_tables.XAKk4DrdsWrMFpD.wide_tableshell_coptioninit_linesize_linebuf.XAKk4DrdsWrM1pD.cmd_mbc_buf_index.XAKk4DrdsWrM1mD.attrmode.XAKk4DrdsWrMFpD.chardef.XAKk4DresWrMF4D.obuf.XAKk4DresWrM1vD.ifiles__div64strncpyeditor.XAKk4DrdsWrMlqD.numbernew_fileungetccadd_forw_posch_beg_seek.XAKk4DrdsWrM1mD.sc_deinitntabstopssync_logfile.XAKk4DresWrMl2D.pound_optnamecalc_shift_countget_cmdbuf_startsqueezesprefixset_mlist.XAKk4DresWrMl2D.J__optname.XAKk4DresWrMV6D.h_proto.XAKk4DresWrMl2D.e_optnamestrchr.XAKk4DresWrMl2D.r_optnameback_lineforce_openpipe_mark.XAKk4DrdsWrMlqD.search_type.XAKk4DrdsWrM1pD.tk_textml_search.XAKk4DresWrMFsD.edittablecheck_winchstrncmpforw_textlistch_ungetcharheld_ifile.XAKk4DrdsWrM1pD.cmdbuffinal_attr.XAKk4DrdsWrM1pD.literal.XAKk4DresWrMFsD.list_ecmd_tablessavematch_brac.XAKk4DrdsWrMlqD.optflag.XAKk4DresWrMl2D.z_optnameget_indexput_line_PROCEDURE_LINKAGE_TABLE_jump_percentgettagtypepappend.XAKk4DrdsWrM1mD.sc_lower_left.XAKk4DresWrM1yD.startimeadd_ecmd_tabletcgetattrlongjmpcfgetospeednext_ifile.XAKk4DresWrMl5D.tableget_filename.XAKk4DresWrMl2D.query_optnameclear_attn.XAKk4DrdsWrMlqD.pipecclr_hlistcmd_reseterrmsgsopen_getchr.XAKk4DresWrMFyD.is_null_linefchmodfind_posch_get.XAKk4DresWrMV6D.more_protomemcpyfollow_modegline.XAKk4DresWrMl2D.b_optname.XAKk4DresWrMl8D.circularopt_shift.XAKk4DresWrM11D.pendopt.XAKk4DresWrMFyD.mbc_buf_indexutf_modeno_initcs_aliaseshomefileshell_unquoteul_e_widthedit_indexedit_listlastmarkireadcvt_length.XAKk4DrdsWrM1mD.sc_s_out.XAKk4DresWrMl2D.j_optnameis_wide_charstrcmphprotoget_return.XAKk4DrdsWrM1pD.curr_mlisteq_message___Argvadd_fcmd_tablequitting.XBKk4DresWrM11D.propt.bufin_mcach_end_seekctldispquit_if_one_screenfstat64.XAKk4DresWrMl2D.V__optname.XAKk4DresWrMF4D.intr_to_abortis_null_patternmlist_examine.XAKk4DresWrMl8D.curseq.XAKk4DrdsWrM1mD.sc_e_keypadskipspeditchar.XAKk4DresWrMl2D.k_optnametabdefaultentire_file_displayed.XBKk4DrdsWrM1mD.raw_mode.curr_oncreat64.XAKk4DrdsWrMlqD.optcharis_diroldbotbelow_membadmark.XAKk4DrdsWrMFpD.comb_tableadd_lineprutfcharlinenumsml_shellch_back_getatexitml_examine.XAKk4DresWrMF7D.hide_hiliteedit_tagfilekill_charclear_cmdfcmd_decodemain.XAKk4DresWrMl2D.s_optnameopt_promptcurr_altfilenameat_switchsetmark.XAKk4DresWrMl2D.L__optnamestrcpyerase2_char.XAKk4DrdsWrM1pD.cpdohelpstrstrget_swindowchg_hiliteedit_lastevery_first_cmd.XAKk4DresWrMFyD.attrisattycurr_dev.XAKk4DresWrMFyD.mid_ansi_charsline_leftcmd_intget_filestatepsignalsatoican_goto_lineforw_linematch_patternraw_modeclr_hiliteset_status_col__longdouble_usedpos_init_GLOBAL_OFFSET_TABLE_.XAKk4DrdsWrM1mD.sc_clearregcomp.XAKk4DrdsWrMlqD.ungotp.XAKk4DresWrMFsD.list_fcmd_tables.XBKk4DrdsWrMFmD.quit.save_statuscmd_acceptopt_bfgetc.XAKk4DresWrMFyD.lmarginwprotowrite.XAKk4DrdsWrMVoD.maxbufsopt_i.XAKk4DresWrMV0D.marks.XAKk4DresWrM1yD.anchor.XAKk4DresWrMl2D.c_optnameopt_jstrlenopt_kis_filtering.XAKk4DresWrMl2D.p_optnameopt_lmarkposscrsizeopen_altfileopt_ocontrol_charopt_p.XAKk4DrdsWrM1mD.sc_home.XAKk4DresWrMl2D.K__optnamebo_s_widthputchrhow_searchfgetssquish_checkopt_t.XAKk4DresWrMl2D.X__optnamebinattrregexec.XBKk4DrdsWrMVoD.end_logfile.triedopt_x.XAKk4DrdsWrM1mD.sc_addline__iobnexttag.XAKk4DrdsWrM1mD.sc_eos_clear.XAKk4DrdsWrM1mD.sc_visual_bellis_ascii_charinit_search.XAKk4DresWrMl2D.F__optnameauto_wrapecallocbs_modeat_exit.XAKk4DresWrMF7D.prep_endposcmd_putstrsnprintftagoption.XAKk4DresWrMl2D.x_optname__fsr.XAKk4DrdsWrM1pD.cmd_offsetcurr_tagerrno.XAKk4DrdsWrM1mD.sc_bl_outis_hilited.XAKk4DrdsWrM1pD.prompt_colscan_optioninitial_scrpos.XAKk4DresWrMFyD.pendcquit.XAKk4DresWrMFyD.cshift.XAKk4DresWrMFyD.pendposapply_at_specials.XAKk4DrdsWrMVoD.thisfileierroruse_lessopengetpid.XAKk4DresWrMFyD.end_ansi_charsmlist_searchsecureno_keypad.XAKk4DrdsWrM1pD.in_completiontputsfopen64pshift_allclear_bgundo_search.XAKk4DrdsWrM1mD.hardcopyungetscmissing_capinit_markedit_stdinsc_widthis_ttyneed_clrforwardrepaint_hilite_lib_versionget_back_scroll_edata.XAKk4DresWrMl2D.h_optnamepclose.XAKk4DresWrMl2D.q_optnamestore_poscmd_lastpattern.XAKk4DrdsWrM1mD.sc_moveforw_scrollat_enter.XAKk4DresWrMF7D.is_ucase_patternend_attnpos.XAKk4DrdsWrM1pD.cmd_mbc_buf.XAKk4DresWrMFyD.mbc_poslen_cmdbufquit_on_intrhilite_searchfindopt.XAKk4DresWrMV6D.w_proto.XAKk4DresWrMl2D.T__optnameis_ansi_middle.XAKk4DresWrMl2D.y_optnamebl_s_width.XAKk4DresWrMl2D.B__optname.XAKk4DresWrMFsD.list_sysvar_tables.XAKk4DresWrMFyD.curropenquote.XAKk4DrdsWrMlqD.fractiongetoff_ifileutf_lenprep_hilitechoplinesignal.XBKk4DrdsWrM1mD.get_term.sbuf.XAKk4DrdsWrM1pD.cmd_col.XAKk4DresWrMV6D.M_protoshow_attn.XAKk4DresWrMl2D.a_optname.XAKk4DresWrM1yD.loopcountreopen_curr_ifileeditprotoget_ifilepdoneprognameback_raw_line.XAKk4DresWrM1yD.poolnopendoptis_at_equivdup.XAKk4DresWrMFyD.mbc_buf_len.XAKk4DresWrMFyD.mbc_bufioctlsave_cmdhistset_filter_patternis_filtered.XAKk4DresWrM1sD.curr_altpipeinttoa.XAKk4DresWrMl2D.S__optname.XAKk4DresWrMl2D.i_optnameinit_charset.XAKk4DrdsWrMlqD.optgetnameopt_queryabove_memisoptpendingPCcvt_text.XAKk4DrdsWrM1mD.sc_b_in.XAKk4DresWrMl2D.q2_optnameso_s_widthscreen_trashedsleepadd_back_pos.XBKk4DresWrMltD.metachars.mchars.XAKk4DrdsWrMFpD.binfmt.XAKk4DresWrMl2D.n_optnamenifileignore_eoionscreenfind_linenumfindopt_nameeqproto.XAKk4DrdsWrM1pD.cmd_mbc_buf_len.XAKk4DresWrMV6D.message.XAKk4DresWrMV3D.read_labellibcurses.so.1SUNW_1.1SUNWprivate_1.1libc.so.1SUNW_0.8SUNW_0.7SYSVABI_1.3libz.solibintl.so.8libgen.so.1/usr/local/lib,0'= ,qN ,,'= ,(= ,(= ,qN ,7,jO  ^] `n;eDafN J^(! 9"h#$%&()*+',-./012356784/ 9~:A<=C>?@BCDE A6FQHI@JKLiMNOnvPQ&7R)3zSTU2FuE2LW/XYZ.C=[\]IiXK_VT1rbcde'^f5 Heb],gYjklmnopqrst u6# 8dw-xyzb}~[o44y9&?|OsmlN:pdh*\oWF'G<LqKYa6>_Cy)B1fXG&c` .<?%{>k{QU[-+\\=$L}"m Zh|=4R( ( .0$!c3I8Qp]BTkH5IT;AJe;%,ND#7RRx:Ot-fq2*KW%lSE#>9)D1 'Biwg@dMMP  _3VgZ,_Pu"M/jYs[87SU 0 Ew0Z$A~G*Jl}W@HHzzzzzzzzz zUzzDz zzzzzPzzzzz5{{L{ {{{R{{b {${0({q,{0{4{8{=<{@{6D{H{/L{8P{T{X{c\{?`{d{]h{l{{p{t{x{|{M{g{{C{q{ {{ {'{V{h{{{%{{{,{A{{+5z%z%zh%zh%zh%zh%zh %zh(%zh0%zh8p%zh@`%zhHP%zhP@%zhX0%zh` %zhh%zhp%zhx%zh%zh%zh%zh%zh%zh%zh%{hp%{h`%{hP% {h@%{h0%{h %{h%{h% {h%${h%({h%,{h%0{h%4{h %8{h(%<{h0%@{h8p%D{h@`%H{hHP%L{hP@%P{hX0%T{h` %X{hh%\{hp%`{hx%d{h%h{h%l{h%p{h%t{h%x{h%|{h%{hp%{h`%{hP%{h@%{h0%{h %{h%{h%{h%{h%{h%{h%{h%{h %{h(%{h0%{h8p%{h@`%{hHPjjR{tkh,)ah}tl}t PCEH}u TH}RU d}RPhPjURQt`|$уt} D$td$у`tƒ 3fd$f T$tfd$f L$l$YZ]ÐU E @E E EHEjhXEEtE@t jj,j;kg:djP‰EE;v)EPX;uEHEE;whXEPu DQDt XE YEjEPEEtjEPjP *EE @@-tE @@+uE @@u 4tE @EE E EHEh YEPuNjEP)E~7E @@-tE @@+uE @@up4uf4t4jjDt8t XjhYƘt@u7jhY蚘t@u  Yjh$Yct@u 0YExtEPh@YEEEEHEEEE~hE j@P誰EEu E @EE E EPEP=jjEEEEHEEEEuJu觫u#cu٫jj耩tjj/}tujhXYDjjvjjy<uhYLPm~jhYDjjj<P|7t jjyQ}0404;P)u;L)u jjBd8=;uat jjt jjQLxjjEEÐUjEPOj@P#EEPEPPEEEÐUE PEP=EEt EE%jhYHCjjLEEÐUE@ t E@ uE@EE@ tE@ tEEEÐUEE @E@EEt>EuEa|Ez EEA|EZ E EE @EE~EA|EZ E EE;Et-E@EE @E EEE@EE @NEEEÐUE} XE EX<jjMuc}tt;jjъjEPÐU$E;}uEEPDP}uREܣ\E`EdEhElEpEtExE|}'f.ffffffff f f f~ fq fafQfAf1f!jEPw$EE(EEEE EEljEEEEEH\Eܡ`EdEhElEpEtExE|EjDPEPhTDP E}tĞԞ$4DTdtUjhYnEEE@}EEt9UEPBPuE@EE@EEuj jZEjEP ЋEPjEPSjP%ЋEPUEPhYBP E}PE}E@E5hYEPEPEPrjEPTEEÐU jEPEEt1E@tE@0t EEEE&t EjEPEEÐUjEP/EEtjEPE't EjEPEEÐUjEPEEt EE(t EE PEPgEEÐUEEEEPhhTj= u E~EEE~EEE~ ETajhY蔍EEtjEPT/jhYEE~ ET TE~ E^jhY$EEtjEP;/jhZ4EE~ E PU EHEPhZNEOEPh Z2E3EPhZEEPhZEEPhZEEPhZEEPh ZEEPh$ZEEPh(ZnEEuEM E-E)U(}Bw$(t֐EEEäܤ0LhUjh,Z EEu 4ZEEPPJt jhjj̣Pu PEPEEjEPTUDEhZEPEP EPhZ?EEu ZẸ@uZEETHPj̣P PEPEEjEPUDEhZEPEP( EPhZu ZEPhZwEEu ZEEPh[REEu [Et Eh[EPEP @u lU@EEEÐUhTPEP EEÐU]E@uE @u}EE[E@uE EFE @uEE2jEPYjE PI;} EEE EE]ÐUE PEPЋEPE@uEUPEUPUE PE PЋEPE@uE PhZЋEPE@u E [PÐUDuhTPP `uhTPP pt2EE;T}jj *E@EE;T|}ÐU}uQ`uhTPPp DuhTPPM }ÐUhjP ÐUhTPP ÐUhjP ÐUhjP ÐUÐUEPj̣P| hjP| ÐU@uhTPPF ÐUjj)ÐUuÐUhTPȣP ÐUhjP ÐU,thjģP hjP ÐUt{}u "}E~jEPÐUjEPEEthjأP EthjP EthjP EthjУP E}ÐU}thjԣP^ }thjP< }thjP }thjܣP }ÐUjEPEEEЋM#ȋEЋ}#;t"jEPwÐUjEP/EjE PE E;E EEÐUE t E 0EE@t EEEEEEEÐUhjP ÐU Et EEjEPV0EUUE;X)u;T)tUEPRZ t.Etjh[*jh$[*EE tEu0Etjh<[x*jhT[d*E;EuEHEEEuEt 0E EEEEEЉEEtjE;Eu E@EIE;E u@EHEE}1Et EE(ȋEPRQ !EЉEEujhp[)ÐUjjEPE PEPj#EEÐU@< u E @; tX @E U$(;Bu;Ju/ U,;Bs U,BEoE $(#\)#`)‰EE DEE MD;teEEE H@;(u;$u U,;Br+E@EE MD;uE MD;$ @; t @P@;h)u;d)tNt t}|  ;}},t  @EEEUE@R P UE@ RP M$(QAE@E MDAE MDA E DUP E ML  l)$( | +E@։EUc E؉U܋U؋E;h)u;d)tEU;EU| E ME;u; u E? jjjUEPRP;h)u;d)u!jh[%Ej EM䉂}t&EUP}BE}q t) *EMHQE5 EUPE@ PBPP EEu EE}jh[$Eu1}|'E~EUPEPBP}Pq EU EPUEPE EM䉂04lEu>EЍEPh[$jjE|utj}P賬ЍHPRDDuAX\;Du;@uH;Ht EtE @;EUE@RPUE@RP U@BE P @UP UPUE@R P UE@ RPE MDAE MDA E DUP E ML U,;Br U,BEE@<ÐUEt}tjh["E}ÐU졸}}}u` 04;h)u;d)u?}jh["tt wuj}P}}ÐU$]E t) x)|))PRQS/EU衄))EUEU;EUE @EE; tUEEEP@;Eu;Uu(UE@PBP}Pw EE@EE; uEuEujh[X E))EUEUEU;EU?]UUE #\)#`)‰EE DEE MD;tEEEEP@;E u;Uu E*E@EE MD;uEEÐU u E?EUEU ;))|$UE;h)u;d)tEU;EU } EK|))PRUE PREU  ME ;u;UEPR EU ;}E ;UE }HNu Et El ;UE |EH EM$(|))PRUE PRС ,EEÐU u E t* jP辚ʋ 04BEUUE;h)u;d)tUEPRE2t t EuEEÐU ))PRXu E @EE; u Ev @EE; t.EMP@;QA}EEE@EE; uҋE P@$( ǀ,EEÐU ud)h)EUdltd)h)EUF tUUEU 04UEEUÐU]u ud)h)EUE  l)$( | + ,։EUEU]uÐU u EEEu Er ,=s , @,= ) )$( $( ǀ,EEEÐU u E ,v , H, ));$(| E u5 $(+))PRu EE $(+) ) $( ǀ,EEÐUE} }-E  }}} }ÐU u u% d) h)04R @EE; t(Ud) h)BJE@EE; uء jP蟕ʋ 04 ) ) ) )$( ǀ, 04;)u;)u6 d) h)04   jjj))PRPS;h)u;d)ujh[dÐU h jEEu E   @ Ud) h)BJEEE P U@B @UP UP U@B UB @UP UPEEÐU]EE@}SE E T TE E T TE@EE@|]U @; tG @EUE@RPUE@RPjEP @; u ǀ ÐUjjj))PREP.;h)u;d)EEÐUj}P  #h8j  E UP UP ǀ  ǀ ) ) ) )$( ǀ, ǀ d) h)04 U E t,jEPu   P}P u UÐUE u  t | E u:  u jPH ǀEEu*j PH j}PÐU u E EEÐUEEEE@lEEEzMME@ʍDЉEjh[(jj,;EEE@EEPb}B҃ w$btcn먋E=rjh \jjEUBE@EEHEEEE@E=sEUBE@EE=r U Et E@uE}EE@t8E@PEPu E@EEEE@uȍ0EE@t`E@PEP8u4Ej@PE@t E@@E@E EE@uE ujh$\$jj(EEÐUEE=}hEIWtU5EI tUUE@EE=|ÐUEtU,tKEEE@t9E@ | E@~~EEE@EE@uNjEteE@tYE@*u.E@tAE@t5EjnPuE@*tjnEPtEEE@*uk<0T0H0<000$E@s} dtkt܃stutЋEEE UPÐUjh<\`EjEPt4jhH\_EEt"E@tjEPjj1EjEPjtjhT\_EEu4jh\\v_EEujhh\\_EEtnhp\EPuBhx\EPzu,h\EPduh\EPNtjhx\tjh\ÐUh\jvjh\^Eh\h4EP jh\r^Eh\h8EP ÐU,tjEP5 EE%EEEEÐUE%EEEEÐUE%EE=r ,u3jEPu jjEPh\j hEuh\haE=s:E@jPDu$E@jjPh\j h萾 jjEP4Pj hnEEÐUEuh\h0cE=srjEPt_E@jPu%E@jjPh\j h0ؽ!EjjP4Pj h0赽ijEP1 t%jjEP8Pj h03E=rEEE=s EpE=s EVE=s EP@ t/P@t!P@ tP@uEEÐUTu ELXPBjPPht EEEÐUE4E h4t44PÐU4uEBE u4@4@B4@4@B4@@ EEu aEEPhTӡTPP@tP@uEEÐUjE P_uE@EE;EtUE PB P?tOjjEjE P譫ЋEP EUPEU@BE@UPEUPEU@BÐU4u hT4P04@ÐU E4u EE4;)u EEEPEPFE8QE89E8P@t/P@ t!P@tP@ uߡP@ uP@ tE(8P=Tv-P@ uP=TvP@ tP=Tv-P@ tZP=TvP@ uE8XjPPEk8P@tP@uE18E8ME8uE8E8E8E\E8jEPEkjEPEUEK8E5U}Bw$e}Bw$et뺐Ed|TLUjEPU‰EEEE@tREEEPjEP E+EPEPEEt藼EEE@uEEÐUEETEjEPYEP@ tMP@t?P@ t/P@t!FP@ tP@uP=TvP@ tP=TuE5TEE;Ps"E@ tE@EE;PrދE;PrPETEE;PEt EE~@EE;Ps2EPEPEP! uEEUDEVEtEP<;uE0EP@;u EE@ uE@EE@EE;P;EEEÐU ltjlPlEEuEpttjtPP+Ej@PtP+EPEPtP P@EPBEP@;tjEPXlREj@PREEuEj@PrXl!jEP]XljEPEPBÐU0E Phx BE0E PhxBEEtȃtۍaEEÐU8tEuhClu褸EfEu l08lPhx @jEP,PEPP;pvP;pwu,8jtPtjPtjPat_P=TvPP<;u~jha8EEu aEjEP`tE89EEÐU,uEE:`EE%u`WE%=u1E%=t"jEPg`EB{E.E%=umE𡌧@UE;`} Ejhu`E`ٵ`E`\t \EPhEWt9Eu1jEP EEE'Ew$EPhWEE``{hU$]ܡ))EUTEE@0|hE@9\U]))؋%)ڋȋE@0ÉUEE@EE@0| E@9~E@E@EE@EEEE.uEPjEPQ ЋEPEUEUEU]ÐUTEEÐU4u E4@@@ EEÐU]jha;4EEt]E@tQhaEP裓thaEP荓u EjEPEjha3EEt E@u E^jEPjhbDEjEPϝEjhbEPhbEPEP輔EEE]ÐUEuhbP蓔jPuPhP` t)jhbPhbP tjP11PhP @tM@ t@ uB@@uh0bP[u DEKh8bP7u XE'"uEtPEPPhP jPÐU Ejh@b1EEtjEP.EEuEdE@EEE;E}%E@ uE@EE@EE;E|ۋE@EE@ t,E@ PhPbE PS E@EE@ uÐUEEEuJTtEhtEEuhXbEP蚑EjEP EuEjEP覑Ѝ`PR褑\\|x%=tEEtjEPThPfhbh\bEP h0bh\bEP EPhDh8bh\bEP EPhXjEP贐ÐUhÐUEjE PEPEPÐUtt EEEEEÐU졔% t7(t 0%tjh`bE%tjhlb'%tjhxb tjhb%tjhb% tjhb/tjhbjhbj)PÐU@E࿉EEu bE bEEE/責jEPtjEPEtjhb*jhb$jhbEtЃtjj.ÐU%PE(PEP 5PEP XE@+t E@ uE@EE@+tE@ tᡜ}tj}P芌E@u}jEPa}PEPR EHEPjjPjRQ藭}EHEPjjPjRQkQt?jEP:m&E@!t-tjP腋jEP7FtuhbhbhbPРtEPRGjhbq#}=}$ } N  :&/}B݃w$/77XXU(yE7E+E0|E9~PE.tHjEPi.du5jhEEY"O࿉EEu/EtE_tEu E EE䣘DE'Eu E EEࣘE@EEE+}t!z+;-tE tE uTu(EEPhb2EB!EtE;tE;t E;(utE࿃ujEPt$PhbEP EjEPEEu-EEEEEEjjjjEPj/ES~;E[7tE7tE{7tEgE]EQE} }tt5 tt&*}t!t*c@rEt3EE`}&} pDr./}M/7E tE uIEOjEPu E3#t $u|EEEÐUu跷2ÐUtT04;)u;)uj))PRqh 8P04PRTh Z tMpElEpl u 6defEpElÐUt=v+jju8aMt.觼u!j}PVu jjqXt8Mt.eu!j}PPVu jj/\u=h\EQtjhbEt E@ujj:@"jj?jEPɡdÐUTEEPhbsÐUuE=vH@Est ?u UEH&Eg;E //E"}tكtސtՐEÐUu =rjhbmjjqE@EUBUjEP~UDEE;Er!E@jPkEHEE;EsÐU E2E%tRt /E /EEtjEP1E%E PEPP E E ujEP1E }^%uKtjjR0Ejj0EEtEVE ~jh cEtjEP&1jEP0U@T@TEe7))t<t jj% #t두EeuEtoEetEEEet4GE뾐5jEPYw$(t0jEPt uEEEEEEEEPEPEEtjEPEtnjjjjh cj4));} ));|˫tPR*]jjPhL ));} ));|?*jjP+M ));|))u.));}PR7\jjPuK ));|))XjjPYL ));|)) u.));}PRg[jjPJ 5));|))jjPK ));|R=uPRZjjPI ߳tjf[lujjjI tltuE2));} T`uPRYjjTPI ));} TjjTPJ a \L));|))PRZ ;))} ))));} )) PR[[k ));| MYPRY& ;))}))dPPR[ 3t ?E܍EPh$c F }t.t! jjF(uQ EtE@jP葁jj腁% ));|))E=));|))}E `E));|))dPj"  ));|))`Pj# E졔tEE̋Ẹ));|))vPjE죔, E졔tEEȋEȣ ));|)).PjE죔 ~ ߭tj  jh(c; tjh@cj jjj)PhXcj ETtjh@c"3tj}PHhbPqujhdcտ tjhc趿jjj)PhbjjPAjPV&tjhcV));|))jP`#ttt#<tu jj|));}cE cEċEĉE܍EPhc藾Gtjhcv&));|))jP"tD));} cE cEċEĉE܍EPhc));|))jPEЋEЃujhd膽6jEPu7TEUċUE;)u;)tdPUEPREU ));|))jPEЋEЃujhdּjEPQu7EUċUE;)u;)tdPUEPRT 5));|))jP!tjh d,?t}Ej}PCEԋEԃu xjEPtjEPB!rjEPMB]&EErjjjjhbj ELtjh@cjjj)PhbjXEtjjjjh0dj XEE;t&E;tE;(tE tE u7jEPь!jjjjh8djEE;t&E;tE;(tE tE uKjEP0tjh@cjjjjhDdj%$\EE;tE;t E;(uKE tE uE.jEP螋tEjjj)Phbj%ELjjjjhLdEPzE&));};~ EEċEċU;}+Љ  ));};~ EEċEċU£ t*͹jjjjhXdj jEP 3E>5U2}B-w$(e}B΃w$(etƐè#X X#'#p$|t' pX$$(@`t&&H%"p8&&8#|#d!"lU,t EEE@EEÐU EPjrEEE;E}UEE@EE;E|EEEÐU EtEU PUjE PYgU ‰EE EEEE;E_E+E EE+EEEPjEPe EEt\EuTE;EvLEHEE;Ev7E@%t&E@%=u͋E@%=tEtYEt E=uGE@EE;Es4E@EE@EEEjEPJ^uE;ErcEt$jEPhtjEPhEEPEPHEtUE} UEM E;EEtE;EvE@ uEHEUBEt U+UEPEtM+M U+UE ÐU$EEEE U;EEE@E@ t!E@UBE@EE@EE@jPxEE@%EEEEEtjEPd;E~ \dEE@t'E@UBE@EE@EE@uًE@?UBE@EE;EwUBE@EE;EvE@EE@%EE@EE%t>E@EE@EEEEtE@EE@EEE܋E܃uEE U;|ÐUhhhhHjh`dj jhdhxd jhdhd ÐUEu Ebj j_cEEu EAEPE PEU PU UEPEU@BEUPEEÐUE PEPhk }jhdÐUE PEPh; }jhdװÐUEPE PEP }jhd訰ÐU E@E EEEE;EEPE@;E@E@EE@%EEuE@EE@%EEtEguEf<E%tE@EEUPE%EEEE@u EE@uE@gu EfE@EE@EEEEtE@EE@EEEEuE@uE@EE@tE@%t&E@EE@tE@EE@uEHEE@EEEE@EE;EUEdEÐU EdEEEtBMUjjEPBPAPE PEEdtE@EEuEfuEdEEEÐUE PEPPg EEÐUE PEPP7 EEÐU EPEPP EEu EEdjEPaEEtE@t EE6EPEPP EEu EE EEÐUEEE@EEU@BE@EEEE@EEU@BE@U‰EEEEÐUEE @tEE @t EE PEPsEEÐUEE @EuEE @nuEE @dt EEEE@EE@EjEPEEPEPEEEjEPEEPEPEEEjEPEEt E EEPEPEP EEEDECE7Ev}c+eR؃vwxtEÐUt EjEPEjEPX_EjEP'^E} EjEP(EUUE;)u;)tEU;))}jEP]E;EjP=\EEujEPd]Ejjj))PREP\;)u;)u)jEPJ]jEP ]EEPEPEPK^ EjEP\UE;Eu;UtjEP\E`E@u$E@MuE@+u E@GtEPEPEUE PREP EEÐU Et.jEP7EEtjEP>eE/EtjE P!eEjE P}EEu;EPEP}EEEPh8e蓨jEP[U$E;t E;u E@E;(u E)EE~EUEDߋUDE@EEPEPEEtE t EdEttE tEdE ttE t"EdEw$-8E uEdu/E~"EHEEDjPEEtjEPEEEì7777UjjEPE PEPjYEEÐU]EEEjEPFXEjE PucЋEP]Ej@PXSM‰AE EEU;PEtEE~@UUE;Ps2EPEPEPY uEEUDEZEtEP<;uE4EP@;u EE@ u UBE@EEU;P5]ÐUE uE@EjE PVU ‰EEU;Pr EEEjEPB=U‰EEUBE@EUBEEEÐU]jhfkEEE@jEPEEuhfEP?EjEP<jEPy<DEjEPDGEIЋEPREPhfEPEP,>jEP=hfEP?EjEP=hfEP>EEEE]ÐU,]؉ujEP)Et EETjEPEEjEP;u fEjEPEEujEP<EEjhfEEt E@u fEjEP ;jEP:jP:+Ѝ3DEjEPEE @<EPRQEPhfEPEP<jEP)<AEE@t?jEPg:ЋME@Ph g P: E@EE@ujEP(:ЋMEPhg P: jEPEjEP;EujEPy;EEtjEPEjEP<E@u%jEP6;jEP(;EE#jEP;jEP;EEE]؋uÐU$]Et t Ejj7ejhgxEEuEE@|uE@EEE@-u E@E%hfEP8uEDjEP}8jEPm8DEjEP8CEjjEPEPEPEP):jEP+EjEP9EuEEtxjEPM:EjEPEP: tjEP:EsEjPcEUPE UPjhf+BE=jEP5EjEPt:E@u EEEE]ÐU]u衸tEtjEP:jh(grEEujEP6jE P6jEP63DEjEPyAEjEPE PEPEPEPh8jEPjEjEP7EtjEPS9]uÐUEjEPeEdPEP_7EE|!|%=@uDž` Dž``EjEPR7EEEÐUEjEPEuYjEP:tFjEPW5jP)@EEPEPV5h,EP5dPEPl6EE}jEPCzEit ES|%=t@jEP4j*P?EEPEP4h<EP5jEP6EEEÐUhPEP6|EUEUjEPuEUEUÐU4gEEÐUuSwSÐU]lt Eue; *u;*u EWjj;EUUE; *u;*teȋ]E;u;u E EEEE]ÐUUu EXjj軆EUUE; *u;*tUE;*u;*u EEEEEÐUuaÐU]EEEt TUH;"|!E;~TUH;t EEEEEptHTUH;|;/dȋ] E;u;t&U EPREQPjj`ȋ] E;u;u 8tL讆U EPR豅Ept xQCPhujh8gzEHEE^E~(EHEEu**E UU EPRg E UU E; *u;*upEEu!jjp; *u;*tjj_u/jjNuTHPj8tU EPR苄E@EEt^htBU E; *u;*u,pu"<u@uw\EHEEEu EthjjE]ÐU EU;EtTUH;~ EEEEEHEE|uU EPR E UU E; *u;*u Eu?U EPR裃E@EEuMMvEHEE}EuEtwuMjjDÐUnt<t2iu%jjt jj:jjہEUUE; *u;*E tTHPj貄tzlth{t**EUIjjgjjjRPjjjIEUUE; *u;*tjEPE PUEPREPUjjEUUE; *u;*u.E tjj;*u;*u !jEPE PUEPREPIÐUlt E6| EptTEE'EÐUE=pt"EPU EPE@EE=puÐUE u pE E U@BEU PE @UPE UPE @U@BEj@Pg@ÐUUE@RPUE@RPEj@P!HÐUj(jQ6EjEP6ЋEPUU UBJ UBE@E@ E PEPEEEÐUEuajEPME;}uj}P}EEjEPEj@P@,jEP2,ÐU EupE EEEEE@=pu E E@EEÐU EupE EEEEE@=pu E E@EEÐUjEPEEt EE,jEP-EEt EE EEÐUEEÐUpEE=pt3E@PEPH)uEEE@EE=puEEÐUjEPEEuE PEPTEEEEÐUEu E E@EEÐUE@EEÐUMU BABA BA$ÐUUM BAB AB$AÐUUBUE@EEÐUEPU EPÐUE@EEÐUE@ EEÐUEU P ÐU0]ЋUE ;Vu;Uu 0UVEUtu 0tLlt E E@ʋMU jEPRQUE PRUE PRUtp/UVEU*EU EUt:/UVEUZEEu.E uYEU+VVEU뚐UEPRUEPRUEUEUEU;EU t.UVEUI#YEUEPREPO# EءVVEUEUE؃~AE؋UM]+ډM]EHE؋E؃|hYEHE؋E؃}EU;EU F*MXEEu-UVEUE tE u E EEԉEtu-UVEU/E tEu`*EoWEUE؃~9\u/u%E@M]+؉M]E EE tEW+VVRPEP! E؋E؃~o\u ~7JWEE tEuVEUEX VM؋]+ӉEUEVEjEPI)UEPR詓tEUEU 0t8!V+VVjjRPUEPRғt jj*+txEtpWVEE tE u@t+UVEU?VEE tȋE tEtVrUEUEUEUEU]ÐU@]UE ;Vu;Ut VV;EU |*UVEUMtu 0tg@ЋEM ;} VVẺU@M] +؉M̉]jjUE PRŰEPR讟UE +VVPRrPt%*UVEUTTELUGUE܃ t E܃ .UE܋E܃ tE܃ uCt)UVEU TE܋E܃ tŋE܃ tE܃uk)UVEUSt=)UVEUTE܋E܃ u ?S VVډM]E܃uSEU닐EUEUUEPRNt(UVEUEP UEPR EUEUUEPRNSE܋E܃t tB(UVEUVVEUEUE܃ u9$EԋEԃ~\uu E@EdEQ+VVRPEP EԋEԃ\u ~EXuEԉEЋEHEԋEЉE̋Ẽ~8REU+VVEUEԉEȋEHEԋEȉEċEăEU;EU jEP$UEPRtEUEU 0t8P+VVjjRPUEPR覎t jj*%EUEUEU]ÐUUE ;Vu;UtdUE PRLtPEEuE t E tVVEU EU 뻐EU }}PEVVEU EU EtE tE uÐEU }}ÐUuMtjhHg$k=q}OEUUEPREUUE;Vu;VuTHPV VPR 8THPUEPR TjHPo;Uu;EtÐUUE PR-/EUUE;Vu;VtJUEPRJu5tUEPRdPUEPR h$V(V;EU |5Lu+RNȡdPRQ jhdgi EU EUEPhgiÐU jEP?r7pEPUEPRv ÐU5MEUUE;Vu;VujhgjeKMEUUE;Vu;VujhghajjE PEPUEPR`EUEU;EU|EU+$V(VEUdPUEPR UUE PRHuHNEE t EtMEE tEuE u(MLEU tUE PREPUE PR ÐU]jEP,qEUE PRoEE|sE+EEE~"jjljjjRPEP"]jjljjjRPSyt jjzUE PRGtjhg'gNjjclEUjjQlEUUE;Vu;VtEU ;EUEE;EUE;Vu;VtSEU;EU |E T+M]jjjUEPRDPt jjUE PRgEU UE ;Vu;VuE@EE;ET8  TE+EPjjUE PRAPEETUH;UE PREU UE ;Vu;Vu_EU ;EU|6MjjjUEPRAPlt jjpE@ETUH;s7pu 65 UE PRDk TjjjUE PRAP]ÐUjhhѶ((t(@u h(jhh蚶,,t,@u 0h,jh jh ÐUEEjEPEjEPEEtEu5EtjEPEtjEPEoPPEP? PPEP' jPjPEE𣠖EEEUEEEÐU048<@HL0t L@LÐU(,V0VEU uUE PRB#EU00 B}};8Vu;4Vt@EU ;}}|,EU ;}}}0@B0B0@04@4 EPUEPR] jEPE؋E؃}E0jjEPEPhHhR]E@EEE;E}&0U  E@EE;E|ڡ0Eأ04Eأ4LEأL4;L}P0 B0E0@0UB4@44;L|ÐU,EE4+LU;~4+LE0+LU;~0+LELEEEE;E:E;0+E@E EtE=EUBEU@BE@EE@EE;0E@EU@BEU@BE@E𡜖E@E؋E@EE؉EjEPu E;0}E@xEE%,EjPVEEE;0~EjPWEjEPW_u@EPEP_u+jEP_t E EEԉEE؉EmEEu8,tjEP?_t E EE؉EEjPQuEEEu^E+EuSEU@BU B EE@EEEEE@EhE~E@E EE؉EEE;0}EEEEEԋEԉEܡEPEPR0EPEPR0E@jPdU‰EEE;0}E@jPU‰EEPEPo0t:jEPU‰EEE;0}jEPU‰EE+E;E}8EEEEEEE}EE;EE;0E;0}IEU@BEU@BE@EE@EE;0|E04+E48E8Uj4PÐUEjEPx/EEt EEEt EEEt EEEt EEEEEÐUEjEP.EEt EEEt E(EEt E$EEt E EEEEÐU Eu:,tjEP=[t EEEEB,tjEPt'EjPMtE6jEPiZuEPEPZt EEjEPZtE@E0~C0PE PR,-u"0@jPMU‰EjE P7-tA0t!0PE PR,ujE PiU‰EEEEÐU0ELPjEPEW E0;L4;L0@0E+0LPjEPV E0PEPREP E4+E4E~ EDEE0;L~(4;L~0@0WEEÐU 0EE;v\PjEPV EEt E=u E1jEPu EE;wEEÐUjEPu E!EP(P EEÐUjEP?u E=jEPt EEP,Pp EEÐU$]܋E EEtE  t uCEt E=u1jUEPRE PjEPt ES*MUEPRQ6 tE), jEP1KjEP:?EjEP؋54j0Pj \3j0P;~ EE@t?EHjUEPRjj Qut EKE@EE@u/jUEPRE PEPEP1t EEE]u}UE~"`dPREEEEÐUHt7H uEu# HjjX\PRjQ8;}+8jP usjjm\tbThEE@tME0@B0E0@0UBE@EE@u4;|&tEt u u;0 B0B0@04;|xE tp0 B0E0@0UB0B0E0@0UB0B0BÐUEB@BU@t\8t%EuE @E~]EHEE @Et E E EE'EPE PE@%EEÐU@8ÐUUE ;8Vu;4Vt%UE PR%uZ*EEu4V8VEUEE tEt t)EUSUH;|#th)+MEU;AQ|ElEP@UEE@EE@=pu‹ll@RPll@RPÐUjhXh@ÐU졐|A@d~,?6С;|U u   jhth#?ÐU ] uDVHVEUUE ;XVu;TVuDVHVEUkDVHV;EU |LVPVEUBpEE=pt5EP@ ;UE }$E@EE=ptEP@ ;UE |܋EP@ ;E u;UuEP@UE4E=pt+E@M] +HX EP@ +UE ;]E@EEP@ PRDtDVHVEUYEP@UEEP@ UEEU;EU jjjjUEPREUtDVHVEUUE;XVu;TVuDVHVEUSLVPVEUEUEU;EU `jjUEPRUEPR1EU ;EU}EU+LVPVEU*EP@ PRtDVHVEUEP@UEEP@ UEEU ;EUjjjjUEPREUtDVHVEUUE;XVu;TVuDVHVEUZEU+LVPVEUEU ;EU_jjUEPRUEPREUEUEU]ÐU ]LVPV;EU |DVHVEUpEE=pt5EP@;UE }$E@EE=ptEP@;UE |܋EP@;E u;UuEP@ UE`E=pt+E@M] +HXEP@+UE ;E@EEP@ PRtTVXVEUEP@UEEP@ UEEU;EU jjjjUEPRKEUtTVXVEUUE;XVu;TVuTVXVEURLVPVEUEUEU;EU gEP@ PRtTVXVEUEP@UEEP@ UEEU ;EUjjjjUEPR{EUtTVXVEUUE;XVu;TVuTVXVEUUEU+LVPVEUEU ;EUfjjUEPRUEPREUEUEU]ÐU jEPo=EUEUUE;XVu;TVuWE|OE;T}DE@EjEP =EUUE;XVu;TVuE| E;T|UE;XVu;TVu EUEUUEPR_EUUE;Eu;UuEU+LVPVEUEUEUEUÐU]E@-u E@E3+ jhh1jEP1jhh1Ejj螓0jj8jjjjj`Ejjjhh}jEP/EjhhiEEE@E@ujEPPEjEP٠EEtijEPjEPpDEjEP;E@ЋEPREPhhEPEP#jEPEu3E@ujhhEjEPEjEPjEPnjj2jEPjEPjj:ijj~E t3jE P/jhh/4jj 8/. jEPjjh]ÐUjEPoEUUE;`Vu;\Vu Ejj9EUUE;`Vu;\VudVhVEUjjR9EUE.u)jUEPRUEPRE PEEU;EU|&jUEPRUEPRE PEcUE;`Vu;\Vu&jUEPRUEPRE PCE'jUEPRUEPRE PEEÐU0U EPRtjhh2EhhEPzEEujhh2Ejhh-jEP-jhhr-u,jjjjfjj DEUE;`Vu;\VtAE UEUlVpVE UE UEUEUEU;EUEEuE@HEEUPE}EPEPE3EE؋E؋@EԋEԋU@BEEEӋUԈBEӉE܋E܃u^UE;`Vu;\V_E UE܉UlVpVE UE UE܋UEԉU؋EU;EUE EEEuE@HEEUPE}EPEPE3EEE@EEU@BEEEUBEEEuE t EgjEPjj 9jj}djj jj&dEEÐUEE5}.EtV xVE@EE5|ÐUEa|EzEE;EA|EZE(EjhiX/EEÐU)EU|V VBJE@ E}P7tjhi.EE6ʋUBJTUHB E}PEEjPE7E}PEjEPEEueEP@;xVu;tVujh4i.E9.E.}$'t딃.O^뀋EEEÐUjEPEEÐUjEPEEu2jEP16UEBEBEB E}PÐU UtMjEP5UE;xVu;tVu$EEE}ÐUjEPEEuE=uEEP@;xVu;tVu,E}PU|V VBJEdP UBEBEB EE@;}tEj@P tEPUEPR ÐU jEPEEutVxVEUAE@;}t"jhDi+tVxVEUEP@UEEUÐUEE5}?E;EuEtV xVE@EE5|ÐUtjh`i+E }tjhi*}|jhi*jE PuE jE PD}j}PO H}}jhiN*}EEPhi2*Ew$%Lܴ\U}E PEPÐU \E EEPhiEPP EEuEjhi)%@jE PC\ EtÐU$EE @.uDE @E EPhiE P xEtjhi#)GEPhiE P E܋Etjhj(Eܣdxx}dEEPh(j(xPhLjEP jEPEE~)ED0uEHEE~ ED0tUDEEEPhTj'(Ew$1ܵxܵUx}Tx@BdÐU$EE @.uDE @E EPh|jE P/ |Etjhj'GEPh|jE P E܋EtjhjH'Eܣ||}EEPhj'|PhLjEP jEP~EE~)ED0uEHEE~ ED0tUDEEEPhj&Ew$Ѹ||U|}|@BÐU,jE PztE EEPhj&EtÐU E <tjhk%jE PjP]ƊENcu!t^EUUE;Vu;VujEP݊=jEP譊dPUEPRG E@GÐUPE LUjE PE jE P蠚L-LEEPh0k$Ew$8lDU7@jE P3WDujh@kW EtÐU -EE @E EE @E EE @E EE @E zEE @E fEE @E REEE @m}M}=t܃MthtЃs} mVs3wt밋Ej@PjE P|ЋEP6EEPhDk#Ew$I  Uj4P{ Ew$h|hUHEw$żðUS}jhHk&jhTjhPkjh|kjhkjhkjh(ljjEw$UrDž@@ Dž4jE PBE E @0|LE @9@4ME @ʍDЉ4E @E E @0| E @9~@4;~ @4@@@jE PE E @0E @E 0,,,t@  @}`@+41h\lDPDž@@;}p@~hhlDPjDPyЋ@PhllDP @@@@;|jDP(hplDPjDPС4Ph|lDPe D88PhDk%Ew$1ðU E @u<@E @t E @tjhlE @@E @u@<E @<I@E<EEEEEPhl8Ew$!LLU#jhlxEw$iL88U~ ETEEÐU,EutvPEPjBЃO@jP EjEPEP С@P@ttEEE@pUE@-uE@EEE7E@+EEtE@E @jj+ jjjPEPEPN EE@+uE@EjEPz}jEPNEHEEzDtEzzEEԋE@EE@EU0}=$}  A+} $1+-n}BЃ w$nsEEuPjEPEEa|Ez E EEԉEjEPEEEE@a|E@z EEEԉEEPjEP EEEEE@t E@ ufE@=uPEt?E@t1E@t#EE؍EPhldjjhE@EEEu>EE؋EuEPhl!EPh8mjjE'EtUE@R P*E@ u EEE@UԉPEtUE@R P!UEPB PЋE@PE@uEE@ uE@EE@ tEjj@PEPEPEPEoE@uEjEPEPm ЋE@P3E@}t2E@tUEPjBЃE@$$$$$$$$$$U E@EE࿉EjEP EEu'jEPEEPhhmEu8E@@t*jEPgEEPhmEu8E@%t(jEP%EEPhmqw"EuE @uEE@t҃t͋EtE@%t jj4ErE@@u EEE@UPSUE@R P?E@ u EEE@UPEHw$PEa|Ez E EEPEPBPrЋE@PjUE@R PWEa|Ez E EUEPB PЋE@PEHw$\jhmEttVEPjE P EEu E@UP9UE@R P'jhm4:EHw$h8E@}g2E@t-Eu E EUE PEPBЃEtE@%t:EusKE@PEjDPhQE@@EUEPBPD-(E@}tt tt֋EtE@ t  Hx 4UE t"Eu EEEE%Eu E EEEEÐUjEPPhnh\ EEÐUjEPEEu EE@SEEÐUjEPEEtE@ u E E@EEÐUEEÐUEEEPh nFÐU@jPjPÐUE@ujEPjjE UPEEE@E@$t)EE@PEPbUBE@EtE+Ej@PЋE PU E+EPEPBP E U+UH *E@$} t t뜃$t-zE@EE@$EEEÐU E tE @E5EtEEEPh(njjEEÐUEj@P<EEE@-uEE@EE@0| E@9~EPE P@EEE@0|FE@9:MME@ʍDЉEE@EE@0| E@9~ƋEUPEt E@EtE؉EEEEÐU EEEj@P.EE@0| E@9~EPE PSEE@0|ME@9AMME@ʍDЉEE@EE@EE@0| E@9~E~GEEEHEEEE~)E EEEEHEEEEGEEE@EEEE}+UUЉEEEE@EEEE|ՋEUPEt E@EEEÐUDu XE#Xt EEEEEÐUjhDn_EEtE@t DHEE@tNE@tUE@R PE@%tEjj@ЃE$EE@uÐUHEE@tRE@;Eu EEEE@tE@ ;Eu EEE$EE@uEEÐUEA|EZ E:Ea|Ez EE-u E EEU0E@EEEEEEHEE@E@EEEEUEPBPEP EE~EE@jPtoEԃuE;Eu ECE;E~8EEEEEEEEj@PѼU;EԋE@uE@EE@E@EEE$EE@E؃tEt E@E@UU܋EPE t&Eu E E@EЋE UЉPEEEÐUjh^t6jEPQjEPjQ E EPE PEP` Elu8Eu؞@؞ ؞؞~ jjE}.u- uE EEEÐUjh聾ÐUjEPoEEEÐU]jPZEjEP艺jEPyDEjEPDEjEPEPh\yEPEP2EEE]ÐU UM V Vȋ%VʉEMVVPRUEPRh;U u;EuUEPRUEPRIЉU2VVPRUEPR&RPUE PRЉUEÐU ]u}] ‹  4Ed3‰EEuVVEU]EMu EuUEPRUEPR_;U u;Eu%VVPRUEPR;EUC]uVVPRUE PR ‹EuEU]u}ÐU t EEPEPEEtXjEP%EEu jEPE@EEPEP趿EEu3ÐU ܞ-,EEuS}t EEEEEPh,EP荸 ;Et  ,ܞÐU,t,ܞ=+rPܞEܞ@ܞEUBhEEEÐUE@t1E@EE@EEEjEP\E@uÐU$]܋EU ;VVEEEEtEU EU EHEUBEHEVVPRUE PRwV VʋˋEHVVPRUE PR5EU UE ;Vu;VuEtEHE-UBEPEP蒵]ÐU$]܋EU ;VVEEEEtEU EU EHEUBEHEVVPRUE PRwV VʋˋEHVVPRUE PR5EU UE ;Vu;VuEtEHE-UBEPEP蒴]ÐUEEEEEtE؉EEHEUBEHEE ƒ0UBE EEu͋EtEHE-UBEPE PÐUEPEPMjEPjEP葳EEÐUEPUE PR jEPjEPMEEÐUEE@-E@%t3E@EE@EEEjEPE@EE@EE @EE E E@t8E@EE@EEEjEPxE@EE@uzE j@PU‰EE E VE P@PRU‰EE E 0EEE@EE@n}dtnts.E@EEEÐUIEE t&E tE tEtjEPg2ÐUEL@L}t;t1u~jjBEEE PEPU‰E}t ujj HjhL UDEE;|  !ÐU83jjE PEPJjh,ÐU E}ttE PEPGE}t ujj EE'E;|  9EEEÐU E %uzjj脺EEEjEPEPY t)jEPjhdyE/E@tEj@PEUPEEÐU tEE?jEPjPFPjǹEjjjjEPEPLGEPE PEP EE;EtjEP?EEEÐUEEE@tEj@PKE@ÐUEEEÐUEE EEEEE;EEEEEEPE@;u8E;EtE;Eu&E@EEEE@EEPE@;tȋE;Eu.Et EUPEt EUPEE@EE;EaEEÐU0EEE$%t3jE P<ЋEPEPEPEPRE PEzE t E EEԉEjEPEPjEPEPʰu EEEЉEEtUUEPUUEPE$%uEuE$%tEu EEEEEEEU0TE5THE'THEEw$U  ЋDMEEUôU ]uEE;T}2U u  ЋDLDE@EE;T|΋ T E] D\]uÐU ]uTHEE~/U u LD DEHEEыEM  BJ]uÐU]EE;T}-M VVʉ\E@EE;T|Ӌ]ÐU]T;, t"jEPj PVVEUjTP  T,3UE;Vu;VtM E]D\]ÐU ] EU ;AQ} EOEE;T}4] EU ;T} EHEE@EE;T|EE]ÐUTHPj EEÐUEEE;E 7U  ЋD;Vu; Vt EE@EE;E ~EEÐUEE;T}VU  ЋD;Vu; Vt%EU@BU  ЋTEHP'E@EE;T|V VUBJÐUE} ETEEEE;T| THEEHEEÐUjhV莲Dt VE 3WEjEP\jhWHjhW4jh:X jhX ÐUjEPOE0E=r0؍EEPEP0P' 0E00BÐUEEEjEPpÐUEPUE PRI jEP;ÐUEPUE PR jEP ÐUEPEPjEPÐUjhtyÐUjEPEUUE;Xu;Xu[E|STUH;}FE@EjEPiEUUE;Xu;XuE| TUH;|UE;Xu;Xu EUEUEUEUU$]~0=4EjE P ;Xu;XEEqEj}P|hxyPɤEf EX t;Xu;Xt EEEE,t,EzEEE,t E PEEEjE P;Xu;Xt"ڋX X;} EEEEcjE PŹ;Xu;XtJEUXX;EU},UEPR觲;Xu;Xt E EEE_;Xu;XE{+tEj}P[xEUl}>a}*L}BtD[LPFBw>$p}Bw*$s} pgs+xFEE]à< <U,]njE PEUUE;Xu;XtUEPR jPKjE PŷEU衤XX;EU}MT~C]M+X XTHPRQSɢX XQSW[EUUE;Xu;Xu UE;Xu;XujjE|UE+XXPREU衤XX;EU|f@]M+X XTHPRQSX XQSjPlj}PgwjPI(t(jPj}P[wjP jE PEUUE;Xu;XtUEPRgEUUE;Xu;Xt?UE;Xu;Xt)UEPR蜮EU衤XX;EU|UE+XXPR<'EEtjEP_ujPwjE PEUEUUE;Xu;Xt?XX;EU},jjUEPRUEPR;jP#jE PqEUUE;Xu;Xt`]EUUE;Xu;Xt?UE;Xu;Xt)UEPR.E܉UࡤXX;EU| *jjU܋EPRUEPRojP4EUUE;Xu;XtUEPR#0=4v30@ u%0H00=4v0@ t=%tjh|yjhy j}PKrE؋E؃tjEPsjPGkUf}WP}'L}B$Lb}PTA|Bwq$*p}0l}fiLl3m5x}'s}p! sSt x]T(@UEUE@EEuEExpEHEEu EE]TE@EIEHECE@EE@:} t܃.t?}:t?w\tjEÐUjE @E @E @|E @pjdPKЋE PVE @EHEAE@EE@j} Btbt͐m}jtmstZDE@d}P;b2"l} d"lpEEEÐU40E@uyEEEE@%E@jPUE@EE@jPz6E@EE@EEu EHEBEEPEP8EEPEPujEPbEjEPIEE@EE@EEu EHEU+UjjPjE PEPREPPP(.ÐU0ujhÐU jEPUE;Xu;Xu.jjkjjRPUEPR jjÐUuÐUthEtXXEUgEUUE;Xu;Xu覻AEUEUEUHtt6Et E EjEPfEUjdPKEjEP:EUEtvjjjjUEPR!EUUE;Xu;Xu@E@EE;T|,jEPEUUE;Xu;XtRUE;Xu;XuEjEP}EjEPEPEPEPEPEjh tyjjPjEPEPEPEPP Py(EEt>jj袑EUEȋM̉BJUEM B JEPh0@jh1jjEPjEPEPEPEPPP(E܋E܃Et1jjEPEPEPEPEPEPUȋEPR(EHEEyu1NjjEPEPEPEPEPEPUȋEPR(jEPGjEP9E$tEȋM̋U$BJE&jEP jEPEÐUj)PEEuEEPEPhJ } E_jEP00tt  uuEEÐU E tE @jhu.jEPujhyEU%;tjhy]Eu jjutEPE Ph }EpjE P00tt  tjj;ujEPEUUE;Xu;Xu4E%t EEjhyEjjEPjEPEPXXPRUEPR(EEt&uE~ jjgEE>EudPUEPRh u jj(EEÐU0]С $EU(,EUjhyu|uE}XXEUIEU EUEE;E}-jjjjUEPR$EUE@E؋E;E|Ӌ $;Xu;Xt=UE;Xu;XtEU; $|(,;EU }L_zUE;Xu;Xt@UEUEEU EUUE;Xu;XuA(,;EU}@UEUE $EUEU ; $}[@ЋEM ;}XXEU @M] +؉M] EU EU(,EU UE;Xu;Xt0UE;Xu;XtEU;EU} EUEUUE;Xu;XtEU ;EUE%U ЉUjEPjEPjEPUEPRUE PR(E܋E܃}](,;Xu;Xt(,;EU} EUEUEU $EU(,]ÐU(Et E@ujh E PEPh   ÐU赹t Ejh EEÐUhj<tÐUh jtUhPjрtrUEt=hj虀h j芀hPj{jjo2jj_jjSjjGjj;ÐU EEuEjj*jjwjjjjwjPh jjj4  EEEtPETEi;Eu T;Et'T@T=أ Et<t jj ÐUDEE=Dt>UE@RPUE@RPjEP|DEE=Du4<8ÐUjjEjE P{j@PԅЋEPUE PBPzUEMB JUEBEuE@7jEPzj@PqЋEPUEPBPzEEEÐUhyLPZzuEhyLP4zu EhyLPzu EhyLPyu EbhzLPyu E>jLPW|EE|jEPzE EEÐUEEujEPEEPEP7ECMjhzl:jhzX&jh4zDEw$U4uXXEU94P @;Xu;Xt EUEUEUÐUEEEEHEEEE~#s EEEEHEEEE݋EEEÐUEEEEHEEEE~# EEEEHEEEE݋EEEÐU8EEÐU<EEÐU0jLPz.EhHzEP6yEjEPxEuEG8jEPvEEPhPx ~!uLEPPEPx u E tE t EEjP{EE@uEEE@ tCE@ t7E@t+E@EE@ tE@ t E@uոUBE@EjEPEE@uMEEPjEPr UEEԃXXEUE@E؋E@EE@^uE@EEEE@;Et>E@t2E@\uE@EE@EE@;Et E@u΋E@$E܋E܃tEHEUBEPEPUEPREPEPyDPHPHPH8@8EPhPiv jEPbv8u ED4<EEÐU4u E4j@PEEÐU(XXEUUEPR̂EUtXXEUPEUEUjjjEPUEPR{EUUE;Xu;XtXXEUEUUE;Xu;Xu%jhLz5XXEU tjjUEPRUEPRy4j@PrE܋4EPEPBPit uM4@tEE@tEE@ u!UEPRxʋ4B J EUEUEUÐU(E tEuE8E uH\zLjhdzt@u ENtzPHz@xz0|z E8E w$-#jEP*u EjPpjPpjPp3jDP\{jPPPhzPp;EtjPqhHzPsjPqPhP r t,=HtjPrEjPo~* u0jPns t ujjPPPPtjPojjPRPPDPHPHPH8@8PhPp =Ht=jPCqt'4<8E@D=Du E4<EEØU4u Ea4@EE=Du+Pu E6D4<E4<@<4@EEÐU4u Ea4@EE=Du+Pu E6H48<E4<H<4@EEÐU4uXXEU4P @PREUEUÐUEEE UPE@tEE@Iu,E@EE@tE@ItԋE@uEEUBE@EE@tEE@It,E@EE@tE@IuԋE@u EE@IE@tEE@Iu,E@EE@tE@ItԋE@tEE@It,E@EE@tE@IuԋE@Iu EEUPEUPE@tEE@Iu,E@EE@tE@ItԋE@u EhUBE@EE@tEE@It,E@EE@tE@IuԋE@u EEUPEUPE@tEE@Iu,E@EE@tE@ItԋE@u EsUBE j@PhtKEj@Pht5Ej@PhtEj@PUi~ EEEÐUjhz1kDD} DÐUÐU jEPDP) EEu E;E} jjotEuEEuE%EEUWVS[}Q[^_UWVS[aQ[^_?  D lXd SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- Search patterns may be modified by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceeded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Forward search skips current screen. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop long lines. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. --no-keypad Don't use termcap keypad init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. CNTL-RightArrow ESC-RightArrow ESC-w Move cursor right one word. CNTL-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. CNTL-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. CNTL-DELETE ESC-DELETE ESC-X Delete word under cursor. CNTL-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. CNTL-L Complete filename, list all. +d@B 0?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSSECURE/moreMORELESS--VISUALEDITORviLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functional-No filenames allowed with -t optionCannot allocate memoryLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_LINESliCOLUMNScokrklkukdkPkNkh@7kDTERMunknownhcamxndadbutsgpcksketitececdcl cmsoseusuemdmembvbbsbcho|^ll cralsrNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread error%sch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMT%cESC^%cascii8bcccbcc18b95.b8bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.next8bcccbcc18b95.bb125.bbdos8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bANSI_X3.4-1968US-ASCIIISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255?LESSSEPARATOR/LESSHISTFILE-/dev/nullHOME.lesshst%s/%sr.less-history-file:.search.shellLESSHISTSIZE"%s w%s Non-match First-file EOF-ignore Keep-pos Regex-off &//?_-(P)+!!done|doneThere is no --%s option& less %sungetcc overflowPattern not found:%s@/\less/\help/\file/\@Command not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filemark: goto mark: |mark: Brackets: /usr/local/bin/.syslessLESSKEY_SYSTEM/usr/local/etc/syslessLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"-@/\less/\help/\file/\@%s"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"LESSMETAESCAPE\LESSMETACHARS; *? '"()<>[]|&^`#\$%=~%c%s%c%s%s%s/HOME%s*SHELLr%s %s %s-LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x -- %sLESSOPENLESSCLOSE-c...skipping... Cannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSmLESSANSIMIDCHARS0123456789;[?!"'#%()*+ %*s Calculating line numbersLine numbers turned off! /dev/ttySHELL%s %s %ssh (press RETURN)Cannot seek to start positionwCannot create pipeInvalid mark letterCannot seek to end of fileMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"lLine number is required after -ljInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %s#Invalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"tags support is not availableTags file "%s"/%sless Copyright (C) 1984-2009 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops ,%d and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sLESS_IS_MOREsearch-skip-screenbuffersauto-buffersclear-screendumbquit-at-eofforcequit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filequit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEpatternpromptsilentquietraw-control-charssqueeze-blank-lineschop-long-linestagtag-fileunderline-specialversionhilite-unreadtabsno-initmax-forw-scrollwindowquotestildehelpshiftno-keypadold-botfollow-nameSearch includes displayed screenSearch skips displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command Follows file descriptorF command Follows file name%s: %sInvalid pattern?-tagfileNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATH-No tags fileNo such tag in tags fileunknown tag typerTag not foundtagsLESSGLOBALTAGSsP%s -x%s %s/dev/tty{Ɛ֐&6FVfvƑ֑&6FVfvƒ֒&6FVfvƓ֓&6FVfvƔ֔&,,,,, ) ,),,LM /L" ``6``D` oգoT|oP0o`o``>z p\x\8`\H`\\ ]T` ]`` ]h` ]t` ]|` ]`(]` ]` ]` ]` ]`\]`]`]`]` ]` ]a ]a ]a ]a ](a ]0a ] @ F H J M U V A C M M 114:GN557799q~-0226799XY__24RSrs   "'(229;446:<<BBks *0/000 %& #      8 : ? ? gi{BD psvy0WX``   ;?__KLn : ; N O U W q z      ) ) 1 1 4 4 7 7 : ; = = C F I J N X ] ] _ e u      ) ) 1 1 4 4 : ; D F I J N U X [ ^ ^ b e r     ) ) 4 4 : = E E I I N T W _ b e p      ) ) : = D E I I N V X _ b e p ;>\HHkp""((++35:?ZZ^IINOWWYY^_[^}w  7?T_mmqqtx,/<?ACnou LO}FGNOXXZZ\\^^~  ( ( ) ) * . ` c d i j o r s O!R!!!##'$?$K$_$&&&''' ' '('('L'L'N'N'S'U'W'W'_'`'''''''''''++$++/,/,_,_,m,s,x,,,,&-/-f-n-p--------------------........////@0@00011-10111111122D2O222MMǤ",?x./ko77==??BBEE@O$/SSgglouu  '';;>>NO^46$/K  669;=>@            4 7 ; > H O Y o##c$o$t$')szFW_rUU  ::??EEGIQQצ _)#*#./000>0A0MNƤ0k`D"D#D%D'""DDDXXXlll e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789.=:f/?/*?*n+n,N-N.&7m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)ppatdppb@4`ppBpqcp-~ Lp.- Z. f0w q2_ v`2L 2] {Xp)@8( ; B pC  C  {$p )H( IF I, K 0Rh R6 S {Xp()!\ {Xph**{XpH}*19pd1 Fdi D e? Q`ey [gW {XppUf{XpH}Un{XpH}Vu|0{ ~    0 #  @ 5   f u {(p,V ?  #P +2 {hpH}DV6{XpH}\V@Gg Pk {pH}tVX{Xp<Vbk5 q02 {Y  p[ {p@H)` {XpDH){p؞V : `> U {,pܞV   {XpH}H){,p Vi % & * -P* 8& ? H V [J R@ e  {0pVo0 {9 0#   l ^ u '  \  PE   {pX5 + 0 {XpH}H)07 BT K= T@$G _@ j@# s# |$ {4pDX{XpH}H){XpTH)D0W \p    `B$ "P,D 8أQE; ZuV }  c| C" Г- `! (H fN A h 3WM" 89 J E @N p(f @v p ( }     p О T U " <' 1 4 T< G XS T] <@y WT 4 es p h 0    k L$ 8, p5 U 0 a `I4 q   @ p h } | 4   x @ `/  & x4 @? @ I 0R g [  c | ( D x  У  }  " H}!* p2 8M 0$ _  h $l `   $ } p8J  H0 hu/ & /|D N`0d YptV X P: @+ L},P :}EKhȞO lD )M ,)h U `\L  F  . 7Up`}lܣБ] @r `Pw$  } 0 s  #@ -6z=@i Kf r xq v lY }d B 4   h;Pa  @P NTD a6 o0@ p}I 0 @|t 0i P4  `1 l  X%/0N@U  ! H}_ -b iR rV4I h  0 pR  I;E W `$ @M ' /@ 8<Te4|C" H }$  ,5/ ;?@[7 HW T,pp w  hPܞt z  (1| : XtuPD  {`    !\ /z 9Fi},F `P` r P 7Pb >H0 Uy 0 p p- :XP *+@#`n -(8Q dB@ _l{` w H@ 9 . i T\5> : EC @B ^yPh   u  pI "  = P@..  %,`fN 7 N h& [z t PF L`(- @`   V;|( .IPcpa m8 <  ,D}HLD 0H0 `^ DY @| d () ԣ,؝G! T[b> m4  d}.. <6   5pD- XPp!@ Pl^<v H 6m 4 ]v } "Z )0,:p% B ^ g q z)  ) h 7 (# 1$ @< H pF  ' N 1 U 9  U \ h P| x   P# B$ }  А H ,!  ! ! i !!5 *!/!@=!Pi  G! U!Н ^!P i!  x!p}!P !z!ȣ!!!"Xm!0'" 1 2"`1 8">"LW"^" d"}}"% "P"p ""еa ""> "3 " #`n #@{ #`0 #W +#  1#`& >#F D#]#y##a #t##0^! #P ##0#Д#}# $3!P) @!$H&$V .$ģL$l$ | z$`# $j ` e01$ $ / $$$$p $($+ $В$< $H${ %{ %X<% E%$K%f% q%d%$ %0  z)%H%P %8%XM %E & !&0N (&5&<&($S "&@ \&DH !i&p&`z&8&&& &$&p] &&I &}&@E 6t &EM '5'% ',#'`b0 +' :'H)G'dT W'XP0 ^'ȝy''8M'ph 'D'2 '̣''б '0(}(.(`G(h R(<_( m(0y u(X(`(Јd (@ ((()05)@?)x)Y)gX f) n)Q z)\)0))T)Wf))**`E# -*?7*g= A* G*P*К ^*ht*$ ~*`< ***Pt+ **q *@Q *e #*$$0E + +P7+НR+l _++ ++ {+09 +@+`)  +&+0++ +0(n +f ,(,,4D,_,`g f,l6а q,} z,0 0, ,,`,4 ,(chg_caselesscrti.scrt1.ocrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptrfsr.strap_tablevalues-Xa.cDdata.dataBbss.bssDrodata.rodatamain.cscreen.cltget_envltgetflagltgetnumltgetstrtmodescheaperinc_costcountcostbeepclear_eol_botbrac.csearch.c_xmknodch_addbufbufferedinit_hashtblch_delbufscharset.cichardeficharsetilocalesetbinfmtset_charsetis_in_tablecmdbuf.ccmd_step_commoncmd_step_rightcmd_step_leftcmd_repaintcmd_leftcmd_homecmd_lshiftcmd_rshiftcmd_rightcmd_icharcmd_erasecmd_deletecmd_werasecmd_wdeletecmd_killcmd_updowncmd_editcmd_completecmd_istrdelimit_wordinit_complnext_complhistfile_namesave_mlistcommand.ccmd_execstart_mcamca_searchmca_opt_toggleexec_mcamulti_searchmca_charclear_buffersmake_displayat_promptcvt.cdecode.cexpand_special_keysadd_cmd_tableadd_var_tablecmd_searchecmd_decodegintold_lesskeynew_lesskeyedit.cclose_fileedit_istepedit_inextedit_iprevfilename.cmetacharsmetachardirfileseek_filesizereadfd.XAKk4DrdsWrMlqD.shellcmdforwback.ceof_bellhelp.cifile.cincr_indexunlink_ifilenew_ifilefind_ifileinput.cjump.cline.cexpand_linebufpshiftattr_swidthattr_ewidthpwidthbackcin_ansi_esc_seqstore_charstore_tabstore_prcharflush_mbc_bufdo_appendlinenum.ccalcgaplongloopmessagelongishabort_longlsystem.cmark.cgetumarkgetmarkoptfunc.coption.cproptoptstringflip_triplenostringnum_erroropttbl.cis_optcharos.coutput.ciprint_intiprint_linenumless_printfpattern.ccompile_pattern2matchposition.cprompt.cap_strap_charap_posap_linenumap_intap_questcurr_byteskipcondprotocharwherecharset_patternclear_patterninit_patternget_cvt_opsis_ucaseprev_patternis_hilited_rangeadd_hilitehilite_linehilite_screensearch_possearch_rangehist_patternsignal.cu_interrupttabstoptags.cmaketagentfindctagfindgtaggtagsearchctagsearchnextgtagprevgtaggetentryttyin.cversion.ccrtn.s_END__START_.XAKk4DresWrMl8D.tagliststep_charforw_prompt.XAKk4DrdsWrM1mD.costcountclr_filterinit_promptpipe_dataedit_firsttcsetattrbinary_char.XAKk4DrdsWrM1mD.sc_u_incat_file.XAKk4DrdsWrM1mD.sc_returnprevtagpr_expand__fpstartch_seekbackwardedit_prev__filbufpercent_posbo_e_width__ctypeprev_ifileseekable.XBKk4DresWrMVuD.forw.first_time.XAKk4DresWrMV6D.m_proto.XAKk4DresWrMl8D.totalshell_quote__flsbuf.XAKk4DresWrM1vD.anchorcleantagsclose_getchrclear_eol.XAKk4DresWrMF7D.search_info.XAKk4DresWrMFsD.cmdtablesigprocmask.XAKk4DresWrMl2D.follow_optnamedispversionsize_helpdata_get_exit_frame_monitorclosequotewait_messagewscrollfcloseget_quit_at_eofsc_height.XAKk4DrdsWrMFpD.comp_table.XAKk4DresWrMV6D.e_proto.XAKk4DresWrMFyD.columndel_ifilecmd_addhistfprintf.XAKk4DresWrMl2D.f_optnameknow_dumb.XAKk4DresWrMl2D.o_optname.XBKk4DresWrMV0D.getmark.smtwiddleiswupper.XAKk4DresWrMl2D.keypad_optnamech_forw_getget_meta_escape.XBKk4DrdsWrMFpD.prchar.buffsyncget_wcharopenedhold_ifilech_tell.XAKk4DresWrMl8D.curtagquietlseek64.XAKk4DresWrMl2D.w_optnamecurr_inoch_getflagssigsforw_raw_linejump_sline_fractionplusoptionopt_quotecharsetspositionintread.XAKk4DresWrMFyD.linebuf.XAKk4DresWrMl2D.P__optnameless_is_more.XAKk4DrdsWrM1pD.tk_tlistignaw.XAKk4DrdsWrM1mD.sc_s_in.XAKk4DrdsWrM1mD.sc_s_keypad.XAKk4DrdsWrM1mD.init_doneget_scrpos_environ__rem64.XAKk4DrdsWrMFpD.utfbinfmtis_composing_charcurrlinefd0is_utf8_well_formedget_time.XAKk4DrdsWrM1mD.sc_eol_clearbl_e_widthany_displayinit_textlistpostoa.XAKk4DresWrMl2D.option.XAKk4DresWrM1yD.freelist.XAKk4DrdsWrMlqD.mcanl_langinfoadd_lnumshift_count_fractioncmd_charwerase_char.XAKk4DrdsWrM1pD.tk_ipoint.XAKk4DresWrMl2D.g_optnameunmark.XAKk4DresWrMl2D.t_optnameempty_screenback_textlistautobufcalc_jump_sline.XAKk4DrdsWrM1mD.sc_bl_in.XAKk4DresWrMl2D.tilde_optname__environ_lockbin_filesave_curr_ifiletgoto.XAKk4DresWrMF7D.is_caseless.XAKk4DresWrMl2D.oldbot_optname.XAKk4DresWrMl2D.O__optnamefcomplete.XAKk4DresWrM1yD.sparereedit_ifilecvt_alloc_chpos_finiset_openlglobis_ansi_enduse_logfile.XAKk4DresWrMF7D.prep_startposch_close.XAKk4DrdsWrM1mD.sc_backspacetop_scrollnamelogfile.XAKk4DrdsWrM1mD.sc_u_outul_s_width.XAKk4DresWrMl2D.quote_optnametgetenteof_displayedch_flushsprintfjump_locso_e_width.XAKk4DrdsWrMVoD.ch_ungotcharerrno_messageset_attnpospr_stringstrerror_etextset_filestate.XAKk4DresWrMl2D.d_optnameclr_linenumputbsch_initjump_line_locno_back_scrollclose_altfile.XAKk4DrdsWrMlqD.save_hshiftstart_attnpos.XAKk4DrdsWrMlqD.ungotsingle_char_optionpercentageinit_option.XAKk4DrdsWrM1pD.curr_cmdflagsjump_backtoggle_optionpopenunsave_ifileadd_hometable.XAKk4DresWrMV6D.mp.XAKk4DrdsWrM1mD.sc_b_outopt__Ostrcatforce_logfileopt__Pinit_cmdhistprewindopt__Tuncompile_patternopt__Vlgetenvgetfractionspecial_key_strmlist_shellsetlocale.XAKk4DresWrMF7D.filter_anchorfilenoch_lengthinit_cmdscommands.XAKk4DresWrMV6D.s_protoadjslineget_pos.XBKk4DrdsWrMFpD.prutfchar.buftowlowerclear_botlinenumtoaregfreeis_combining_charis_ubin_char.XAKk4DresWrMF7D.hilite_anchorfexpandfindtagget_term.XAKk4DresWrMFyD.overstrike__fsr_init_value.XAKk4DresWrMl2D.m_optnamepr_typech_setbufspace.XAKk4DrdsWrMFpD.ubin_table.XAKk4DrdsWrM1pD.tk_trial.XAKk4DresWrMFyD.last_overstrikereadingedit_next.XAKk4DrdsWrM1mD.sc_padend_logfilelsystemsquishedvbellabsbad_fileempty_lines.XAKk4DresWrMl5D.table_sizegomark.XAKk4DresWrMF7D.filter_info.XAKk4DresWrMl2D.u_optnamesetjmp.XAKk4DresWrMF4D.ob.XBKk4DresWrMF4D.error.return_to_continuejump_forwinit_signals.XBKk4DrdsWrM1mD.special_key_str.tbufplinenum__1cG__CrunMdo_exit_code6F_v_.XAKk4DrdsWrM1pD.tk_original.XAKk4DrdsWrMlqD.bottompospflushmbcpos_clear_DYNAMICsigemptysetprproto.XAKk4DrdsWrM1mD.sc_initput_wchar.XAKk4DresWrMFsD.list_var_tables.XAKk4DrdsWrMFpD.wide_tableshell_coptioninit_linesize_linebuf.XAKk4DrdsWrM1pD.cmd_mbc_buf_index.XAKk4DrdsWrM1mD.attrmode.XAKk4DrdsWrMFpD.chardef.XAKk4DresWrMF4D.obuf.XAKk4DresWrM1vD.ifiles__div64strncpyeditor.XAKk4DrdsWrMlqD.numbernew_fileungetccadd_forw_posch_beg_seek.XAKk4DrdsWrM1mD.sc_deinitntabstopssync_logfile.XAKk4DresWrMl2D.pound_optnamecalc_shift_countget_cmdbuf_startsqueezesprefixset_mlist.XAKk4DresWrMl2D.J__optname.XAKk4DresWrMV6D.h_proto.XAKk4DresWrMl2D.e_optnamestrchr.XAKk4DresWrMl2D.r_optnameback_lineforce_openpipe_mark.XAKk4DrdsWrMlqD.search_type.XAKk4DrdsWrM1pD.tk_textml_search.XAKk4DresWrMFsD.edittablecheck_winchstrncmpforw_textlistch_ungetcharheld_ifile.XAKk4DrdsWrM1pD.cmdbuffinal_attr.XAKk4DrdsWrM1pD.literal.XAKk4DresWrMFsD.list_ecmd_tablessavematch_brac.XAKk4DrdsWrMlqD.optflag.XAKk4DresWrMl2D.z_optnameget_indexput_line_PROCEDURE_LINKAGE_TABLE_jump_percentgettagtypepappend.XAKk4DrdsWrM1mD.sc_lower_left.XAKk4DresWrM1yD.startimeadd_ecmd_tabletcgetattrlongjmpcfgetospeednext_ifile.XAKk4DresWrMl5D.tableget_filename.XAKk4DresWrMl2D.query_optnameclear_attn.XAKk4DrdsWrMlqD.pipecclr_hlistcmd_reseterrmsgsopen_getchr.XAKk4DresWrMFyD.is_null_linefchmodfind_posch_get.XAKk4DresWrMV6D.more_protomemcpyfollow_modegline.XAKk4DresWrMl2D.b_optname.XAKk4DresWrMl8D.circularopt_shift.XAKk4DresWrM11D.pendopt.XAKk4DresWrMFyD.mbc_buf_indexutf_modeno_initcs_aliaseshomefileshell_unquoteul_e_widthedit_indexedit_listlastmarkireadcvt_length.XAKk4DrdsWrM1mD.sc_s_out.XAKk4DresWrMl2D.j_optnameis_wide_charstrcmphprotoget_return.XAKk4DrdsWrM1pD.curr_mlisteq_message___Argvadd_fcmd_tablequitting.XBKk4DresWrM11D.propt.bufin_mcach_end_seekctldispquit_if_one_screenfstat64.XAKk4DresWrMl2D.V__optname.XAKk4DresWrMF4D.intr_to_abortis_null_patternmlist_examine.XAKk4DresWrMl8D.curseq.XAKk4DrdsWrM1mD.sc_e_keypadskipspeditchar.XAKk4DresWrMl2D.k_optnametabdefaultentire_file_displayed.XBKk4DrdsWrM1mD.raw_mode.curr_oncreat64.XAKk4DrdsWrMlqD.optcharis_diroldbotbelow_membadmark.XAKk4DrdsWrMFpD.comb_tableadd_lineprutfcharlinenumsml_shellch_back_getatexitml_examine.XAKk4DresWrMF7D.hide_hiliteedit_tagfilekill_charclear_cmdfcmd_decodemain.XAKk4DresWrMl2D.s_optnameopt_promptcurr_altfilenameat_switchsetmark.XAKk4DresWrMl2D.L__optnamestrcpyerase2_char.XAKk4DrdsWrM1pD.cpdohelpstrstrget_swindowchg_hiliteedit_lastevery_first_cmd.XAKk4DresWrMFyD.attrisattycurr_dev.XAKk4DresWrMFyD.mid_ansi_charsline_leftcmd_intget_filestatepsignalsatoican_goto_lineforw_linematch_patternraw_modeclr_hiliteset_status_col__longdouble_usedpos_init_GLOBAL_OFFSET_TABLE_.XAKk4DrdsWrM1mD.sc_clearregcomp.XAKk4DrdsWrMlqD.ungotp.XAKk4DresWrMFsD.list_fcmd_tables.XBKk4DrdsWrMFmD.quit.save_statuscmd_acceptopt_bfgetc.XAKk4DresWrMFyD.lmarginwprotowrite.XAKk4DrdsWrMVoD.maxbufsopt_i.XAKk4DresWrMV0D.marks.XAKk4DresWrM1yD.anchor.XAKk4DresWrMl2D.c_optnameopt_jstrlenopt_kis_filtering.XAKk4DresWrMl2D.p_optnameopt_lmarkposscrsizeopen_altfileopt_ocontrol_charopt_p.XAKk4DrdsWrM1mD.sc_home.XAKk4DresWrMl2D.K__optnamebo_s_widthputchrhow_searchfgetssquish_checkopt_t.XAKk4DresWrMl2D.X__optnamebinattrregexec.XBKk4DrdsWrMVoD.end_logfile.triedopt_x.XAKk4DrdsWrM1mD.sc_addline__iobnexttag.XAKk4DrdsWrM1mD.sc_eos_clear.XAKk4DrdsWrM1mD.sc_visual_bellis_ascii_charinit_search.XAKk4DresWrMl2D.F__optnameauto_wrapecallocbs_modeat_exit.XAKk4DresWrMF7D.prep_endposcmd_putstrsnprintftagoption.XAKk4DresWrMl2D.x_optname__fsr.XAKk4DrdsWrM1pD.cmd_offsetcurr_tagerrno.XAKk4DrdsWrM1mD.sc_bl_outis_hilited.XAKk4DrdsWrM1pD.prompt_colscan_optioninitial_scrpos.XAKk4DresWrMFyD.pendcquit.XAKk4DresWrMFyD.cshift.XAKk4DresWrMFyD.pendposapply_at_specials.XAKk4DrdsWrMVoD.thisfileierroruse_lessopengetpid.XAKk4DresWrMFyD.end_ansi_charsmlist_searchsecureno_keypad.XAKk4DrdsWrM1pD.in_completiontputsfopen64pshift_allclear_bgundo_search.XAKk4DrdsWrM1mD.hardcopyungetscmissing_capinit_markedit_stdinsc_widthis_ttyneed_clrforwardrepaint_hilite_lib_versionget_back_scroll_edata.XAKk4DresWrMl2D.h_optnamepclose.XAKk4DresWrMl2D.q_optnamestore_poscmd_lastpattern.XAKk4DrdsWrM1mD.sc_moveforw_scrollat_enter.XAKk4DresWrMF7D.is_ucase_patternend_attnpos.XAKk4DrdsWrM1pD.cmd_mbc_buf.XAKk4DresWrMFyD.mbc_poslen_cmdbufquit_on_intrhilite_searchfindopt.XAKk4DresWrMV6D.w_proto.XAKk4DresWrMl2D.T__optnameis_ansi_middle.XAKk4DresWrMl2D.y_optnamebl_s_width.XAKk4DresWrMl2D.B__optname.XAKk4DresWrMFsD.list_sysvar_tables.XAKk4DresWrMFyD.curropenquote.XAKk4DrdsWrMlqD.fractiongetoff_ifileutf_lenprep_hilitechoplinesignal.XBKk4DrdsWrM1mD.get_term.sbuf.XAKk4DrdsWrM1pD.cmd_col.XAKk4DresWrMV6D.M_protoshow_attn.XAKk4DresWrMl2D.a_optname.XAKk4DresWrM1yD.loopcountreopen_curr_ifileeditprotoget_ifilepdoneprognameback_raw_line.XAKk4DresWrM1yD.poolnopendoptis_at_equivdup.XAKk4DresWrMFyD.mbc_buf_len.XAKk4DresWrMFyD.mbc_bufioctlsave_cmdhistset_filter_patternis_filtered.XAKk4DresWrM1sD.curr_altpipeinttoa.XAKk4DresWrMl2D.S__optname.XAKk4DresWrMl2D.i_optnameinit_charset.XAKk4DrdsWrMlqD.optgetnameopt_queryabove_memisoptpendingPCcvt_text.XAKk4DrdsWrM1mD.sc_b_in.XAKk4DresWrMl2D.q2_optnameso_s_widthscreen_trashedsleepadd_back_pos.XBKk4DresWrMltD.metachars.mchars.XAKk4DrdsWrMFpD.binfmt.XAKk4DresWrMl2D.n_optnamenifileignore_eoionscreenfind_linenumfindopt_nameeqproto.XAKk4DrdsWrM1pD.cmd_mbc_buf_len.XAKk4DresWrMV6D.message.XAKk4DresWrMV3D.read_label%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03acomp: Sun C 5.10 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ld: Software Generation Utilities - Solaris Link Editors: 5.11-1.1689main.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g main.c -W0,-xp.XAKk4DrdsWrMFmD.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DrdsWrMFmD.;backend;raw;cd;DBG_GEN 5.2.7char*every_first_cmd2}voidVcurr_ifile^}old_ifile^}intany_display}long longPOSITIONstart_attnpos}end_attnpos}logfile&}force_logfile'}namelogfile2(}mainG@|UargcDargvD ifile^Hs2I MЙ h hfilename22 save,U27 2s* p2- ecalloc<U^ count9 size9 p^=unsigned skipspN hU2 2sL sprefix^pJUQ 2psZ 2sZ uppercaseZ c_ sc` lena quit}PϝU status{ save_status~Xeditproto2-editor2,less_is_more#Ddohelp"xsecure!quitting <progname2wscrollTscrpos }pos#ln#initial_scrposW0is_ttynew_filePclose_getchropen_getchredit_tagfiletagsearchfindtaginit_signalsinit_searchinit_prompterrorflushinit_optionget_quit_at_eofnopendoptisoptpendingscan_optioninit_markinit_lineget_ifile^nifileprev_ifile^shell_quote2cat_fileedit_stdinedit_nextedit_firsteditlgetenv2init_cmdscommandssave_cmdhistinit_cmdhistinit_charsetclear_botdeinitinitget_termraw_mode* size_tstrlen>*>strcpy2g2C*g*qstrcmplvmkstemps642mkstemp642mkstemps642mkstemp64 2exit. calloc^M longM M Z tm$ tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst# d  __wcsftime_xpg59 U _  wchar_t9 9 I D __wcstok_xpg5D  D N S M wint_t__putwchar_xpg5   unsigned char __FILE _cnt#_ptr #_base #_flag # _magic # __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#   __putwc_xpg5    __getwchar_xpg5 __getwc_xpg5   __ungetwc_xpg5 0   M 0  __fputws_xpg5e 5 : __fputwc_xpg5     __fgetws_xpg5D  D  __fgetwc_xpg5   lockf64 * truncate64.  off64_ttell64. V ssize_tVd pwrite64V  V i Vpread64V  V  lseek64.  . ftruncate64*truncate64>off_ttell64>dVdpwrite64V V ipread64V V  lseek64>>lockf64 isatty'ftruncate64K*K*Uattropen64PZ*openat64posix_fallocate64posix_fadvise64*unsigned longcreat64U$*Uopen64Z**attropen64*openat64posix_fallocate64posix_fadvise64N*Ncreat64xS$*xopen64} ftello64. fseeko64: fsetpos64: fgetpos64<:  FILE<tmpfile64G*_*ifreopen64GdnG**fopen64G ftello64>fseeko64: fsetpos64A: fgetpos64c: *c*mfreopen64GhrG**fopen64Gtmpfile64GYuscreen.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g screen.c -W0,-xp.XAKk4DrdsWrM1mD.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DrdsWrM1mD.;backend;raw;cd;DBG_GEN 5.2.7intinit_done.}missing_cap.}attrmode.}raw_modeНU'.oncurr_on.}{sw save_termw \saved_term. } Cunsigned 'tcflag_tunsigned char Bcc_tlong Sw ^ termios$c_iflag3#c_oflag3#c_cflag3#c_lflag3# c_ccf#ltget_envpUcapnamennameqsrenv next#name#value#envsx}pychar  ^Kltgetflag U. capnamestgetflag.ltgetnumU.wcapnamestgetnum.ltgetstrTUcapnamepp sscrsize`Udssys_height.sys_width.n.swvunsigned short winsizews_rowd#ws_cold#ws_xpixeld#ws_ypixeld#special_key_struU:.keystbuf:vswsp (K ^'get_term!@Usp`t1at2atermbtermbufcsbufevtgetent.^$^inc_costcountK,U.X.cIcostS0dU.tQtputs.cheaperbpUt1_t2_ def_tmodeszUyincaproutcapr instrroutstrrdef_instrrdef_outstrrsppr initIU=66i.deinit#PUhome>گUadd_lineMUlower_leftUline_left, :Ucheck_winchL@EUgoto_linekPyU .slinenumivbellUbeepUbell аUclearUclear_eol(*Uclear_eol_botc0kUclear_bottp±U saved_attrmode.at_enterбnU .attrat_exitpUat_switch^U5 .attrnew_attrmode.ignore_modes.is_at_equiv`U.} .attr1.attr2 apply_at_specialsU. .attrputbs%  Ucostcount.Ehardcopy.ktgototgetstrclear_bg.$can_goto_line.@below_mem.,above_mem.bl_e_width.$bl_s_width.so_e_width. so_s_width.ul_e_width.ul_s_width.bo_e_width.(bo_s_width.sc_height.Tsc_width.werase_char.kill_char.(erase2_char.erase_char.ignaw.auto_wrap.sc_deinitsc_initsc_e_keypadsc_s_keypadsc_backspacesc_visual_bellsc_bl_outsc_bl_insc_b_outsc_b_insc_u_outܣsc_u_inأsc_s_outԣsc_s_inУsc_eos_clearģsc_eol_clearsc_clearȣsc_movẹsc_returnsc_lower_leftsc_addlinesc_homesc_padwItcsetattr.z..Nwtcgetattr..zw 'speed_tcfgetospeedpos_initputchr.lgetenvvoidecalloc save. 'size_tstrlen8_3_strcpydstrcmp.strcatmkstemps64..mkstemp64.$mkstemps64.G.mkstemp64.ddatoi.i^^ tm$.tm_sec.#tm_min.#tm_hour.#tm_mday.# tm_mon.#tm_year.#tm_wday.#tm_yday.#tm_isdst.# .__wcsftime_xpg58j83wchar_tjjzu__wcstok_xpg5uu ^wint_t__putwchar_xpg5B __FILE_cnt.#_ptr#_base#_flagB# _magicB# __orientation'# __ionolock'#  __seekable'#  __extendedfd'#  __xf_nocheck'#  __filler'#  __putwc_xpg5__getwchar_xpg5__getwc_xpg5)__ungetwc_xpg5P^P__fputws_xpg5.UZ__fputwc_xpg5__fgetws_xpg5uu.__fgetwc_xpg5long longlockf64.....truncate64.[3 off64_ttell64[. .ssize_tpwrite64'pread64'lseek64[.[.ftruncate64.>.>truncate64.kC off_ttell64k.pwrite64'pread64'lseek64k.k.lockf64.:..ioctl.Y..ftruncate64.}.fsync..attropen64..openat64...posix_fallocate64.3.posix_fadvise64.e..eunsigned longcreat64.joopen64..attropen64..openat64.8. .posix_fallocate64.g.posix_fadvise64...creat64.oopen64..ftello64[fseeko64.4Z.4fsetpos64.`Z9fgetpos64.Z` FILEtmpfile64freopen64fopen64ftello64k:fseeko64.`Z.`fsetpos64.Zefgetpos64.Z`sprintf.freopen64fopen64H#tmpfile64 Ibrac.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g brac.c -W0,-xp.XAKk4DrdsWrMlnD.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DrdsWrMlnD.;backend;raw;cd;DBG_GEN 5.2.7#match_brac!Uobraccbrac forwdirnc"nest#pos$chget&%ch_back_getch_forw_getintlong longPOSITION position error jump_line_locch_back_getch_forw_getch_tellch_seekchar  mkstemps64   mkstemp64  mkstemps64   mkstemp64- long -unsigned:size_t - Stm$tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst# ]  __wcsftime_xpg5F2 5 F X wchar_t 2 2 B = __wcstok_xpg5=| = G L-wint_t __putwchar_xpg5| |unsigned char __FILE_cnt#_ptr#_base#_flag# _magic# __orientation:# __ionolock:#  __seekable:#  __extendedfd:#  __xf_nocheck:#  __filler:#   __putwc_xpg5| | __getwchar_xpg5| __getwc_xpg5|  __ungetwc_xpg5|) |  - )  __fputws_xpg5^ . 3 __fputwc_xpg5| |   __fgetws_xpg5= =   __fgetwc_xpg5|  lockf64      truncate64'  off64_t tell64'O ssize_tvoid ] e pwrite64O O j :  ] pread64O O  :  lseek64'  '  ftruncate64     truncate64?  off_t tell64?e  ] e pwrite64O O j :  pread64O O  :  lseek64?  ?  lockf64    ftruncate642    2  < attropen64o 7 A   o openat64  t  posix_fallocate64    posix_fadvise64       unsigned long creat64<   < open64f A   f  p attropen64 k u   openat64   posix_fallocate64    posix_fadvise645      5 creat64_ :  _ open64 d   ftello64' fseeko64 3    fsetpos64 3  fgetpos64# 3 FILE # tmpfile64.   F  P freopen64.  K U .   fopen64.   ftello64? fseeko64 3    fsetpos64( 3  fgetpos64J 3  J  T freopen64.  O Y .   fopen64.  tmpfile64. @ch.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g ch.c -W0,-xp.XAKk4DrdsWrMVoD.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DrdsWrMVoD.;backend;raw;cd;DBG_GEN 5.2.7mknodUtt_path_mode _devintchar{unsigned longmode_tdev_tch_ungotchart}}maxbufst~} ch_getUt;bpbnntsleptthtpos"len"    Ի "Ի "Ի "C *C *C parg7 VԻ `Ի `Ի stJ rtK bufnode next# prev# hnext# hprev# ;long longBLOCKNUMunsignedunsigned charlong buf  node;# block# datasize# data#POSITION{LINENUMparg p_string1# p_intt# p_linenum6#DPARG unsigned long longino_tnlink_tuid_tgid_toff_ttime_ttimespec@ tv_sec# tv_nsec#timestruc_tblksize_tblkcnt_t{ stat st_dev# st_pad1# st_ino# st_mode# st_nlink# st_uid# st_gid#$ st_rdev#( st_pad2#, st_size#4 st_atim@#< st_mtim@#D st_ctim@#L st_blksizeR#T st_blocksb#X st_fstypeq#` st_pad4#pch_ungetchar}>Utc{end_logfile@U triedt}sync_logfile U bp bn warnedt block nblocks 7 Z Z wrotetbuffered UtHblock bp bn htch_seek{Ut"pos new_block len"ch_end_seekFUt len"ch_beg_seek"PUt2 bn# firstbn$ch_lengthB U"ch_tellQ,U"ch_forw_get\0Ut ct]ch_back_getsUtch_setbufspace6U tbufspacech_flush@U2 bnch_addbufUt{ bp bninit_hashtbl@U htch_delbufs@U bnseekableUt tfch_init/UN tf,tflags, ch_closeVWU keepstatetWch_getflags`Ut; ?filestate8T buflist;# hashtbl # filet# flagst# fpos"# nbufst# block# offset# fsize"# thisfileT | ignore_eoit lt{ _xmknodt   { lstat64t   { stat64t   fstat64t; t {; fstatat64tq t@  t{q  ino64_t off64_tblkcnt64_t{  stat64 st_dev# st_pad1{ # st_ino # st_mode# st_nlink# st_uid# st_gid#$ st_rdev#( st_pad2 #, st_size #4 st_atim@#< st_mtim@#D st_ctim@#L st_blksizeR#T st_blocks #X st_fstype #` st_pad4 #p fstatat64t@tv t{@lstat64tjE{jstat64tofstat64ttwait_message1 ierror errorireadt set_filestatevoidget_filestateget_filename1filesize" clear_eolmkstemps64tw1tmkstemp64t1mkstemps64t1tmkstemp64t1!freecallocsize_ttm$ tm_sect# tm_mint# tm_hourt# tm_mdayt# tm_mont# tm_yeart# tm_wdayt# tm_ydayt# tm_isdstt# #__wcsftime_xpg5  wchar_t__wcstok_xpg5B wint_t__putwchar_xpg5BrB__FILE T _cntt# _ptrr# _baser# _flag# _magic# "__orientation# "__ionolock#  "__seekable#  "__extendedfd#  "__xf_nocheck#  "__filler#  w__putwc_xpg5B~BT#__getwchar_xpg5B__getwc_xpg5BT__ungetwc_xpg5BBTw__fputws_xpg5t__fputwc_xpg5B9BTw__fgetws_xpg5it9__fgetwc_xpg5BTlockf64ttt{truncate64ttell64 ttssize_tpwrite649 pread64h9lseek64 t tftruncate64ttwrite{truncate64t tell64%tsleep>>pwrite64sCpread649lseek64ttlockf64tttftruncate64t tcloset$t{${.attropen64ta)3t${aopenat64ttft$posix_fallocate64ttposix_fadvise64ttt{creat64t{open64tG"t${G{Qattropen64tLVt${openat64ttt$posix_fallocate64ttposix_fadvise64ttt{creat64t@{@open64tjEt$wftello64 jfseeko64ttfsetpos64tfgetpos64twFILE #tmpfile64{'{1freopen64b,6{b{lfopen64gqwftello64fseeko64ttfsetpos64t fgetpos64t+{+{5freopen64f0:{f{pfopen64ku#tmpfile64%lseek64&lseek'stat64&statfcharset.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g charset.c -W0,-xp.XAKk4DrdsWrMFpD.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DrdsWrMFpD.;backend;raw;cd;DBG_GEN 5.2.7!intutf_mode0,charO0charset nameW#p_flag\#descW#longacharsets$0cs_aliasnameW#onameW# H(cs_aliasesB} binfmtWr4 utfbinfmtWs8binattr0t0 ichardefU Ws cpW n0 vO icharset 7U0' Wname 0no_error p' a,a ilocale@U^ c0setbinfmt(U Ws fmtvarptr Wdefault_fmt333tWWset_charset00UsW1init_charsetw UPsWxbinary_charTU0cunsigned longLWCHARcontrol_char`U0cprcharsUWcbufO 'prutfcharUWchbuf0$$\\len0O utf_lenXU0Ochis_utf8_well_formed`oU0si0len0$$$mask%unsigned charget_wchar7pUWp5put_wcharl )Uppichi step_char0Uppdir Wlimitchlen0pWsigned intwchar_rangefirst#last#comp_table< @!comp_table<Jcomb_table; ucomb_tabledubin_table/| ubin_table/|wide_table; wide_table ;is_in_tableL$U0 chH tableH 0tsizeHhi0Mlo0Nmid0Wis_composing_chari0TU0% chgis_ubin_chars`U0Z chqis_wide_char}U0 ch{is_combining_charU0 ch1ch2 i0 O  chardef qnl_langinfoW3 0O3 setlocaleW_ 08 errorlgetenvWquitO O strstrW   O strchrW  0O strcpyW W O O strcmp0:   mkstemps640] W0mkstemp640z Wmkstemps640 W0mkstemp640 Wunsigned size_t tm${ tm_sec0#tm_min0#tm_hour0#tm_mday0# tm_mon0#tm_year0#tm_wday0#tm_yday0#tm_isdst0#  { __wcsftime_xpg5      wchar_t    __wcstok_xpg5    wint_t__putwchar_xpg51__FILE_cnt0#_ptr#_base#_flag# _magic# __orientation # __ionolock #  __seekable #  __extendedfd #  __xf_nocheck #  __filler #  1__putwc_xpg58 __getwchar_xpg5__getwc_xpg5q__ungetwc_xpg51__fputws_xpg50__fputwc_xpg51__fgetws_xpg5 # 0__fgetwc_xpg5Dlong longlockf640v00DOvtruncate640{DDoff64_ttell6400ssize_tvoidpwrite64 Dpread64E Dlseek64j00ftruncate6400DOtruncate640DDoff_ttell640pwrite64 Dpread64@ Dlseek64e00lockf64000Dftruncate6400DOOattropen6400!Oopenat64000!posix_fallocate640K0DDposix_fadvise640}0DD0O}creat640Oopen6400!OOattropen6400!Oopenat640?00!posix_fallocate640n0DDposix_fadvise6400DD0Ocreat640Oopen6400!1ftello64fseeko640;D0D;fsetpos640g@Dfgetpos640g1FILE tmpfile64OOfreopen64OOfopen64 1ftello64A fseeko640gD0Ogsnprintf0W l!Dfsetpos640fgetpos640gOOfreopen64!O!O+fopen64U&0 tmpfile64(xcmdbuf.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g cmdbuf.c -W0,-xp.XAKk4DrdsWrM1pD.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DrdsWrM1pD.;backend;raw;cd;DBG_GEN 5.2.7+mknod HU||_path_mode _devintcharunsigned longmode_tdev_tin_completion|'8 openquote3@ closequote4< mliste nexte# preve# curr_mpe# stringj# modified|# mlist_searchMDvoid ml_searchO) mlist_examineQl ml_examineS) mlist_shellVX ml_shell X)curr_mlistei4 cmd_resetvPU clear_cmdU cmd_putstrUZjsprev_chZchZendlinejnsjSxxwidth|LWCHARlen_cmdbufhU|sjendlinejlen|cmd_step_commonp-Uj;jpZch |len;pwidth;bswidthprjv"~~len|""""""<"<"OOlen|""prev_chZ|cmd_step_right0Ujpp;pwidth ;bswidthpjchZjcmd_step_leftUjDpp;pwidth ;bswidthpjchZcmd_repaint"U+jold_cp i [ [npj)width|*prj+iwwnpj4width|5prj6cmd_homeJoU]PPwidth|Mbswidth|Mcmd_lshift]p\Uo sj^save_cpj_cols|`width|j2&&width|pnsjqcmd_rshift`U sjsave_cpjcols|{width|cmd_right U|b prjncpjwidth|cmd_leftU| ncpjwidth|bswidth|cmd_icharU| jcs|clen sjcmd_erasexU|c sjclen|cmd_delete6U|cmd_weraseIaU|cmd_wdeletecpU|cmd_kill}lU|set_mlistpU# mlist|cmdflags cmd_updownhU|k |actionsjcmd_addhistpU emlistjcmd mlecmd_accept QUcmd_edit`U|8 |caction|flags|cmd_istr\U| jstrsjaction|endlinejPDDosjdelimit_word`TUjwordjpjdelim_quoted|meta_quoted|escjesclen|init_compl`Uwordjc88qwordjnext_compl2UjM|action/jprev/ cmd_completeGU||actionEsjHcmd_charU||caction|len|cmd_intUi\fracpjnierr|long long\LINENUMlongwget_cmdbufUjcmd_lastpattern"Ujhistfile_name/%Uj.homej0namej1len|2init_cmdhistT0*UmleVlineWfilenamejXfYpjZwunsigned charunsigned__FILE _cnt|# _ptr# _base# _flag# _magic# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  FILEsave_mlist0UPemlf histsize|n|sjsave_cmdhistqUfilenamejfmodified|do_chmod|statbuf r|w wunsigned long longino_tnlink_tuid_tgid_twnw\off_twtime_ttimespec tv_secz# tv_nsecw#timestruc_twblksize_t\blkcnt_tww wstat+ st_dev# st_pad1# st_ino+# st_mode# st_nlink7# st_uidE# st_gidQ#$ st_rdev#( st_pad2]#, st_sizen#4 st_atim#< st_mtim#D st_ctim#L st_blksize#T st_blocks#X st_fstype#` st_pad4#pcmd_mbc_buf_index|ncmd_mbc_buf_len|m`zwcmd_mbc_bufilcurr_cmdflags|jhtextlist stringj# endstringj#tk_tlist,xtk_trialj+tk_ipointj*ptk_originalj)ttk_textj(lliteral| \cmd_offset|XcpjPprompt_col|dcmd_col|TwcmdbufT| _xmknod|(!!!!(  lstat64|W!-!2W stat64|!\!2 fstat64|!|!2 fstatat64|!|!!2!|w wino64_tww\off64_t\blkcnt64_t@ww Qwstat64t st_dev# st_pad1# st_ino# st_mode# st_nlink7# st_uidE# st_gidQ#$ st_rdev#( st_pad2#, st_size#4 st_atim#< st_mtim#D st_ctim#L st_blksize#T st_blocks#X st_fstype/#` st_pad4@#pQ fstatat64|!|!!t!| lstat64|!!t stat64|!!t fstat64|!|!t fchmod|7!|!"putstr#putchr|#getfractionw#is_dir|#fcompletej#shell_quotej#get_meta_escapej#back_textlistj#forw_textlistj"init_textlist#editchar|#lgetenvj#in_mca|#is_combining_char|#is_wide_char|#is_ubin_char|#is_composing_char|#step_charZ#is_utf8_well_formed|#utf_len|#prutfcharj#prcharj"putbs"clear_eol"bell#ecalloc#savej strncpyjJ!j! !JT strncmp|!O!Y!size_t strlen! strcpyj!j! strcmp|!! mkstemps64|3!j!| mkstemp64|P!j mkstemps64|s!j!| mkstemp64|!j$free! atoi|!wwtm$ n tm_sec|# tm_min|# tm_hour|# tm_mday|# tm_mon|# tm_year|# tm_wday|# tm_yday|# tm_isdst|# n __wcsftime_xpg5!!!!swchar_t __wcstok_xpg5!!!wwint_t __putwchar_xpg5$ ! __putwc_xpg5N !!$ %__getwchar_xpg5 __getwc_xpg5 !$ __ungetwc_xpg5 !!$ w  __fputws_xpg5| ! ! __fputwc_xpg5 !!!$  __fgetws_xpg59!!!|! ! __fgetwc_xpg5Z!!$ lockf64|!!|!|!\! truncate64|!!!!\ tell64!!||ssize_t! pwrite64! "!!!!!!\ pread64!8"!!! "!!\ lseek64]"!|!!| ftruncate64|"!|!\" truncate64|"!"!\ tell64n"!|" pwrite64!"!!!"!!\ pread64!'#!!! "!!\ lseek64nL#!|!n!| lockf64|q#!|!|!\ ftruncate64|#!|!\## attropen64|#!#!#!|&# openat64|$!|!#!|& posix_fallocate64|2$!|!\!\ posix_fadvise64|d$!|!\!\!|d$ creat64|$!i$!$ open64|$!$!|&$$ attropen64|$!$!$!|&$ openat64|&%!|!$!|& posix_fallocate64|U%!|!\!\ posix_fadvise64|%!|!\!\!|% creat64|%!%!% open64|%!%!|& ftello64%!% fseeko64|"&! !\!|\"& fsetpos64|N&! !'&\ fgetpos64|u&! !N&%tmpfile64&& freopen64&!&!&!&& fopen64&!&!& ftello64n'!& fseeko64|>'! !\!| fileno|X'! X' snprintf|'!j!!]'&\' fsetpos64|'! !' fgetpos64|'! !N& fgetsj'!j!|! ' fprintf|%(! !'&%(/( freopen64`(!*(!4(!`(j( fopen64(!e(!o( fclose|(! %tmpfile64'fopen64(((fopen)fstat64((fstat command.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g command.c -W0,-xp.XAKk4DrdsWrMlqD.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DrdsWrMlqD.;backend;raw;cd;DBG_GEN 5.2.7;Bchar0ungotp8;shellcmd8=cmd_execUUstart_mcafUactiona8prompta mlistacmdflagsaintvoidin_mcapUmca_searchy eUmca_opt_togglepGUno_promptflagdash8exec_mcaPUcbuf8 mca_char dU c p8! flag" buf# parg*$             o oname8 lclong 0long longLINENUMparg*p_string8#p_int#p_linenum#PARG:optnamefoname8#onext5#k 8 loption$oletter0#onames5#otype#odefault# ovarf#ofuncm#odescr#clear_buffersDpUmake_displayS]U [ [ [ [ [ save_top_scrolle save_ignore_eoifprompt{`U p8|dispversionU parg*getccUungetcc U\ c ungetscIU 8s p8multi_search-PU* 8pattern* n* nomore. save_ifile/ changed_file0commands(U c action cbuf8 newaction save_search_type extra8 tbuf parg* old_ifile new_ifile tagfile8 ( ' ' Q' X' X' !" !" !" pos t"" "" "" pos 0POSITIONpipec0Isave_hshiftG bottomposFoptgetnameEoptflagDoptchar0CfractionBnumberAsearch_type@mca? 0d cungot :getchrntagsprevtag8nexttag8tagsearchcleantagspsignalsis_filteringset_filter_patternsearchclr_hiliteundo_searchclear_attnpr_string8eq_message8pr_expand8empty_screenpositionerrorputstrputchrflushfindopt_nameget_quit_at_eofopt_prompt8single_char_optiontoggle_optionget_swindowgomarksetmarkbadmarkpipe_marklsystemclr_linenumjump_locjump_line_locjump_percentrepaintjump_backjump_forwset_attnposget_filename8getoff_ifilenext_ifiledel_ifilebackwardforwardentire_file_displayedeof_displayedfexpand8reopen_curr_ifilereedit_ifileunsave_ifilesave_curr_ifileedit_indexedit_prevedit_nextedit_lastedit_firstedit_listedit_ifileediteditcharfcmd_decodeget_cmdbuf8cmd_intcmd_charcmd_acceptset_mlistlen_cmdbufcmd_putstrclear_cmdcmd_resetch_getflagsch_flushmatch_bracat_exitat_enterclear_botclear_eolbellcheck_winchquitsave80unsignedsize_tstrlen00strcmpmkstemps648mkstemp6408mkstemps64S8mkstemp64p8freetm$,tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst# ,__wcsftime_xpg5h1wchar_thhxs__wcstok_xpg5ss}wint_t__putwchar_xpg5unsigned char__FILE_cnt#_ptr#_base#_flag# _magic# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  __putwc_xpg5__getwchar_xpg5__getwc_xpg58__ungetwc_xpg5____fputws_xpg5di__fputwc_xpg5__fgetws_xpg5ss__fgetwc_xpg5 lockf64000truncate64]5off64_ttell64]ssize_tpwrite64pread64lseek64]]ftruncate64@0@truncate64mEoff_ttell64mpwrite64pread64lseek64mmlockf64<ftruncate64`0`0jattropen64eo 0openat64 posix_fallocate64posix_fadvise64/0/unsigned longcreat64j490jopen64o 00attropen64 0openat64 posix_fallocate641posix_fadvise64c0ccreat64h90open64 ftello64]fseeko64ifsetpos64*ifgetpos64Qi*FILEQtmpfile64\0t0~freopen64\y\00fopen64\ftello64mfseeko64*i*fsetpos64Vi/fgetpos64xi*0x0freopen64\}\00fopen64\tmpfile64\ cvt.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g cvt.c -W0,-xp.XAKk4DresWrMVrD.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DresWrMVrD.;backend;raw;cd;DBG_GEN 5.2.7zZcvt_length( )Uhhhlenhops intcvt_alloc_chpos,)])Uhlen*ih-chpos.hcvt_textA`)j+Uodst;osrc; chpos;lenp;hops;dstBsrcCsrc_endDchE) +)*)*src_poshNdst_poshOcharunsigned long LWCHAR is_ansi_middleh step_char put_wcharvoid7 ecalloc? Tunsigned ^size_t strlenjY mkstemps64hh mkstemp64h mkstemps64hh mkstemp64hlong tm$tm_sech#tm_minh#tm_hourh#tm_mdayh# tm_monh#tm_yearh#tm_wdayh#tm_ydayh#tm_isdsth# ( __wcsftime_xpg5jj#wchar_t   __wcstok_xpg5G wint_t __putwchar_xpg5GwGunsigned charw__FILEj_cnth#_ptr#_base#_flagw# _magicw# __orientation^# __ionolock^#  __seekable^#  __extendedfd^#  __xf_nocheck^#  __filler^#   __putwc_xpg5GGj__getwchar_xpg5G __getwc_xpg5Gj __ungetwc_xpg5GGj  __fputws_xpg5h) __fputwc_xpg5GOGj __fgetws_xpg5hO __fgetwc_xpg5Gj towlowerGG iswupperhlong long lockf64h hh   truncate64h7 off64_t tell647_h hssize_t 7m pwrite64__r^7 pread64__^ lseek647h7h ftruncate64h h  truncate64hG   off_t tell64G m h 7m pwrite64_ _r ^ pread64_ _^ lseek64G  hG h lockf64h hh ftruncate64h: h : D attropen64hw ? I h w openat64h h| h posix_fallocate64h h posix_fadvise64h hh  creat64h3   3 open64h] 8 h ] g attropen64h b l h  openat64h h h posix_fallocate64h h posix_fadvise64h, hh , creat64hV 1  V open64h [ h ftello647  fseeko64h h  fsetpos64h   fgetpos64h  FILE tmpfile64%  = G freopen64% x B L % x  fopen64%  }   ftello64G   fseeko64h h  fsetpos64h fgetpos64hA A K freopen64% |FP% |  fopen64% tmpfile64% j,decode.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g decode.c -W0,-xp.XAKk4DresWrMFsD.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DresWrMFsD.;backend;raw;cd;DBG_GEN 5.2.7\unsigned charlong.V?cmdtableG/.?cmdtablem/edittableGH.?edittableH char  tablelist ) t_next# t_start# t_end#list_fcmd_tableslist_ecmd_tableslist_var_tableslist_sysvar_tables expand_special_keysp+-UI table Ilen fmtoaIreplklenIintinit_cmds$ --Uadd_cmd_tableE-.UItlistAbufA IlenAtF add_fcmd_tableb.>.Ubuf_Ilen_ add_ecmd_tablen@.n.U^bufkIlenk add_var_table{p..Utlistwbufw Ilenwcmd_search.0UILcmdtable endtableLsppqaI cmd_decode00UItlistcmd LsptactionIfcmd_decode1$1UIcmdLsp ecmd_decode 01T1UIRcmdLsp lgetenv`11UvaraIsgint-2_2UILsp+nI.old_lesskey<`22UI(buf9Ilen9 new_lesskeyR2 4UIbufNIlenN IsysvarNpScITnIUlesskey46UIGfilenameIsysvar buflenTn?fIlong longGPOSITIONadd_hometable66Uenvnamedef_filename Isysvarfilenameparg> GLINENUMparg> p_string# p_intI# p_linenum# PARGeditchar6-8UI IcIflags actionInchIsusercmd  ?errorfilesizeThomefileshell_unquoteungetscungetccgetccIspecial_key_strsave } unsigned size_tstrlen   mkstemps64I Imkstemp64I mkstemps64I Imkstemp64I:  : getenv^ ? void ^ free f callocf    ?? tm$F tm_secI# tm_minI# tm_hourI# tm_mdayI# tm_monI# tm_yearI# tm_wdayI# tm_ydayI# tm_isdstI#  F __wcsftime_xpg5     K wchar_t  __wcstok_xpg5     ?wint_t__putwchar_xpg5   .__FILE _cntI# _ptr # _base # _flag.# _magic.# __orientation # __ionolock #  __seekable #  __extendedfd #  __xf_nocheck #  __filler #   __putwc_xpg5   __getwchar_xpg5 __getwc_xpg5 A __ungetwc_xpg5 h  ? h  __fputws_xpg5Imr__fputwc_xpg5    __fgetws_xpg5  I__fgetwc_xpg5  lockf64I9IIG 9truncate64If>GGoff64_ttell64fIIssize_t^ pwrite64 G ^ pread64 Glseek64f%IfIftruncate64IIIG Itruncate64IvNGGoff_ttell64vIread ^ pwrite64 Gpread64 Glseek64vBIvIlockf64IgIIGftruncate64IIGcloseII  attropen64II! openat64III!posix_fallocate64IAIGGposix_fadvise64IsIGGI sunsigned longcreat64Ix} open64II!  attropen64II! openat64IFII!posix_fallocate64IuIGGposix_fadvise64IIGGI creat64I} open64II!  ftello64ffseeko64IBrGIG Bfsetpos64InrG Gfgetpos64Irn FILE  tmpfile64  freopen64  fopen64'  ftello64vH'fseeko64InrGIG nfsetpos64Irsfgetpos64Irn  freopen64  fopen64+ tmpfile64"open64NV#open$lseek64c#lseek6edit.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g edit.c -W0,-xp.XAKk4DresWrM1sD.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DresWrM1sD.;backend;raw;cd;DBG_GEN 5.2.7kemknod@8h8Uxx_path_mode _devintcharunsigned longmode_tdev_tfd0x$curr_altfilename/  init_textlist>p89Utlist;str; s? meta_quotedxA delim_quotedxB escC esclenxD textlist string# endstring# forw_textlistj9G:U3tlistgprevg sk back_textlistP::Utlistprev sclose_file;;U scrposlong longPOSITION scrpos  pos# lnx# edit;<Ux2filename edit_ifile <@Uxifile fx answerx no_displayx chflagsx filename open_filename qopen_filename alt_filename alt_pipe was_curr_ifile parg"?*@?*@?*@?@statbufGrxvoidLINENUMparg" p_string# p_intx# p_linenum#PARGlong- F-unsigned long longFino_tnlink_tunsignedvuid_tvgid_t--off_t-time_t timespec tv_sec# tv_nsec-#timestruc_t-blksize_tblkcnt_t6-- G- stath st_dev# st_pad15# st_ino\# st_mode# st_nlinkh# st_uid# st_gid#$ st_rdev#( st_pad2#, st_size#4 st_atim#< st_mtim#D st_ctim#L st_blksize#T st_blocks#X st_fstype%#` st_pad46#pedit_list@\BUxY filelistsave_ifilegood_filenamefilenamegfilelistgfilenametl_filestl_gfilesedit_first`BBUxedit_last BBUxedit_istepBdCUx hxn xdirnextedit_inextDpCCUx8 hAxnA edit_nextKCCUxi xnIedit_iprevSCCUx hPxnP edit_prevZCDUx xnXedit_indexdDiDUx xnbhesave_curr_ifilexpDDUunsave_ifileDDUz save_ifilereedit_ifileDZEU save_ifilenextprevreopen_curr_ifile`EEU save_ifileedit_stdinEEUxcat_fileEFUq cxuse_logfile FHU filenameexistsxanswerxparg" curr_altpipe0$curr_ino\,@curr_dev+Hx: _xmknodxn 5 ? n Glstat64x s x  stat64x  x fstat64x xx  fstatat64xx x x- 7-Fino64_t-V-off64_tblkcnt64_t-- - stat64 st_dev# st_pad1&# st_ino7# st_mode# st_nlinkh# st_uid# st_gid#$ st_rdev#( st_pad2E#, st_sizeV#4 st_atim#< st_mtim#D st_ctim#L st_blksize#T st_blocksd#X st_fstypeu#` st_pad4#pfstatat64xx!xlstat64xstat64x>fstat64x^xclr_hiliteget_scrpospos_clearqueryxerrorputchrxflusherrno_messagelastmarkclr_linenumheld_ifilexhold_ifileopenedxset_openget_posstore_posget_indexxget_filenameget_ifileprev_ifilenext_ifiledel_ifilebad_fileclose_altfileopen_altfilelglobbin_filexget_meta_escapeshell_unquoteungetsccmd_addhistch_getflagsxch_closech_initch_forw_getxend_logfilequitskipspsavestrncmpxvvsize_tstrlen 44>strcmpxg9Cmkstemps64xxmkstemp64xmkstemps64xxmkstemp64xfree-- tm$ tm_secx# tm_minx# tm_hourx# tm_mdayx# tm_monx# tm_yearx# tm_wdayx# tm_ydayx# tm_isdstx#  __wcsftime_xpg5  wchar_t__wcstok_xpg5)-wint_t__putwchar_xpg5)Y)unsigned charY __FILE L _cntx# _ptrj# _basej# _flagY# _magicY# __orientationv# __ionolockv#  __seekablev#  __extendedfdv#  __xf_nocheckv#  __fillerv#  o__putwc_xpg5)v)L__getwchar_xpg5)__getwc_xpg5)L__ungetwc_xpg5))L-o__fputws_xpg5x __fputwc_xpg5)1)Lo__fgetws_xpg5ax1__fgetwc_xpg5)Llockf64xxxtruncate64xtell64Vxxssize_tpwrite641vpread64`1vlseek64VxVxftruncate64xxtruncate64xtell64xpwrite64%vpread64O1vlseek64txxlockf64xxxisattyxxftruncate64xxclosexxattropen64x-x -openat64x^x2x posix_fallocate64xxposix_fadvise64xxxcreat64xopen64xx attropen64xP"x Popenat64xxUx posix_fallocate64xxposix_fadvise64xxxcreat64x  open64x6x oftello64VW6fseeko64x}x}fsetpos64xfgetpos64xoFILE tmpfile64freopen64..8fopen64b3=oftello64bfseeko64xxfsetpos64xfgetpos64xfreopen6422<fopen64f7Atmpfile64!open64"open!creat64"creat!lseek64"lseek#stat64"stat ifilename.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g filename.c -W0,-xp.XAKk4DresWrMltD.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DresWrMltD.;backend;raw;cd;DBG_GEN 5.2.7pmknodH(HU_path_mode _devintcharunsigned longmode_tdev_tshell_unquoteE0H`IUdddstrC namedF pdG YHJI HJI HJI escdY esclenZget_meta_escapek`IIUd sdl metacharsyIIUd mcharsdz( metacharIJUcshell_quote JKUdds pd newstrd len escd esclen use_quotes have_quotes dirfileKLUdjddirnamedfilename pathnamed qpathnamed len f homefile L4MUd dfilename pathnamed  fexpand=@MOUdI ds;frd>tod>n?ed@ifileQAvoidI fcompleteOPUd dsfpatdqsd O.Plen bin_fileP/RU fnbin_countdatapdpendd GQR eQ R eQ RclongLWCHARseek_filesize0RRU fspos"long longPOSITIONoff_treadfd RSUd fd lenchbufdpdunsigned charunsigned__FILE_cnt#_ptr#_base#_flag# _magic# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  FILEshellcmd>STU dcmd<fd?shelldB ST TT TTscmddGesccmddH (TT LTT LTTlenT lglobqUWUdz dfilenameogfilenamedrofilenameds EUdWfdsdlessechodcmddescdlen open_altfile1WYUd dfilename- pf- pfd-lessopend5cmdd6len7fd8returnfd: X`Y X`Y X`YficjQclose_altfileYZUA daltfilename dfilename Qpipefdlessclosedfdcmddlen is_dirZ<[U dfilenameisdir Z#[rstatbuf  unsigned long long ino_tnlink_tuid_tgid_t* time_ttimespecg tv_sec* #tv_nsec#7 timestruc_tblksize_tblkcnt_t  statst_dev#st_pad1 #st_ino #st_mode#st_nlink #st_uid # st_gid #$st_rdev#(st_pad2 #,st_size"#4st_atimg #<st_mtimg #Dst_ctimg #Lst_blksizey #Tst_blocks #Xst_fstype #`st_pad4 #p bad_file@[w\Ud dfilenamemd a[^\ ~[[ ~[[is_a_dir, [^\ [^\rstatbuf  [^\ [^\ [^\ \^\ \^\ \^\ \^\not_reg<*) filesize \\U_ f statbuf  shell_coption!\\Ud_xmknod lstat64stat64fstat6433fstatat64i8i  ino64_toff64_tblkcnt64_t stat64st_dev#st_pad1s#st_ino#st_mode#st_nlink #st_uid # st_gid #$st_rdev#(st_pad2#,st_size#4st_atimg #<st_mtimg #Dst_ctimg #Lst_blksizey #Tst_blocks#Xst_fstype#`st_pad4#pfstatat648n8lstat64b=bstat64gfstat64errno_messagedis_ansi_middleget_filenamedlgetenvdstep_charbinary_charseekablech_ungetcharecallocQsavedbstrchrdgstrncmpsize_tstrlenstrcpydd(strcmpQ#-QstrcatdzdVmkstemps64dmkstemp64dmkstemps64dmkstemp64dfreeQcallocQ-2tm$ tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst# <__wcsftime_xpg5-7wchar_t!__wcstok_xpg5[&+wint_t __putwchar_xpg5[[__putwc_xpg5[[__getwchar_xpg5[__getwc_xpg5[__ungetwc_xpg5[[__fputws_xpg5J__fputwc_xpg5[p[__fgetws_xpg5p__fgetwc_xpg5[lockf64truncate64tell64-ssize_tI;pwrite64-p-@Ipread64--plseek64ftruncate64truncate64tell64"/read-Q-pIQpwrite64--Vpread64--plseek64""lockf64ftruncate64close77Aattropen64t<Ftopenat64yposix_fallocate64posix_fadvise64creat640 0open64Z5Zdattropen64_iopenat64posix_fallocate64posix_fadvise64))creat64S.Sopen64}Xftello64}fseeko64fsetpos64fgetpos64tmpfile64*4freopen64e/9eofopen64jtftello64"fseeko64pclosepopen, filenoFFsnprintfwdK__filbuffsetpos64fgetpos64sprintf d  freopen64G   G Q fopen64{ L V tmpfile64 open64 !open lseek64 !lseek fstat64 !fstat"stat64 !statOxforwback.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g forwback.c -W0,-xp.XAKk4DresWrMVuD.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DresWrMVuD.;backend;raw;cd;DBG_GEN 5.2.7|intno_back_scroll2leof_bell-\ ]Ueof_displayed9]]U2pos:long longPOSITIONentire_file_displayedT]&^U2posUsquish_checkh0^Q^U forw`^DaU 2ny posy 2forcey 2only_lasty 2nblankyeof2nlines2do_repaint2first_time2h back$PaYbUx 2n pos 2force 2only_last nlines2% do_repaint2& forwardX`bcU 2nT 2forceT 2only_lastT posY backwardc dUC 2n 2force 2only_last posget_back_scrolldddU2forw_prompt2\squished2screen_trashed2 empty_lines2empty_screen2pos_clearadd_back_posadd_forw_pospositionputstrput_lineget_quit_at_eof2LINENUMcurrlineSrepaintback_lineforw_lineedit_next2ch_getflags2ch_lengthclearbellvbelllower_leftadd_linehomequitchar%mkstemps642U-2mkstemp642r-mkstemps642-2mkstemp642-longunsignedsize_ttm${tm_sec2#tm_min2#tm_hour2#tm_mday2# tm_mon2#tm_year2#tm_wday2#tm_yday2#tm_isdst2# {__wcsftime_xpg5wchar_t__wcstok_xpg5wint_t__putwchar_xpg51unsigned char1__FILE$ _cnt2#_ptrB#_baseB#_flag1# _magic1# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  G__putwc_xpg5N $ __getwchar_xpg5__getwc_xpg5 $ __ungetwc_xpg5 $  G__fputws_xpg52   __fputwc_xpg5 $ G__fgetws_xpg59 2 __fgetwc_xpg5Z $ lockf642 22% truncate642  off64_ttell64  22ssize_tvoid  pwrite64     pread64 N   lseek64 s 2 2ftruncate642 2% truncate642  off_ttell64  2  pwrite64    pread64 I   lseek64 n 2 2lockf642 22ftruncate642 2% % attropen642   2% openat642% 2 2posix_fallocate642T 2posix_fadvise642 22% unsigned longcreat642   % open642  2% % attropen642(  2%(openat642Y2-2posix_fallocate6422posix_fadvise64222%creat642 %open6422Gftello64 /fseeko642U 2Ufsetpos642 Zfgetpos642 GFILEtmpfile64%%freopen64%%fopen64: Gftello64 [:fseeko642 2fsetpos642 fgetpos642 %%freopen64 % %fopen64>tmpfile64 help.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g help.c -W0,-xp.XAKk4DresWrMFvD.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DresWrMFvD.;backend;raw;cd;DBG_GEN 5.2.7@char*long2+R7+helpdata?*intjsize_helpdataqU*mkstemps64j  jmkstemp64j mkstemps64j  jmkstemp64j 7unsigned size_t76 tm$ tm_secj# tm_minj# tm_hourj# tm_mdayj# tm_monj# tm_yearj# tm_wdayj# tm_ydayj# tm_isdstj# @__wcsftime_xpg5)  ) ; wchar_t% __wcstok_xpg5 _  * / 7wint_t__putwchar_xpg5_ _unsigned char __FILE _cntj# _ptr# _base# _flag# _magic# __orientation#  __ionolock#   __seekable#   __extendedfd#   __xf_nocheck#   __filler#  __putwc_xpg5_ _ __getwchar_xpg5___getwc_xpg5_ __ungetwc_xpg5_  _ 7 __fputws_xpg5jA  __fputwc_xpg5_g _ __fgetws_xpg5   j g__fgetwc_xpg5_ long longlockf64j j j *truncate64j   off64_ttell64? j jssize_tvoidMUpwrite64? ? Z  Mpread64? ?   lseek64 j  jftruncate64j j *truncate64j/   off_ttell64/U jMUpwrite64? ? Z  pread64? ?   lseek64/ j / jlockf64j j j ftruncate64j" j *"*,attropen64j_ ' 1 j*_openat64j j d jposix_fallocate64j j  posix_fadvise64j j   j*unsigned longcreat64j,  *, open64jV 1 j*V *` attropen64j [ e j* openat64j j jposix_fallocate64j j  posix_fadvise64j% j   j*% creat64jO * *O open64jy T jftello64 y fseeko64j   j fsetpos64j  fgetpos64j  FILE tmpfile64 *6 *@ freopen64 q ; E  *q *{ fopen64  v ftello64/ fseeko64j   j fsetpos64j  fgetpos64j:  *: *D freopen64 u ? I  *u * fopen64  z tmpfile64 ifile.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g ifile.c -W0,-xp.XAKk4DresWrM1vD.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DresWrM1vD.;backend;raw;cd;DBG_GEN 5.2.7ifile(h_next#h_prev#h_filename#h_filestate# h_index#h_hold#h_opened#h_scrpos#,charvoidintlong longPOSITIONscrpos 'pos#ln#anchor,0pifiles2 incr_index8pddU p5 incr5 link_ifileDdeU pA prevA unlink_ifile] e_eU p[ new_ifilen`eeUG filenamek prevk po del_ifileeSfU hp next_ifile`ffU hp prev_ifileffU hp getoff_ifilegXgUS ifilenewifilenifile`gsgU find_ifileӀggU filenamep get_ifileghU  filename prev p get_filename hFhUA ifile get_indexPhdhUt ifilestore_pos phhUifilescrpos Cget_poshhU ifilescrpos Cset_open hhU9ifileopened*hhUkifile(hold_ifile2hhUifile/incr/ held_ifile9iiUifile7get_filestate@ i4iUifile>set_filestateH@iNiUfifileEfilestateE unmarkecallocsavestrcmpmkstemps64mkstemp64mkstemps64$mkstemp64AfreeUlongUunsignedbsize_tU{tm$ tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst#  __wcsftime_xpg5nZ ]n# wchar_tZ Z j e __wcstok_xpg5e  e o t Uwint_t__putwchar_xpg5   unsigned char __FILE _cnt#_ptr #_base #_flag # _magic # __orientationb# __ionolockb#  __seekableb#  __extendedfdb#  __xf_nocheckb#  __fillerb#   __putwc_xpg5    __getwchar_xpg5 __getwc_xpg5 *  __ungetwc_xpg5 Q   UQ  __fputws_xpg5 V [ __fputwc_xpg5     __fgetws_xpg5e  e  __fgetwc_xpg5   lockf64" " truncate64O ' off64_ttell64O w ssize_t pwrite64w  w  bpread64w  w  blseek64O  O ftruncate642 2 truncate64_ 7 off_ttell64_   pwrite64w  w  bpread64w  w  blseek64_  _ lockf64.ftruncate64RR\attropen64Waopenat64posix_fallocate64posix_fadvise64!!unsigned longcreat64\&+\open64aattropen64openat64posix_fallocate64#posix_fadvise64UUcreat64Z+open64 ftello64O fseeko64[ fsetpos64[ fgetpos64C[  FILECtmpfile64Nfpfreopen64NkuNfopen64N ftello64_ fseeko64[ fsetpos64H[ !fgetpos64j[ jtfreopen64NoyNfopen64Ntmpfile64NGinput.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g input.c -W0,-xp.XAKk4DresWrMlwD.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DresWrMlwD.;backend;raw;cd;DBG_GEN 5.2.7forw_line0Pi[nUcurr_pos.base_pos1new_pos2c3blankline4endline5backchars6long longPOSITIONintback_line`nsUcurr_posnew_posbegin_new_posbase_poscendlinebackcharsset_attnposssUpos c is_filtering prep_hilite is_hilited is_filtered null_line set_status_col pdone pflushmbc pappend pshift_all plinenum prewind ch_back_get ch_forw_get ch_tell ch_seekchar  mkstemps64M% mkstemp64j% mkstemps64% mkstemp64%long unsignedsize_t tm$stm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst#  s __wcsftime_xpg5xwchar_t    __wcstok_xpg5wint_t __putwchar_xpg5)unsigned char )__FILE_cnt#_ptr:#_base:#_flag)# _magic)# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  ? __putwc_xpg5F__getwchar_xpg5 __getwc_xpg5 __ungetwc_xpg5  ? __fputws_xpg5 __fputwc_xpg5 ? __fgetws_xpg51 __fgetwc_xpg5R lockf64w w truncate64|off64_t tell64ssize_tvoid  pwrite64   pread64F   lseek64k  ftruncate64  truncate64  off_t tell64   pwrite64   pread64A   lseek64 f   lockf64  ftruncate64   attropen64    openat64   posix_fallocate64L  posix_fadvise64~  ~ unsigned long creat64    open64    attropen64    openat64Q %  posix_fallocate64  posix_fadvise64  creat64    open64   ? ftello64'  fseeko64M  M fsetpos64y R  fgetpos64 y ?FILE tmpfile64   freopen64        fopen64 2  ? ftello64 S2 fseeko64y y fsetpos64~ fgetpos64y    freopen64     fopen64 6tmpfile64 jump.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g jump.c -W0,-xp.XAKk4DresWrMVxD.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DresWrMVxD.;backend;raw;cd;DBG_GEN 5.2.7jump_forwttUspos end_pos!long longsPOSITIONjump_backFtuUlinenumDposGpargGHsLINENUMcharintpargG p_string# p_int# p_linenum# PARGrepaintfuuUscrposg scrpos  pos# ln#jump_percentxuvUpercentufractionu posylenylongjump_line_locvCwUrposslinecjump_locPwtzUposslinenlinetposbpos repaint_hilite adjsline get_scrpos onscreen pos_clear add_back_pos position ierror error percent_pos lastmark find_pos set_attnpos back_line forw_line back forw ch_back_get ch_forw_get ch_tell ch_length ch_beg_seek ch_end_seek ch_seek clear home mkstemps64 mkstemp64 mkstemps64 mkstemp64unsignedsize_t tm$ tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# ) __wcsftime_xpg5$wchar_t  __wcstok_xpg5 H wint_t __putwchar_xpg5HxHunsigned charx __FILEk _cnt# _ptr# _base# _flagx# _magicx# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#   __putwc_xpg5HHk__getwchar_xpg5H __getwc_xpg5Hk __ungetwc_xpg5HHk __fputws_xpg5*  __fputwc_xpg5HP Hk __fgetws_xpg5   P __fgetwc_xpg5H k lockf64 s truncate64  ssoff64_t tell64  ssize_tvoid) 1 pwrite64 f  6 s) pread64   f s lseek64    ftruncate64 s truncate64  ssoff_t tell64 1 ) 1 pwrite64 f  6 s pread64   f s lseek64    lockf64 s ftruncate64 s  attropen64;   ; openat64l @  posix_fallocate64 ss posix_fadvise64 ss unsigned long creat64    open642  2 < attropen64o 7 A o openat64 t  posix_fallocate64 ss posix_fadvise64ss creat64+ + open64U0 ftello64 vU fseeko64ss fsetpos64s fgetpos64FILEtmpfile64 freopen64M!MW fopen64R\ ftello64  fseeko64ss fsetpos64 fgetpos64  freopen64Q%Q[ fopen64V`tmpfile64line.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g line.c -W0,-xp.XAKk4DresWrMFyD.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DresWrMFyD.;backend;raw;cd;DBG_GEN 5.2.7char*linebuf2attr2intsize_linebuf`long`tabstopsntabstops`tabdefault`4last_overstrike`#mbc_buf_len`Ambc_buf_index`B8init_lineJz%{U expand_linebuf]0{ |U`new_size`_new_buf2fnew_attr2g is_ascii_char |:|U` chunsigned long LWCHARprewind@||U plinenum|~U poslinenumi`}i~}i~}i~bufn`long long POSITION LINENUM*pshift~U7 `shiftprev_chc7shifted`to`from`len`width`prev_attr`next_attr`2xMaMas''chunsigned charpshift_allgUattr_swidthrU``apw`sattr_ewidth%U``aw`pwidth0U`Lch`a prev_chw`backcU`prev_chp2chwidth`in_ansi_esc_seqwU`*p2k``chis_ansi_endȈU`^chis_ansi_middle#Ј4U`ch!store_char9@܋U` ch4`a4 2rep4pos4w`:replen`;cs*<bmatches`DNN@@@p2UbchVPP||p2gprev_chhstore_tabU`o `attrpos to_tab`i`store_prchar U` *cpos s2flush_mbc_buffU` posi`pappendpU`[ *cpos r`do_appendM5U`, chI2repI posIa`Nprev_chO H H   ;;s2pflushmbcPU`b r`pdoneU `endline`forw ,,p2set_status_col1U *c/gline?wU`> `i<> ap< `null_line]Uforw_raw_linelƚU curr_posh lineph> line_lenphn`mc`nnew_poso2back_raw_lineКU"curr_pos linep> line_lenpn`c`new_pos\p\k\kUțUțUold_size_linebuf`fm2to2mbc_posC`*Imbc_buf8@Pmid_ansi_chars2),end_ansi_chars2((pendpos'Xpendc*&Hlmargin`%Lis_null_line`$@overstrike`"<column` 4curr`0hshift`cshift`8linenumtoais_hilited`find_linenumlgetenv2is_combining_char`is_wide_char`is_ubin_char`is_composing_char`step_charget_wcharis_utf8_well_formed`utf_len`prutfchar2prchar2control_char`ch_back_get`ch_forw_get`ch_tellch_seek`apply_at_specials`is_at_equiv`voidecalloc *strchr2G#`*Gunsigned Qsize_tstrlen]Lmemcpy  Qmkstemps64`2`mkstemp64`2mkstemps64`2`mkstemp64`22freeF calloc eQQjtm$ tm_sec`#tm_min`#tm_hour`#tm_mday`# tm_mon`#tm_year`#tm_wday`#tm_yday`#tm_isdst`# t __wcsftime_xpg5]Ie]owchar_tIIYT__wcstok_xpg5TT^c wint_t__putwchar_xpg57__FILE_cnt`#_ptr#_base#_flag7# _magic7# __orientationQ# __ionolockQ#  __seekableQ#  __extendedfdQ#  __xf_nocheckQ#  __fillerQ#  __putwc_xpg5__getwchar_xpg5__getwc_xpg5__ungetwc_xpg5//__fputws_xpg5`d49__fputwc_xpg5__fgetws_xpg5TT`__fgetwc_xpg5lockf64```*truncate64`- off64_ttell64-U` `ssize_tcpwrite64UUhQpread64UUQlseek64-`-`ftruncate64``*truncate64`= off_ttell64=c`cpwrite64UUhQpread64UUQlseek64=`=`lockf64` ``ftruncate64`0`*0*:attropen64`m5?` *mopenat64``r` posix_fallocate64``posix_fadvise64```*creat64`)*)open64`S.` *S*]attropen64`Xb` *openat64``` posix_fallocate64``posix_fadvise64`"``*"creat64`L'*Lopen64`vQ` ftello64-vfseeko64`9`fsetpos64`9fgetpos64`9 FILEtmpfile64*3*=freopen64n8B*n*xfopen64s}ftello64=fseeko64`9`fsetpos64`9fgetpos64`79*7sprintf`b2< *b*lfreopen64gq**fopen64tmpfile64linenum.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g linenum.c -W0,-xp.XAKk4DresWrM1yD.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DresWrM1yD.;backend;raw;cd;DBG_GEN 5.2.7clr_linenumNrUbpbOlong longgPOSITIONgLINENUMlinenum_info nextb#prevb#post#gapt#line# calcgapkU  bpiadd_lnumrU linenum} tpos}pbnewbnextpbprevpbmingapt longloopmessageրU longish᠟U abort_long"U find_linenum 0Us tpos pb linenumcpost find_pos Ut linenum}pbcpostclinenum currlineU] ]wherepostlentlinenumintlongstartimedloopcount]sparebBldpoolAhfreelistb@hanchor?ppositiontierrorerrorget_timedback_raw_linetforw_raw_linetch_lengthtch_seek]charmkstemps64]]mkstemp64]mkstemps64]]mkstemp64]dunsignedsize_td1tm$tm_sec]#tm_min]#tm_hour]#tm_mday]# tm_mon]#tm_year]#tm_wday]#tm_yday]#tm_isdst]# ;__wcsftime_xpg5$$6wchar_t __wcstok_xpg5Z%*dwint_t__putwchar_xpg5ZZunsigned char__FILE}_cnt]#_ptr#_base#_flag# _magic# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  __putwc_xpg5ZZ}__getwchar_xpg5Z__getwc_xpg5Z}__ungetwc_xpg5Z Z}d __fputws_xpg5]<   __fputwc_xpg5Zb Z}__fgetws_xpg5 ]b __fgetwc_xpg5Z }lockf64] ]]g truncate64]  ggoff64_ttell64 - ]]ssize_tvoid; C pwrite64- x - H g; pread64-  - x glseek64  ] ]ftruncate64] ]g truncate64]  ggoff_ttell64 C ]; C pwrite64- x - H gpread64-  - x glseek64  ] ]lockf64] ]]gftruncate64] ]g  attropen64]M   ]M openat64]~ ]R ]posix_fallocate64] ]ggposix_fadvise64] ]gg] unsigned longcreat64]    open64]D  ]D N attropen64] I S ] openat64] ] ]posix_fallocate64] ]ggposix_fadvise64]]gg]creat64]= =open64]gB]ftello64 gfseeko64] g]gfsetpos64] gfgetpos64] FILEtmpfile64 $.freopen64 _)3 _ifopen64 dnftello64 fseeko64] g]gfsetpos64] fgetpos64]( (2freopen64 c-7 cmfopen64 hrtmpfile64 Llsystem.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g lsystem.c -W0,-xp.XAKk4DresWrMlzD.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DresWrMlzD.;backend;raw;cd;DBG_GEN 5.2.7lsystem- UCKcmd*Kdonemsg* inpP.shellK0pK1save_ifile_3<<esccmdKMUUlenPcharCintvoidWpipe_markUPPcKcmd mpos tpos bposlong long POSITIONpipe_data$ 9UP Kcmd  spos  epos  f% cP& popen  unsigned charunsigned__FILE_cntP#_ptr#_base#_flag# _magic# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  FILECC P Psignal P init_signalswinchpositionerrorget_returnputstrputchrPflushmarkposshell_coptionKshell_quoteKreedit_ifilesave_curr_ifile_edit_ifilePlgetenvKch_forw_getPch_seekPclear_botdeinitinitraw_modeecalloc_saveKCR size_tstrlen\ Wmkstemps64P K Pmkstemp64P Kmkstemps64P K Pmkstemp64P KCsystemP' free; _long;;Htm$tm_secP#tm_minP#tm_hourP#tm_mdayP# tm_monP#tm_yearP#tm_wdayP#tm_ydayP#tm_isdstP# R__wcsftime_xpg5\' C \ M wchar_t''72__wcstok_xpg52q 2 < A ;wint_t__putwchar_xpg5q q__putwc_xpg5q q __getwchar_xpg5q__getwc_xpg5q __ungetwc_xpg5q+ q ;+ __fputws_xpg5P` 0 5 __fputwc_xpg5q q __fgetws_xpg52 2 P __fgetwc_xpg5q lockf64P P P C truncate64P)   off64_ttell64) Q P Pssize_tW_ pwrite64Q  Q d  Wpread64Q  Q  lseek64)  P ) Pftruncate64P P C truncate64P9   off_ttell649 _ PW_ pwrite64Q  Q d  pread64Q  Q  lseek649  P 9 Plockf64P P P ftruncate64P, P dupPC PcloseP\ PC\ Cf attropen64P a k PC openat64P P Pposix_fallocate64P P  posix_fadvise64P+ P   PC+ unsigned longcreat64Pf 0 5 Cf open64P k PC C attropen64P PC openat64P P Pposix_fallocate64P- P  posix_fadvise64P_ P   PC_creat64P d 5 Copen64P  Pftello64)  fseeko64P 5  Pfsetpos64P& 5 fgetpos64PM 5 &tmpfile64C`Cjfreopen64 e o CCfopen64  ftello649  fseeko64P 5  PpcloseP0 5 popenN  CNsnprintfP K  S__flsbufP P 5 fsetpos64P 5 fgetpos64P 5 &CCfreopen64)   C)C3fopen64] . 8tmpfile64open64|openmark.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g mark.c -W0,-xp.XAKk4DresWrMV0D.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DresWrMV0D.;backend;raw;cd;DBG_GEN 5.2.7߮init_mark(@UZiZ)intgetumark5U Zc3voidlong longPOSITION scrpos  pos# lnZ# mark  m_ifile# m_scrpos#getmarkHkU ]ZcFm IsmJ badmarkpUZZcsetmarkUZcm scrpos ClastmarkdUscrpos Cgomarkp6UoZcm scrpos C markpos@UZcm unmarkUifileiZlongP4marks!get_scrposerrorjump_locedit_ifileZch_getflagsZch_tellch_end_seekZcharmkstemps64ZZmkstemp64Zmkstemps64ZZmkstemp64Zunsignedsize_t4 tm$ tm_secZ# tm_minZ# tm_hourZ# tm_mdayZ# tm_monZ# tm_yearZ# tm_wdayZ# tm_ydayZ# tm_isdstZ# >__wcsftime_xpg5''9wchar_t#__wcstok_xpg5](-wint_t__putwchar_xpg5]]unsigned char __FILE _cntZ# _ptr# _base# _flag# _magic# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  __putwc_xpg5]]__getwchar_xpg5]__getwc_xpg5]__ungetwc_xpg5] ] __fputws_xpg5Z?__fputwc_xpg5]e]__fgetws_xpg5Ze__fgetwc_xpg5]lockf64ZZZtruncate64Z off64_ttell64 0 ZZssize_t> pwrite640 s 0 C pread640  0 s lseek64  Z Zftruncate64Z Z truncate64Z  off_ttell64 > Z> pwrite640 s 0 C pread640  0 s lseek64  Z Zlockf64Z ZZftruncate64Z Z  attropen64ZH   ZH openat64Zy ZM Zposix_fallocate64Z Zposix_fadvise64Z ZZ unsigned longcreat64Z    open64Z?  Z? I attropen64Z| D N Z| openat64Z Z Zposix_fallocate64Z Zposix_fadvise64Z ZZ creat64Z8   8 open64Zb = Zftello64  b fseeko64Z Z fsetpos64Z  fgetpos64Z  FILE tmpfile64)freopen64Z$.Zdfopen64_iftello64 fseeko64ZZfsetpos64Zfgetpos64Z# #-freopen64^(2^hfopen64cmtmpfile64 !optfunc.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g optfunc.c -W0,-xp.XAKk4DresWrMF1D.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DresWrMF1D.;backend;raw;cd;DBG_GEN 5.2.7Ѳchar0tagoption8<<opt_oP %UtypeM8sM pargQintlong longLINENUM parg p_string8# p_int# p_linenum#PARGopt__O@_UBtype}8s} opt_l`εUtype8s errnt8opt_jе1Utype8s pargbuflenerr ֵ/ ܵ  ܵ  ܵr ,r ,rslinelong 0 calc_jump_sline@kUopt_shiftpѸUtype8s pargbuflenerr vϸ | | | ̷ ̷hs 0 calc_shift_count Uopt_k(NUtype%8s% parg)opt_t@P'Uxtype=8s= save_ifileAposBvoidxPOSITIONopt__Ti0Utypef8sf pargjopt_pUtype8s opt__PIUtype8s protoparg8opt_b`Utype8s opt_iżUtype8s opt__VU2type8s opt_xd1Utypea8sa msghiipj /      ɽ ɽns 0opt_quote@!Uitype8s bufiparg 0z opt_query0iUtype8s get_swindowUedit_tagfiletagsearchfindtagchg_caselesserrorputstrgetfractiongetnumjump_loclglob8use_logfilereedit_ifileunsave_ifilesave_curr_ifilelesskeyungetscdispversionch_getflagsch_setbufspacesync_logfilequitskipsp8save80B unsignedL size_tstrlenX  G 0 strcpy8 8 0 strcat8 8 mkstemps64 8mkstemp64 8mkstemps644 8mkstemp64Q 8freee j tm$ tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# t  __wcsftime_xpg5X I e X o  wchar_tI I Y T __wcstok_xpg5T  T ^ c wint_t__putwchar_xpg5   unsigned char __FILE _cnt# _ptr # _base # _flag # _magic # __orientationL # __ionolockL #  __seekableL #  __extendedfdL #  __xf_nocheckL #  __fillerL #   __putwc_xpg5    __getwchar_xpg5 __getwc_xpg5  __ungetwc_xpg5 @  @ __fputws_xpg5uEJ__fputwc_xpg5    __fgetws_xpg5T T __fgetwc_xpg5  lockf640truncate64>off64_ttell64>fssize_txtpwrite64ffyL xpread64ffL lseek64>>ftruncate64!0!truncate64N&off_ttell64Ntxtpwrite64ffyL pread64ffL lseek64NNlockf64ftruncate64A0A0Kattropen64~FP0~openat64posix_fallocate64posix_fadvise640unsigned longcreat64K0Kopen64uP0u0attropen64z0openat64posix_fallocate64posix_fadvise64D0Dcreat64nI0nopen64s ftello64>fseeko64Jfsetpos64 Jfgetpos642J  FILE2tmpfile64=0U0_freopen64=Zd=00fopen64= ftello64Nfseeko64 J fsetpos647Jfgetpos64YJ 0Ysprintf8^00freopen64==00fopen64=tmpfile64=V"option.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g option.c -W0,-xp.XAKk4DresWrM11D.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DresWrM11D.;backend;raw;cd;DBG_GEN 5.2.7intplusoption.@scan_option+U7?s)o,optc.-optname?.printopt?/str?0set_default.1lc.2err.3pargo4char7Ioptnameu oname?# onextD#. zlong ?  loption$ oletter7# onamesD# otype.# odefault.# ovaru# ofunc|# odesc#long long LINENUMpargo p_string?# p_int.# p_linenum## 1PARGtoggle_option PU7.c?s .how_toggleo num.no_prompt.err.pargoflip_tripleU.y.val.lc proptU?.cbuf 7 single_char_option bU..coopt_promptpU?Y.coisoptpending U.nostringU?printoptpargonopendopt$Uoptstring.0bU?Z?s)Zp_str) ?printopt)?validchars)p?/?num_errorVpU.?printoptSuerrpS pargoWgetnumrU.FZspn?printoptn uerrpns?sn.tneg.ugetfraction<UZsp?printopt uerrps?fracfraclen.get_quit_at_eof@U.pendoptchg_hiliterepaint_hiliteerrorfindopt_namefindoptungetscprchar?quitskipsp?voidecallocsave?7strchr?.7unsignedstrncpy?* ?mkstemps64.M ?.mkstemp64.j ?mkstemps64. ?.mkstemp64. ? size_t tm$_ tm_sec.# tm_min.# tm_hour.# tm_mday.# tm_mon.# tm_year.# tm_wday.# tm_yday.# tm_isdst.#  _ __wcsftime_xpg5     d wchar_t    __wcstok_xpg5     wint_t__putwchar_xpg5   unsigned char __FILE _cnt.# _ptr& # _base& # _flag # _magic # __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  + __putwc_xpg5 2   __getwchar_xpg5 __getwc_xpg5 k  __ungetwc_xpg5     + __fputws_xpg5.   __fputwc_xpg5    + __fgetws_xpg5   . __fgetwc_xpg5 >  lockf64.c ..7c truncate64. h  off64_ttell64  . .ssize_t pwrite64    pread64 *  lseek64 O. .ftruncate64.s.7struncate64.x off_ttell64.pwrite64  pread64 %  lseek64J..lockf64.o..ftruncate64..77attropen64..7openat64...posix_fallocate64.0.posix_fadvise64.b..7bunsigned longcreat64.gl7open64..77attropen64..7openat64.5. .posix_fallocate64.d.posix_fadvise64...7creat64.l7open64..+ ftello64  fseeko64.1 .1fsetpos64.] 6fgetpos64. ] + FILEtmpfile6477freopen6477fopen64+ ftello647fseeko64.] .]fsetpos64. bfgetpos64. ]7sprintf.?77freopen6477fopen64E tmpfile64,$opttbl.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g opttbl.c -W0,-xp.XAKk4DresWrMl2D.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DresWrMl2D.;backend;raw;cd;DBG_GEN 5.2.77longjump_sline_fraction.+xshift_count_fraction.,|intless_is_more}<Dcharoptnameoname#onext#a_optnameAb_optnameBB__optnameCc_optnameDd_optnameEe_optnameIf_optnameJF__optnameKg_optnameMh_optnameOȝi_optnamePНj_optnameQ؝J__optnameRk_optnameTK__optnameVL__optnameWm_optnameXn_optnameYo_optname[O__optname\p_optname^ P__optname_(q2_optname`0q_optnamea8r_optnameb@s_optnamecHS__optnamedPt_optnamefXT__optnameg`u_optnameihV__optnamejpw_optnamekxx_optnamelX__optnamemy_optnamenz_optnameoquote_optnameptilde_optnameqquery_optnamerpound_optnameskeypad_optnametoldbot_optnameuȞfollow_optnamevО}  . .loption$oletter#onames#otype}#odefault}# ovar#ofunc#odesc# . .optionH .0 .+optionHinit_option+U6o6p.findopt0U6|}co6is_optcharU}cfindopt_nameU6p_optname p_oname  p_err optnameo6onamelen}uppercase}maxo6maxonamemaxlen}ambig}exact}hilite_search}9oldbot}7follow_mode}6|quit_on_intr}5<use_lessopen}4status_col}30shift_count}2show_attn}1twiddle}08no_keypad}/`no_init}.Dchopline}-\jump_sline}*dswindow})force_open}(ctldisp}' bufspace}&4autobuf}%linenums}$ caseless}#forw_scroll}"back_scroll}!tabstop} squeeze}quit_if_one_screen}Xquit_at_eof}Xknow_dumb}bs_mode}pr_type}top_scroll}phow_search}tquiet}opt_queryopt_quoteopt_xopt__Vopt_iopt_bopt__Popt_popt__Topt_topt_kopt_shiftopt_jopt_lopt__Oopt_olgetenvsprefix} unsigned size_tstrlen #  mkstemps64}F }mkstemp64}c mkstemps64} }mkstemp64} .. tm$Ktm_sec}#tm_min}#tm_hour}#tm_mday}# tm_mon}#tm_year}#tm_wday}#tm_yday}#tm_isdst}#  K__wcsftime_xpg5    Pwchar_t__wcstok_xpg5.wint_t__putwchar_xpg5unsigned char__FILE_cnt}#_ptr#_base#_flag# _magic# __orientation # __ionolock #  __seekable #  __extendedfd #  __xf_nocheck #  __filler #  __putwc_xpg5__getwchar_xpg5__getwc_xpg5W__ungetwc_xpg5~.~__fputws_xpg5}__fputwc_xpg5__fgetws_xpg5 }__fgetwc_xpg5*long longlockf64}\}}*\truncate64}a**off64_ttell64}}ssize_tvoidpwrite64 *pread64+ *lseek64P}}ftruncate64}t}*ttruncate64}y**off_ttell64}pwrite64 *pread64& *lseek64K}}lockf64}p}}*ftruncate64}}*attropen64}}openat64}}}posix_fallocate64}1}**posix_fadvise64}c}**}cunsigned longcreat64}hmopen64}}attropen64}}openat64}6} }posix_fallocate64}e}**posix_fadvise64}}**}creat64}mopen64}}ftello64 fseeko64}2*}*2fsetpos64}^7*fgetpos64}^FILEtmpfile64freopen64fopen64ftello648fseeko64}^*}*^fsetpos64}cfgetpos64}^freopen64fopen64tmpfile647&os.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g os.c -W0,-xp.XAKk4DresWrMV3D.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DresWrMV3D.;backend;raw;cd;DBG_GEN 5.2.7'ireadJUfdFbufF lenFnK000"maskVfVV``consecutive_nulls؞intchar unsignedlong< # V __sigbits+# <sigset_t intreadUget_time/U#t #time_terrno_message0U,filenamepmlenpercentageUUnumdennum100long long POSITIONpercent_pos`U*pospercent#fractionperden#temp(; # *jmp_bufread_label;<reading:longjmpysetjmpy<<sigprocmasksigemptyset flushquitvoidecalloc& ; size_tstrlenEl@strerrormkstemps64mkstemp64mkstemps64mkstemp64## tm$ tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# __wcsftime_xpg5EEwchar_t__wcstok_xpg56 #wint_t__putwchar_xpg56f6unsigned charf__FILEY _cnt# _ptrw# _basew# _flagf# _magicf# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  |__putwc_xpg566Y__getwchar_xpg56__getwc_xpg56Y__ungetwc_xpg566Y#|__fputws_xpg5 __fputwc_xpg56> 6Y|__fgetws_xpg5n > __fgetwc_xpg56 Ylockf64   truncate64   off64_ttell64   ssize_t pwrite64 L   pread64 {  L lseek64   ftruncate64   truncate64   off_ttell64  read 9  L 9 pwrite64 n  > pread64   L lseek64   lockf64 ftruncate64     attropen64C    C openat64t H posix_fallocate64 posix_fadvise64   unsigned longcreat64     open64:   :  D attropen64w ? I  w openat64 | posix_fallocate64 posix_fadvise64   creat643  3open64]8|ftello64 ~]fseeko64fsetpos64fgetpos64 |FILE tmpfile64  $freopen64U) U _fopen64Zd|ftello64 fseeko64 snprintffsetpos64-fgetpos64O O Yfreopen64T^  fopen64tmpfile64time'output.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g output.c -W0,-xp.XAKk4DresWrMF4D.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DresWrMF4D.;backend;raw;cd;DBG_GEN 5.2.7put_line0?Uc1i2a3intcharobNܞflushb@Uncfddputchr>!Uc<putstrt0uU:srpostoavUnumbuf neg tbuf slong long POSITIONlong  linenumtoavU__numbuf neg tbufm s LINENUM ~ inttoaUnumbuf neg tbuf s    iprint_int ZULnum bufL  ]  iprint_linenum`U_num buf   less_printfU#fmtlparg s colpargap_string#p_int#p_linenum_# #PARGaget_return>U cerror@!Ufmtlparg col return_to_continue & 5 intr_to_abort&# c  intr_to_abortR#ierror/0~Ufmt,lparg, queryBU!fmt?lparg? cC colD4obuf!M,at_prompthfinal_attrneed_clr,errmsgsLgetchrglinesquish_checkungetccputbsat_switchat_exitat_enterclear_botlower_left1unsigned ;size_tstrlenGn6nstrcpysmkstemps64mkstemp64mkstemps64mkstemp64  tm$ tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst# &  __wcsftime_xpg5G  G!  wchar_t    __wcstok_xpg5 E    wint_t__putwchar_xpg5E u E unsigned charu __FILEh _cnt#_ptr #_base #_flagu # _magicu # __orientation;# __ionolock;#  __seekable;#  __extendedfd;#  __xf_nocheck;#  __filler;#   __putwc_xpg5E  E h __getwchar_xpg5E __getwc_xpg5E  h __ungetwc_xpg5E  E h   __fputws_xpg5'   __fputwc_xpg5E M E h  __fgetws_xpg5 }  M __fgetwc_xpg5E  h lockf64  truncate64   off64_ttell64   ssize_tvoid& . pwrite64 c  3 ;& pread64   c ;lseek64   ftruncate64 &  write   ;truncate645  off_ttell645[& [pwrite64  `;pread64  c ;lseek6455lockf64ftruncate64((2attropen64e-7eopenat64jposix_fallocate64posix_fadvise64unsigned longcreat6422open64\7\fattropen64akopenat64posix_fallocate64posix_fadvise64++creat64U0Uopen64Z ftello64 fseeko64 fsetpos64 fgetpos64  FILEtmpfile64$<Ffreopen64$wAK$wfopen64$| ftello645fseeko64 fsetpos64 fgetpos64@ @Jfreopen64${EO${fopen64$tmpfile64$y)pattern.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g pattern.c -W0,-xp.XAKk4DresWrM14D.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DresWrM14D.;backend;raw;cd;DBG_GEN 5.2.7?compile_pattern2 Upatternsearch_type comp_pattern&33comp pcomp!intcharvoidunsignedsize_t _regex_ext_t  re_nsub# re_comp# re_cflags# re_erroff# re_len# re_sc-#2regex_t compile_patternmOULpatternisearch_typei comp_patternicvt_patternnresulto uncompile_patternPUpatternpcomp is_null_patternUpatternmatchɰUpatternpattern_len bufbuf_lenpfoundpendpplppattern_endbuf_end match_patternUpatterntpattern lineline_lenspepnotbol search_type$matchedspatternEEEErmZflagsregoff_t Z rm_sp# rm_ep# rm_so# rm_eo# rm_ss# rm_es#regmatch_t2regfreek2regexecregcompkerrorcvt_textcvt_lengthecalloc8strlen\=mkstemps64mkstemp64mkstemps64mkstemp64freelongtm$ tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# __wcsftime_xpg5wchar_t__wcstok_xpg5& wint_t__putwchar_xpg5& V & unsigned charV __FILEI _cnt# _ptrg # _baseg # _flagV # _magicV # __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  l __putwc_xpg5& s & I __getwchar_xpg5& __getwc_xpg5&  I __ungetwc_xpg5&  & I  l __fputws_xpg5   __fputwc_xpg5& . & I l __fgetws_xpg5^ . __fgetwc_xpg5&  I long longlockf64   truncate64    off64_ttell64  ssize_t pwrite64 I    pread64 x  I  lseek64   ftruncate64   truncate64    off_ttell64   pwrite64 I    pread64 s  I  lseek64   lockf64  ftruncate64    attropen64  openat64O#posix_fallocate64~  posix_fadvise64  unsigned longcreat64open64attropen64R$Ropenat64Wposix_fallocate64  posix_fadvise64  creat64open648l ftello64 Y8fseeko64   fsetpos64  fgetpos64 l FILEtmpfile64freopen6400:fopen64d5?l ftello64 dfseeko64   fsetpos64 fgetpos64 freopen6444>fopen64h9Ctmpfile64A*position.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g position.c -W0,-xp.XAKk4DresWrMl5D.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DresWrMl5D.;backend;raw;cd;DBG_GEN 5.2.7+long long2POSITION?tableN position*U?where(intadd_forw_pos?U?pos=i@add_back_posPU"?posNiQpos_clear`MURiapos_initlPUscrposm scrpos  pos?# ln#onscreen}U?posi empty_screenUempty_linesU\se iget_scrposUscrposiadjsline֐Uslinetable_size,void ecallocchar  mkstemps64; mkstemp64X mkstemps64{ mkstemp64freelongunsignedsize_t tm$u tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# u __wcsftime_xpg5zwchar_t __wcstok_xpg5wint_t __putwchar_xpg5+unsigned char+ __FILE _cnt# _ptr<# _base<# _flag+# _magic+# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  A __putwc_xpg5H__getwchar_xpg5 __getwc_xpg5 __ungetwc_xpg5A __fputws_xpg5 __fputwc_xpg5A __fgetws_xpg53 __fgetwc_xpg5T lockf64y2 y truncate64~22off64_t tell64ssize_t pwrite64 2 pread64@  2 lseek64e  ftruncate64 2  truncate64  22off_t tell64   pwrite64  2 pread64;  2 lseek64 `   lockf64 2 ftruncate64 2    attropen64     openat64   posix_fallocate64F 22 posix_fadvise64x 22 x unsigned long creat64 }    open64      attropen64     openat64K   posix_fallocate64z 22 posix_fadvise64 22  creat64     open64  A ftello64!  fseeko64G 22G fsetpos64s L 2 fgetpos64 s AFILE tmpfile64     freopen64         fopen64 , A ftello64 M, fseeko64s22s fsetpos64x fgetpos64s    freopen64     fopen64 0 tmpfile64  ,prompt.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g prompt.c -W0,-xp.XAKk4DresWrMV6D.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DresWrMV6D.;backend;raw;cd;DBG_GEN 5.2.7char.long6R;s_protoC+V64y;3s_protoh+V.;m_proto-3WM;Lm_proto-3W.;M_proto/Wf;eM_proto /W.1E;e_proto61W1Tl;Se_proto[1W.;h_proto3:XP;Oh_proto3:X.;w_proto5X;w_proto5X.$8;more_proto)7V$;b;:more_protoQ7V. { eqproto;.  hproto<.  wproto= init_promptG~U ap_strVU2 2sTlen7W .int ap_chargUy .cebufyh.; ap_posu JU possbufvlong longPOSITION.; ap_linenumPzU7 7linenumbufELINENUM.V; ap_intU 7numbuf. ; ap_questUcurr_byteU 7whereposcondU7L .c 7where len protocharU 7c 7where 7iseditprotoposlenn7linenum7last_linenum7h!void skipcond@U2m2piflevel7wherecharU22pwp 7pr_expandU232proto7maxwidth p2c7where7eq_message( >U2pr_string4@U2prompt25type76wait_messageE!U2mp2@0.;message?42  ; prproto:inttoalinenumtoapostoacurr_tag7ntags7adjsline7positionpercentage7currline7find_linenum7get_index7get_filename2nifile7next_ifile!eof_displayed7ch_getflags7ch_lengthsave2. W unsignedstrncpy2 2\ a . a size_tstrlen   . . strcmp7   mkstemps647 27mkstemp6476 2mkstemps647Y 27mkstemp647v 2 ;; { tm$ tm_sec7#tm_min7#tm_hour7#tm_mday7# tm_mon7#tm_year7#tm_wday7#tm_yday7#tm_isdst7#   __wcsftime_xpg5 Z v   # wchar_t Z Z j e __wcstok_xpg5e  e o t ;wint_t__putwchar_xpg5   unsigned char __FILE _cnt7#_ptr #_base #_flag # _magic # __orientationa # __ionolocka #  __seekablea #  __extendedfda #  __xf_nochecka #  __fillera #  __putwc_xpg5    __getwchar_xpg5 __getwc_xpg5 * __ungetwc_xpg5 Q  ; Q __fputws_xpg57V[__fputwc_xpg5   __fgetws_xpg5e e 7__fgetwc_xpg5  lockf647"77. "truncate647O'off64_ttell64Ow77ssize_t pwrite64wwa  pread64wwa lseek64O7O7ftruncate64727. 2truncate647_7off_ttell64_7 pwrite64wwa pread64wwa lseek64_ 7_7lockf647.77ftruncate647R7. R. \attropen647Wa7. openat64777posix_fallocate6477posix_fadvise647!77. !unsigned longcreat647\&+. \open647a7. . attropen6477. openat64777posix_fallocate647#7posix_fadvise647U77. Ucreat647Z+. open6477 ftello64Ofseeko647[7 fsetpos647[ fgetpos647C[ FILE Ctmpfile64N. f. pfreopen64NkuN. . fopen64N ftello64_fseeko647[7 fsetpos647H[!fgetpos647j[. j. tfreopen64NoyN. . fopen64Ntmpfile64N-search.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g search.c -W0,-xp.XAKk4DresWrMF7D.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DresWrMF7D.;backend;raw;cd;DBG_GEN 5.2.7hiliterhl_nextr#hl_startpos#hl_endpos# .long longwPOSITIONhilite_anchor.7filter_anchor.80set_patternQ0U&& 6infoM patternM &search_typeMintunsigned-size_tvoidF _regex_ext_tS re_nsub9#re_compN#re_cflags&#re_erroff9# re_len9#re_scb#gregex_tcharpattern_info 6compiled#text#search_type&# clear_patterni)Ul 6infog init_patternv0SU 6infot init_search`Uget_cvt_opsU&ops&is_ucase U&G strstr_endchXunsigned longGLWCHARprev_patternU& 6inforepaint_hiliteU) &onslinenum&posepossave_hide_hilite&clear_attnpUslinenum&old_start_attnposold_end_attnposposeposmoved&undo_search pUclr_hlist3DUVranchor1hlr4nexthlr5clr_hiliteBPdUclr_filterHpUis_hilited_rangeSU&posPeposPhlrTis_filteredhuU&2posfhlriis_hilitedU&posepos&nohidep_matchesmatch&&add_hiliteU ranchorrhl ihlrhilite_lineUlineposline&line_lenchposspep &cvt_ops$searchpline_endhlrchg_caselessUhilite_screen'LU@ scrpos@ (scrpos f pos#ln&#chg_hilite6PsUsearch_posKFU &search_typeIposLlinenum&Msearch_rangeP U&0 posendpos&search_type&matches&maxlines 0 plinepos$0 pendpos(lineclineline_len&linenum5 spepline_match&cvt_ops&cvt_len&chposlineposoldposx x x  S  S  S line_filter& S  S  S hlrwLINENUMhist_patternL [ U& &search_typeJpatternNsearchw` U& &search_typespatterns &nsposxprep_hilite1U+sposepos&maxlinesnprep_startpos nprep_endpos new_epos max_epos result& i&W   search_type&sset_filter_pattern@U~pattern&search_type is_filteringU&filter_infoG search_infoFis_ucase_pattern&/0is_caseless&.prep_endpos-(prep_startpos, hide_hilite&+adjsline&get_scrposempty_screen&positionmatch_pattern&is_null_pattern&uncompile_patterncompile_pattern&errorput_linefind_linenum5 add_lnumback_raw_lineforw_raw_linejump_locrepaintforw_linecvt_textcvt_alloc_chposcvt_length&cmd_lastpatternset_mliststep_charXch_getflags&ch_lengthch_end_seek&goto_linelower_leftecallocNfstrlen9kstrcpymkstemps64&&mkstemp64&mkstemps64&&mkstemp64&3freeGNabs&^&long^^ktm$tm_sec&#tm_min&#tm_hour&#tm_mday&# tm_mon&#tm_year&#tm_wday&#tm_yday&#tm_isdst&# u__wcsftime_xpg59Jf9pwchar_tJJZU__wcstok_xpg5UU_d^wint_t__putwchar_xpg5unsigned char__FILE_cnt&#_ptr#_base#_flag# _magic# __orientation-# __ionolock-#  __seekable-#  __extendedfd-#  __xf_nocheck-#  __filler-#  __putwc_xpg5 __getwchar_xpg5__getwc_xpg5__ungetwc_xpg5A^A__fputws_xpg5&vFK__fputwc_xpg5__fgetws_xpg5UU&__fgetwc_xpg5iswupper& ^lockf64&.&&w.truncate64&[3wwoff64_ttell64[&&ssize_tFpwrite64-wFpread64-wlseek64[&[&ftruncate64&>&w>truncate64&kCwwoff_ttell64k&Fpwrite64-wpread64-wlseek64k&k&lockf64&:&&wftruncate64&^&w^hattropen64&cm&!openat64&&&!posix_fallocate64&&wwposix_fadvise64&-&ww&-creat64&W2GWopen64&\&!attropen64&&!openat64&&&!posix_fallocate64&&wwposix_fadvise64&P&ww&Pcreat64&zUGzopen64&&!ftello64[fseeko64&Kw&wfsetpos64&Kwfgetpos64&>KFILE> tmpfile64Iakfreopen64IfpIfopen64Iftello64kfseeko64&Kw&wfsetpos64&CKfgetpos64&eKeofreopen64IjtIfopen64I tmpfile64I0signal.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g signal.c -W0,-xp.XAKk4DresWrM17D.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DresWrM17D.;backend;raw;cd;DBG_GEN 5.2.7Hu_interrupt.U]]type,intstopJ PU]typeHwinchZPU]typeXinit_signalsU]onpsignals5Ultsignals]old_width]old_height]sigs]long kill]  ]  ]   ]  signal ]  flush intread calc_shift_count calc_jump_sline clear_bot bell deinit init get_term raw_mode quitchar u mkstemps64] } ] mkstemp64] } mkstemps64] } ] mkstemp64] } unsignedsize_t tm$tm_sec]#tm_min]#tm_hour]#tm_mday]# tm_mon]#tm_year]#tm_wday]#tm_yday]#tm_isdst]# *  __wcsftime_xpg5   % wchar_t    __wcstok_xpg5 I   wint_t __putwchar_xpg5Iy Iunsigned char y__FILEl_cnt]#_ptr#_base#_flagy# _magicy# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#   __putwc_xpg5I I l__getwchar_xpg5I __getwc_xpg5I l __ungetwc_xpg5I I l   __fputws_xpg5]+   __fputwc_xpg5IQ I l  __fgetws_xpg5   ] Q __fgetwc_xpg5I llong long lockf64] ] ] u  truncate64]  off64_t tell64) ]]ssize_tvoid7 ? pwrite64)t ) D   7 pread64) ) t   lseek64 ]  ] ftruncate64] ] u  truncate64]  off_t tell64 ? ]7 ? pwrite64)t ) D   pread64) ) t   lseek64  ]  ] lockf64] ] ] pid_tgetpid  ftruncate64]( ] u ( u 2 attropen64]e - 7 ]u e openat64] ] j ] posix_fallocate64] ]   posix_fadvise64] ]   ]u unsigned long creat64]2  u 2 open64]\ 7 ]u \ u f attropen64] a k ]u openat64] ] ] posix_fallocate64] ]   posix_fadvise64]+ ]   ]u + creat64]U 0  u U open64] Z ]  ftello64  fseeko64]   ] fsetpos64]   fgetpos64]  FILE  tmpfile64$ u < u F freopen64$ w A K $ u w u fopen64$  |  ftello64  fseeko64]   ] fsetpos64]  fgetpos64]@  u @u J freopen64$ { E O $ u {u  fopen64$   tmpfile64$ 41tags.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g tags.c -W0,-xp.XAKk4DresWrMl8D.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DresWrMl8D.;backend;raw;cd;DBG_GEN 5.2.7char*tags2Lklong longPLINENUMtagnextK#prevK#tag_file2#tag_linenum]# tag_pattern2#tag_endline*#taglist tl_firstK#tl_lastK#taglistCD cleantags\@UTtpK] maketagentwxUK 2nameq 2fileq ]linenumq 2patternq endlineqtpKxint gettagtype|Uf findtagUn 2tagtyperesultn tag_resultTAG_FOUNDTAG_NOFILETAG_NOTAGTAG_NOTYPETAG_INTRtagsearch0UPPOSITION nexttag۠U2. ntagfile2 prevtagVU2r ntagfile2ntags`sUcurr_tagUfindctagUn2tag p2ftaglentaglinenum]tagfile2tagpattern2tagendlinesearch_charerrtlinetpKunsigned charunsigned__FILE_cnt#_ptr#_base#_flag# _magic# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  FILElong*edit_tagfile}7Uctagsearch@Uposlineposlinenum]lenline2findgtag-#Unb 2tagtype bufb fptpK3 X X command2flag2qtag2cmd2 " " " "!n"!n"name2 file2 line2 len!_!!!!!!c0*u circularXPnextgtaga@##U2 tpKbprevgtag#?$U2 tpKgtagsearch@$$Ugetentry$X(U 2buf tag  file linep22curtagKK4curseq<total8errorgetnumfind_posfind_linenum]add_lnumforw_raw_lineshell_quote2shell_unquote2editlgetenv2skipsp2void ecalloc * * strncmp   * size_tstrlen   * strcpy23 2 *3 *= strcmpf 8 B mkstemps64 2mkstemp64 2mkstemps64 2mkstemp64 2free  * atoi  ! tm$ tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst# +  __wcsftime_xpg5   &  wchar_t __wcstok_xpg5 J wint_t__putwchar_xpg5JzJ__putwc_xpg5JJz __getwchar_xpg5J__getwc_xpg5Jz__ungetwc_xpg5JJz__fputws_xpg59 __fputwc_xpg5J_Jz__fgetws_xpg5  ___fgetwc_xpg5Jzlockf64P*truncate64PPoff64_ttell64*ssize_t 8pwrite64*m*=P pread64**mPlseek64ftruncate64P*truncate64PPoff_ttell648 8pwrite64*m*=Ppread64**mPlseek64lockf64Pftruncate64Pclose**(attropen64[#-!*[openat64`!posix_fallocate64PPposix_fadvise64PP*unsigned longcreat64(*(open64R-!*R*\attropen64Wa!*openat64!posix_fallocate64PPposix_fadvise64!PP*!creat64K&*Kopen64uP!ftello64ufseeko64PPfsetpos64Pfgetpos64 tmpfile64*"*,freopen64]'1*]*gfopen64blftello64fseeko64Ppclose**popen$P$fsetpos64P)fgetpos64rfgets22fgetc*sprintf2!**freopen64**fopen64H#fcloseb tmpfile64"fopen64#fopen$open64#open( [3ttyin.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g ttyin.c -W0,-xp.XAKk4DresWrMV9D.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DresWrMV9D.;backend;raw;cd;DBG_GEN 5.2.7xopen_getchr$`((Uclose_getchrZ((Ugetchrf()UcgresulthintcharttyDireadquit  mkstemps64    mkstemp64*  mkstemps64M   mkstemp64j long junsigned wsize_t j tm$3tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst#  3 __wcsftime_xpg5o r   8wchar_t o o  z __wcstok_xpg5z z   jwint_t __putwchar_xpg5 unsigned char __FILE_cnt#_ptr#_base#_flag# _magic# __orientationw# __ionolockw#  __seekablew#  __extendedfdw#  __xf_nocheckw#  __fillerw#   __putwc_xpg5  __getwchar_xpg5 __getwc_xpg5?  __ungetwc_xpg5f   j f  __fputws_xpg5 k p __fputwc_xpg5    __fgetws_xpg5z z   __fgetwc_xpg5 long long lockf64D     D truncate64q I  off64_t tell64q  ssize_tvoid   pwrite64   w   pread64   w  lseek64q8  q  ftruncate64\    \ truncate64 a  off_t tell64    pwrite64   w  pread64   w  lseek643    lockf64X    ftruncate64|    |   attropen64      openat64    posix_fallocate64    posix_fadvise64K      K unsigned long creat64 P U  open64    attropen64   openat64   posix_fallocate64M    posix_fadvise64       creat64 U  open64   ftello64q fseeko64 p     fsetpos64F p   fgetpos64m p F FILE m tmpfile64x    freopen64x  x   fopen64x   ftello64 fseeko64F p    F fsetpos64r p K fgetpos64 p F   freopen64x  x   fopen64x  tmpfile64x open64" opengx4version.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xannotate=no -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g version.c -W0,-xp.XAKk4DrfsWrMF_D.Xa;g;R=Sun C 5.10 SunOS_i386 2009/06/03;G=.XAKk4DrfsWrMF_D.;backend;raw;cd;DBG_GEN 5.2.7charlong0Q8version@T /var/tmp/less-436/usr/include/sys/usr/include/isomain.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h@FZ a k }       Ŗ ʖ ϖ   }4 > C r z ֗     zU _d p   Θ     (/ 9 M h|     dЙ"ڙ     $8 G L Q ] i   Ě Κ ښ    * 4 DN Z_ d p w    ƛٛ       &> E ] c pv}     Ĝ Ԝ ݜ      q?E PS[ h p z         ͝  /var/tmp/less-436/usr/include/sys/usr/include/isoscreen.ctermios.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.hН֝   b ltĞԞ$4DTdtJ;ğ ֟͟    Td {  $ < L~]l    ʡ ҡ      &? p z    Ԣ ޢ    ( 2 < O `fs:      ڣ     & 0 J ` z    Ԥ ܤ      ( 0 D L ` h |       ʥ ԥ ݥ  ~  @Ic l v      Ԧ    $O Y c   Ƨڧ   1 ; F \ f q      Ǩ ݨ      B L Wm    ȩө    @ l    ê ת   1 9 B P \{   ǫ ϫ ث    6 Pf p {     ŬϬ ܬ   ! ' 06 @ W _ py      ĭ ̭     + 6? H Ld o      ٮ     $ 8= G PS ] ` j     ï د . #8@CPSw  5аӰݰ     (103= T i pv        бӱ   $ / D O dl ps    IJ ٲ   ' . I N \ `fw     ȳ ѳ ڳ   /var/tmp/less-436/usr/include/sys/usr/include/isobrac.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h-C n v     д ߴ   + 2 B J T k t   /var/tmp/less-436/usr/include/sys/usr/include/isoch.cstat_impl.htypes.hless.hstat.htime_impl.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.hƵ  , 7 h  ׶ ݶ   v< W   ɷӷ ޷    & {  ' 4 g v {    ¹ й    ?G T \k p w    "*2 COV` ǻ Ի޻  Nl Լܼ  % 4 < @CM T      ~ν ؽ  7 Z a w }    y̾ ܾ o &= g m  | ƿп ܿ   , L         {%0H o v        ' 0~:A PVp |     }     &0 D N d w      06@ L T \ h z        ,K X         * 4 @FP X k  ~ 2 A b      4 H N       ,};@FV a  |   + 9M k z         / H \ l z           # +; E U `fp |  W  /var/tmp/less-436/usr/include/sys/usr/include/isocharset.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h            ,mdn }   ]&    &: H\ t } {      y   + 2 @FW i |   y       'y3       z & 06H [ `r      j ~           4 ? O `fq      $ He n      $ 7 \f m |   (B Q e n}}         $ 0 @ L S `fy         $3 I T~cj pv|,| W+ &:d n   4 d r   ( 6c    I v    ' 06? IQ         ' . I Q l s |            x  06O `f    |  L /var/tmp/less-436/usr/include/sys/usr/include/isocmdbuf.cstat_impl.htypes.hless.hstdio_impl.hstdio_iso.hstat.htime_impl.htime_iso.hwctype_iso.h &C PS^ l v            & K S ] h x     o % , 8 J Q}]c pv~           " * < O ` h q y        "( 06? d         & 6 8 @ N [wi w      x    # ( C Py] m pv   |     &y2 ? G L Z `ft {  |    $0 8 M ] d           z "0 8 B V ^ `|j|         7 G Yp           |',<c l s      6 ; U\ pv      & + 9 IV ` g ps{           0 I N \ c pv         #- 0 C O `fm w         ' 5 : H T ^ x }            , 1 ? L V d n |           (4 > H|    , 4 9 DxP W `fm t |     0 < @~R] l            , 3mIO `fp         " 8J R h{   {  ' , 8 @LV i       = B T \ e x |          . A PU l {         " 8J [ `h lz{    ( G Q p         + ? k x       09 @K V \ v        7 U c h{    j( 06 =O W h p w     |         ( 2 9 C J R X l z       ) :P ao ; /var/tmp/less-436/usr/include/sys/usr/include/isocommand.cless.hoption.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h          #2 @M \ f k p           $1 D S c pv             ' ,y9 E PV[ c hz          ' , F P X |             * @ S Xb h |  ( 4_y          z  '  ,  8 [  `  l  y  ~        j            *  /  @ L m  |                .  =  B  G  Y  c  {       z            ,  C  P i  q  w                                       jj r         ~  #, JO X_ ps           ( 2 <A F K S [ `f|   $. 3 8 B J T c w         (2 F PT`lxm      & 8 G PV] e t          #(5 H W _ d k px           " .38 = G L T \f l t z   m        .6 DL Q Xo t        #< Q V h p        # ( : @Y o t         ) > C M b t |       }      * ? Q Xq {          + 5 N d n s         # (5 < A I Z `e j p             * C Y ^ f lv {     0 8@ v       b j pu |             ! ( 5 < _ n t ~         #  8 Y  e              ! ! K! \! d!}! ! ! ! ! ! ! ! ! ""-" C" V" ^" m" t" " " " """ " # # #)# 0# 8# K# S# X# `# s# # # # ## # # # ## # # # #$  $ $$ )$ 0$ K$ S$ X$ e$ l$ $ $ $ $ $ $$ $ (% 0% 5% C% H%R% a% h% % % % % % % % % % &  & &)& 1& 8&Q& `&& & & & & & ' 'P' b' l' t'~' ' ' ' ' ''' 'z'( # /var/tmp/less-436/usr/include/sys/usr/include/isocvt.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h(((( ) ))-') 6) C) R) X) `)f)n) |) ) ) ) ) ) )) 8* U*\* d* * *~** * * * *^ +%(+ /+ :+ B+ N+ V+ h+  /var/tmp/less-436/usr/include/sys/usr/include/isodecode.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.hp+v+++ + + + + + + , !, -, H, T,kd,v,~, , , , , , , , -W-- -#-5- G-X-l-- --- -- - - - - - .  . ..-. <. @.C.]. l. p.s.. . ... . . . /  / "/ */ 2/@/M/ ]/ h/ |/ // // / / / 0  0 0 &0 90 90 L0 S0s0z0 0000 0 0 0|00 0 0 111 0161O1 `1f11 1 1 1 1 1 1 1 1 1 22)2 T2 Z2 `2f22 2 2 2 222 2 2 3 3!3 13 :3 @3 Q3 a3 j3 p3 3 3 3 3 33h44 44 4 ,4=4 N4 \4 d4 p4 4 44 4 4 4 4 +5 95 G5 T5 k5 y5 5 5 55 5 6 6676 L6 T6 h6 y6 6 6 6 6 6 6 666 6 6 77 7 7 !7 -7 47 G7 O7 Z7 \7c7 h7{u7 777 7{7 777 7z7 77 7~ 88 "8 (8 8  /var/tmp/less-436/usr/include/sys/usr/include/isoedit.cstat_impl.htypes.hless.hstat.htime_impl.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h@8F8c8 p8y88 8 8 88 8 88 9 /9 69 H9 P9 b9 l9~9 9 9 9l9999 9 9 9 : : : ': 2: <: B: P:V:^: l: w: : : : : : : : : : : : ;;; ;&; <; N; S;X;b;; ; ; ; ; ;;; ; <  <)<4<@< E< M< W< _< d< << <<< <<< < = %= ,= 4= D= Z=b= p= = = = == = = = > > > ,>4>@> N> \> u>> > > >> >> > ? ? $? ,? 4? B? J? R? Z? j? }? ? ? ?? ?? ? @ @@ *@8@ Y@ ^@ h@ r@ w@ |@ @ @ @@ @@ @ @@@ @A  A +A I|JIUI [I `IfIxI I I I III I I I I IIJ  J&J.J ?J FJ MJTJ fJ mJ J J J JJJmJJ JJ  K#K +K XKdK {KK K KvK K K KKK  L1L BL JL XL zLL L L L LL L L LLM M (M/M @MFMMM cM hMMM MM M M NN N $Nc@N~WN#iNoN N NN N N O O 8OSO iOlO O OkO~OO O OOO OP P .P?P PP ePsP zP P P P PPPP P Q Q 7Q GQ eQ Q QQ Q R  RwR*R 0R6R[R qR R R RRR R R 0S 8S FSSS ^S oS S S S S SnSS S S SSS T (T 0T LTqT T T T T TTT U UU 'U 4U EUMU `U iU zU U U U U U UV V LV ZV nV V V V V V V W W %W 3W ?W MW [W dW rW W W WWWW W W W X X X X*X4X JX XX}X X X X X XXX X YY (Y 7Y @Y IY `YqY Y YY Y YYY Y Y Y Y Z c Pc hcmc pcc ccc c c c  d dd d ,d 6d @d Jd Xd _d  /var/tmp/less-436/usr/include/sys/usr/include/isohelp.ctypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h /var/tmp/less-436/usr/include/sys/usr/include/isoifile.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.hpdsd8}d d d ddd d d d d dd  e e  e#e2e Ae Re ]e `efeue e e e e e e e eee ee  f f $f 2f Cf Qf `ffff f f f fff f f f ggg (g Ag Lg Sg `gfgng ggg g g~gg ggg h h  h&h.h 8h Ah PhVh_h phshh hhh hhh hhh hhh iii  i&i/i @iCiLi  /var/tmp/less-436/usr/include/sys/usr/include/isoinput.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.hPiYi8oi ti ii i  j j (j4jAj Fj \j dj lj pj xj }j j j jj j j j j j j k k 'k >k Fk Kk dk sk xk krkk kk k k k kl  l $l 4lp Cp \p dp lpp p pp p p p p p p p p q  q q$q 9q >q Tq kq sq {q q q q q q q qq q q r r $r )r Ar}\rdr vr rrr rr rr ss,s As HsPs Xs `s ps ts s s ss s s s s s ! /var/tmp/less-436/usr/include/sys/usr/include/isojump.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.htt"t t $t)t.t 9t Ot et tt t t ttt u u !u y Hy ty y y yy yy y y zhzz 'z 0z 5z ?z Oz oz  /var/tmp/less-436/usr/include/sys/usr/include/isoline.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.hzzz z z z z z { { #{ 0{6{E{V{ g{ w{ { { { { {{ { { { |  | | |  |&|5| @|C|M| W| a| k| u| | | | | | | |||| |} } \} t} } } }}} } } } ~  ~ ~ 3~ B~ O~ \~ i~v~ ~ ~ ~|~~~~ ~~   $ 2M \      B D{dls    ΀  ! ,3 < t       % T   ł     3> @ I R Z ax  }̃ԃ     . 9 E P \ g s ~     Ʉ Մ         06>x       < ^    ƆԆ . < Y |    xׇ އ  & 8 D W `zkr   È Јֈ    / @IR Z b     & 4 @ G P l s |      % :D Pk   |͋ ԋ  DW f h~w Ȍ     /A   Ѝ   8 H~Za pv  ŽՎ ߎ      ) : HR x   ȏ     4 H h u   А   ' / 4 X l    ϑ֑    % L V     ے     ! , 6 D P \ d m s   ߓ  , 0yH ؔ ;L   ܕ   ' PV] g    ˖  ,5 A W {} ՗   3 W k    ØИ ޘ      ) L^ r      ' , 9 CZ \r z |       Кٚ # < D \d y    ț Лڛ   + J U k p x      /var/tmp/less-436/usr/include/sys/usr/include/isolinenum.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.hƜٜ      . D Z p    Ɲ  }(. 7 AI X` js |     Ȟ ֞      # 2{H\ p  Ÿ ̟ ߟ       09C\ r נ נ   $. cl    ֡    2 H Mtv آ   *H U Z p   tˣ  4W W {   ٤   @^ k   w  @^ k   wڦ  * 5 ^ y   ħ ڧ    E /var/tmp/less-436/usr/include/usr/include/iso/usr/include/syslsystem.cless.hstdio_impl.hstdio_iso.htypes.htime_iso.hwctype_iso.h );5 @E T b qy    ¨֨    % <M U z   Ʃ ҩ    ! / =I U ] k z       ƪڪ    $ 5 G O x   «     &; J Xt       Ƭ ˬ ׬  MU ] d ϭ ԭw/G O W \ Ǯ ̮z    !- 4  /var/tmp/less-436/usr/include/sys/usr/include/isomark.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h@F*U t  5  ȯ ܯ     ) 3 ? DN ] l u      ʰ аٰ     $ 0 4M`5f pv   ı ұ     & < @ X b pv   ò ײ    4 @FW _ t     Ƴճ  ~%  /var/tmp/less-436/usr/include/sys/usr/include/isooptfunc.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h &0 ? D LT \ i x      Ĵ Դ ٴ ܴ    c#@CM ] `fhn       ĵt̵еֵܵ     $ ,D L `h rx    ȶ ݶ        X/*@CM P i pv|    ķ ̷    " * @W h }      Xϸ*    + 1 B DxL PV\d l v    ع     f%068@ D U h l t  tº кں  p  , D \ p   x    # 4 8iG`chx | v  yü      + : I X g s xmɽ ӽ   $ < Q q   v ʾ о ۾    " : E Y |п     Z/(@FLX l t               f038G L Xyg    9  /var/tmp/less-436/usr/include/sys/usr/include/isooption.coption.hless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h5        x5 ? DK R bhp|           $+ 2 8 B I LL;     $* Y n t {         $5 AH PX l           5 8 D L T q tW. ~ ) 1 B S Xn         z ' 3? DHs x    v     / 4u xt z      s$(^i     k.D N       &7 ? H ] pv       " 06B P \ e {     t<@mW] pv~              # < C [ }            ( @ [ b}       ' 1 7 @FP \ }  /var/tmp/less-436/usr/include/sys/usr/include/isoopttbl.coption.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h      x) 06K W ` } {         & - 4 ; B[p          . 0bCyX{q.y        /var/tmp/less-436/usr/include/sys/usr/include/isoos.cselect.htypes.hless.hsetjmp_iso.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h " 05 ?V `h x          $ * 09Lq        P `o     0p \ /var/tmp/less-436/usr/include/sys/usr/include/isooutput.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h4       y8 = @FS [ `            06B g s  &6 D U `fz          & K R}^` y     nw  . < @FMX l v {              038 = I Y h m r |               /var/tmp/less-436/usr/include/usr/include/sys/usr/include/isopattern.cregex.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h &3B H _ m |    8    . 6 D J PV\ g x      ~*2 : C K T `usz   % -9 E3  y /var/tmp/less-436/usr/include/sys/usr/include/isoposition.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h*    w  . N ` z       6 H PYf lv           ( : R \~nu    ~  7 A Y \{n       h /var/tmp/less-436/usr/include/sys/usr/include/isoprompt.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h , @ T h |           &: H PVj x      0 [ q |       <L@  S/     ! ( 8 @ T q       2 E L        2 D I P [         ( 3 \     ( O T_ u           # @ E L@FM PW \d l p   Z'     , 8 T hy}    , B HZ ` g y            % 07 JjlX~.      &9 @F    0 /var/tmp/less-436/usr/include/usr/include/sys/usr/include/isosearch.cless.hregex.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h06> L e p {           ' 03= G Q `cr                 &<D Y l x|          $ .8 = E L` t      x       1 B n x }          / = B Itai n pv      }  B PSb ps  | # ,< O X}ip   # + 4 <F P\ nx    }  " - y          $ G X` h p |       > J PSX b lq           8K _ j     |   |2> PVl x       , B \~        6  B  W  \ d  w            $  3  B  S  k           . <  J  R  a  l z                        ,  6 J  O V ` f ~               (  -  < V  d w                      ' 4f n      ) 08 LX g       % 8Pc   KW           , @C H \ p        /var/tmp/less-436/usr/include/sys/usr/include/isosignal.ctypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h.     #2 ? I N PSb o y ~   &5A F K P \ h t             ' 3 Y  /var/tmp/less-436/usr/include/usr/include/iso/usr/include/systags.cless.hstdio_impl.hstdio_iso.htypes.htime_iso.hwctype_iso.h@FX v }       " * 8Z m s          0 < O W e p w          s06@ T o |         ( 0 K Q `fn         5 A H         # 4 @ HO l x        |   * P          2 @FW mz      $. J `       $ ) 3; G X m           q      m             !!)! :! H! _! }! !! !!!," c" n"\"&" " " " "" " #  # # # @#F#P# \# g# q# {# # # ## # # ### # # # # $ $ $$$ /$ :$ @$F$P$ d$ $ $$$ $ % % "% s% % %% % K&d& p& y& & & & & O' [' h' q' ' ' ' 'C( L( S( K /var/tmp/less-436/usr/include/sys/usr/include/isottyin.ctypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h`(c(w( ( (((((( ( ( (((( ( (  ) 5/ /var/tmp/less-436version.c DD%$> I4I?  : ;  I: .?  6 : ; @ ID I: ;  4I : ;   .?  : ;@ ID  I: ; 4I : ; .?  : ;@ D  :  I8 .? < D .? < ID &I.? < ' ID I.? < ' D  I8 .? < ' ID  DD%$> 4I : ;  4I?  : ;  .?  : ;@ D I: ; 4I : ;   D D I: I  !I/  :  I8 . : ;@ ID  I.? < ID .?  : ;@ ID I !I/. : ;@ D .?  : ;@ D . : ;@ D &I.? < ' ID I.? < D  I8 .? < ' ID  DD%.?  : ; @ D I: ;  4I : ;  .? < ID $> I: ID I .? < D .? < ' ID  I &I :  I8  I8 .? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: 4I : ;  .?  : ; @ ID   4I : ;   I8 II !I/  : I !I/  : .?  : ;@ D I: ; . : ;@ ID .?  : ;@ ID .?  : ;@ ID . : ;@ D 4I?  : ;  .? < ' ID I.? < ID .? < D !.? < ' D " I8 #.? < ' ID $%&.< ' DD%$> 4I?  : ;  I  I8 I !I/ I  4I : ;  . : ; @ D  I: ;  . : ; @ ID . : ;@ D  4I : ; .?  : ;@ D .?  : ;@ ID I: ; I: I!I!I/. : ;@ ID .? < ' ID I&I.? < D .? < ID  :  I8 .? < ' ID ! DD%. : ; @ ' ID I: ;  $> &III: 4I : ;  4I?  : ;    I8 .?  : ; @ D .?  : ; @ D  .?  : ; @ ID . : ; @ ID . : ;@ ID I: ; 4I : ; . : ;@ D . : ;@ ID .?  : ;@ D .?  : ;@ D .?  : ;@ ID .?  : ;@ ID I !I/ :  I8 I !I/ .? < ' ID !I".? < D #.? < ID $.? < ' D %.? < ' ID &'(.< ) DD%$> I4I : ;  . : ; @ D . : ; @ D I: ;  .?  : ; @ ID . : ;@ ID  I: ; 4I : ;  I !I/ I:  :  I8  : D . : ;@ D . : ;@ D .?  : ;@ D .?  : ;@ ID .? < ID .? < D &I.? < ' ID I.? < ' D  I8 .? < ' ID  DD%.?  : ; @ ID I: ;  $> 4I : ;  I.?  : ; @ D   I: .? < ID .? < D &I .? < ' ID I :  I8  I8 .? < ' ID  DD%$> I!I4I : ;  I !I/I  I   I8 . : ; @ D  I: ;  .?  : ;@ D . : ;@ ID I: ; 4I : ; .?  : ;@ D . : ;@ D .?  : ;@ ID I:  : !I/ .? < D .? < ID &I.? < ' ID I.? < ' D  :  I8 .? < ' ID !"#.< $ DD%. : ; @ ' ID I: ;  $> &III: 4I?  : ;  .?  : ; @ D  4I : ;   :  I8 .?  : ; @ ID . : ; @ D  4I : ;  : I !I/ .?  : ;@ ID I: ; .?  : ;@ ID . : ;@ ID .?  : ;@ D .? < ' ID I.? < D .? < ID .? < ' D  I8 .? < ' ID !".< # DD%. : ; @ ' ID I: ;  $> &III: .?  : ; @ ID  4I : ;   . : ; @ ID  .?  : ;@ ID  I: ; 4I : ; I !I/. : ;@ ID  :  I8  I8 .?  : ;@ D I !I/ .?  : ;@ ID .? < ' ID I.? < ID .? < D .? < ' D .? < ' ID  !.< " DD%$> 4I?  : ;  . : ; @ D .?  : ; @ ID 4I : ;  I: .?  : ; @ D .?  : ; @ D  I: ;  .?  : ;@ D  I: ; 4I : ; .?  : ;@ ID .? < ID .? < D I.? < ' ID I&I :  I8  I8 .? < ' ID  DD%$> &II !I/4I?  : ;  I.? < ' ID  I I:  :  I8 I8 .? < ' ID  DD%  I8 I$> I:  : 4I : ;  . : ; @ D  I: ;  . : ; @ ID  .?  : ; @ D  .?  : ; @ ID .?  : ; @ ID .?  : ;@ D I: ; D D .?  : ;@ ID .? < D .? < ID &I.? < ' ID I.? < ' D  I8 .? < ' ID  DD%.?  : ; @ ID I: ;  4I : ;  $> I: .?  : ;@ D I: ; 4I : ; .? < ID .? < D I .? < ' ID I&I :  I8  I8 .? < ' ID  DD%.?  : ; @ D 4I : ;  $> I: I: ;  I :  I8  :  .? < D .? < ID .? < ' ID I&I I8 .? < ' ID  DD%$> I4I : ;  4I?  : ;  I !I/ .?  : ; @ D . : ; @ ID  .?  : ; @ ID  I: ;  I: .?  : ; @ D  . : ; @ D 4I : ; .?  : ;@ D . : ;@ ID I: ; .?  : ;@ ID .?  : ;@ D .? < D .? < ID &I.? < ' ID I.? < ' D  :  I8  I8 .? < ' ID  DD%.?  : ; @ D 4I : ;  I$> I:   I8 . : ; @ D  I: ;  . : ; @ D .?  : ;@ ID  I: ; 4I : ; I !I/.? < ID .? < D .? < ' ID I&I :  I8 .? < ' ID  DD%.?  : ; @ D I: ;  4I : ;   $> I.?  : ;@ ID  4I : ; I: I: ; .? < ID I :  I8  I8 &I' D .? < ' ID .? < D .? < ID .? < ' D .? < ' ID .<  DD%.?  : ; @ D 4I : ;  $> . : ; @ ID I: ;  II:  :  I8   .?  : ; @ ID  D D I !I/ .? < D .? < ID .? < ' ID I&I I8 .? < ' ID  DD%$> I4I?  : ;  .?  : ; @ D I: ;  4I : ;  I:  :  I8  I  !I/ .?  : ; @ D .?  : ;@ D .?  : ;@ D I: ; 4I : ; !I/.?  : ;@ ID .? < ID .? < D &I.? < ' ID I.? < ' D  :  I8 .? < ' ID  DD%$> 4I?  : ;  .?  : ; @ D I: ;  4I : ;  I :  I8 D I  !I/ I:  : .?  : ;@ D I: ; 4I : ; . : ;@ ID .?  : ;@ ID .?  : ;@ ID . : ;@ D .?  : ;@ D .? < D .? < ID &I.? < ' ID I I8 .? < ' ID  DD%$> 4I?  : ;  I :  I8 4I : ;  D I  !I/ I !I I .?  : ;@ D 4I : ; .?  : ;@ ID I: ; . : ;@ ID .? < D .? < ID &II: .? < ' ID I I8 .? < ' ID  DD%.?  : ; @ ID I: ;  4I : ;   $> II  !I/  :  I8 I: .?  : ; @ D .?  : ;@ ID I: ; 4I : ; 4I?  : ;  .? < ' D I.? < ' ID &I.? < D .? < ID  :  I8 .? < ' ID .? < ' ID  DD%.?  : ; @ D 4I : ;  $> I.?  : ;@ ID I: ; .?  : ;@ D  4I : ; I: I  !I/ . : ;@ ID  :  I8 I!II !I/4I?  : ;  .? < ID .? < D &I.? < ' ID I :  I8 .? < ' ID  DD%. : ; @ ID I: ;   4I : ;  $> II: <  :  I8 .?  : ; @ ID  .?  : ; @ D 4I : ; &I.? < ' D I.? < ' ID .? < D .? < ID  :  I8 .? < ' ID  DD%$> I: I4I : ;  .?  : ; @ ID I: ;  .?  : ; @ D   :  I8 .?  : ; @ ID .? < ID .? < ' ID I.? < ' D &I I8 .? < ' ID  DD%$> &II!I4I : ;  I !I/ I 4I?  : ;  .?  : ; @ D . : ; @ D  I: ;  I: . : ; @ D . : ; @ ID 4I : ; . : ;@ ID I: ; .?  : ;@ ID .?  : ;@ ID !I/.? < D .? < ID .? < ' ID I :  I8  I8 .? < ' ID  DD%  I8 I$> I: 4I : ;  . : ; @ ID  I: ;  <  :  . : ; @ D  .?  : ; @ D .?  : ; @ D .?  : ;@ D .?  : ;@ D I: ; 4I : ; . : ;@ ID .?  : ;@ ID . : ;@ D  :  .?  : ;@ ID .? < ID .? < D &I.? < ' ID I.? < ' D  I8 .? < ' ID ! DD%. : ; @ D I: ;  $> .?  : ; @ D 4I : ;   4I?  : ;  .? < ' ID  I ' D  I .? < D I: &I :  I8  I8 .? < ' ID  DD%$> I4I?  : ;  I:   I8 4I : ;  .?  : ; @ D  . : ; @ ID  I: ;  .?  : ; @ ID   ( .?  : ; @ ID . : ;@ ID I: ; 4I : ;  :  I8 I !I/.?  : ;@ ID  . : ;@ ID .? < D .? < ID &I.? < ' ID I.? < ' D  .? < ' ID !"#.< $ DD%.?  : ; @ D .?  : ; @ ID 4I : ;  $> 4I?  : ;  .? < ID .? < D I .? < ' ID  I I: &I :  I8  I8 .? < ' ID .<  DD%$> I !I/ 4I?  : ; n7every_first_cmdccurr_ifile}old_ifileany_displaystart_attnposend_attnpos logfile#force_logfile@namelogfile[mainsave7ecallocskipspsprefixQquiteditprotoeditorless_is_moredohelpsecurequitting(progname@wscroll}initial_scrposis_ttynew_filep]Mmissing_capraw_modescrsizespecial_key_strKget_termyinitdeinithomeadd_line lower_left( line_leftC check_winch` goto_line vbell bell clear clear_eol& clear_bot at_enter at_exit at_switch5 is_at_equiv} apply_at_specials putbs clear_bg7 can_goto_lineT below_memm above_mem bl_e_width bl_s_width so_e_width so_s_width ul_e_width ul_s_width" bo_e_width< bo_s_widthV sc_heighto sc_width werase_char kill_char erase2_char erase_char ignawauto_wrapD1 *match_brac?ch_getch_ungetcharend_logfilesync_logfileHch_seekch_end_seekch_beg_seek2 ch_lengthQ ch_telln ch_forw_get ch_back_get ch_setbufspace ch_flush seekable ch_initN ch_close ch_getflagsp ignore_eoi*Zj7utf_modecharsetscs_aliasesNbinattrinit_charsetPbinary_charcontrol_charprchar'prutfcharutf_lenis_utf8_well_formedget_wcharput_wcharstep_char is_composing_char% is_ubin_charZ is_wide_char is_combining_charMYr(openquoteclosequoteomlist_searchml_searchmlist_examineml_examinemlist_shellml_shellCcmd_reset]clear_cmdwcmd_putstrglen_cmdbuf set_mlistk cmd_addhist cmd_acceptcmd_charcmd_intget_cmdbufcmd_lastpattern.init_cmdhistPsave_cmdhistXLin_mcadispversiongetcc1ungetcc\ungetsc*commands>H(cvt_lengthocvt_alloc_chposcvt_text nPinit_cmdsadd_fcmd_tableadd_ecmd_tablefcmd_decodeecmd_decodeRlgetenvlesskeycadd_hometableI editchara{fd0curr_altfilenameinit_textlistforw_textlist3back_textlistedit2edit_ifilehedit_listY edit_firsty edit_last8 edit_next edit_prev edit_index save_curr_ifileA unsave_ifilez reedit_ifile reopen_curr_ifile edit_stdin@ cat_fileq use_logfile curr_ino curr_devV shell_unquoteiget_meta_escapeshell_quotejhomefilefexpandVfcompletebin_file lglobz open_altfile close_altfileA is_dirbad_filefilesize_shell_coptionFS9no_back_scrolloeof_displayedentire_file_displayedsquish_check$forwbackxforwardbackwardCget_back_scrollhforw_promptsquishedscreen_trashed-, Rhelpdatavsize_helpdataW9Gdel_ifilenext_ifileprev_ifilegetoff_ifileSnifileget_ifile get_filenameAget_indextstore_posget_pos set_open9openedkhold_ifileheld_ifileget_filestateset_filestate:ELK,forw_lineback_lineset_attnposf[*jump_forwjump_backRrepaintjump_percent jump_line_locrjump_loc2*lgsize_linebuftabstopsntabstopstabdefault;init_lineis_ascii_charprewind-plinenumHpshift_all*is_ansi_end^is_ansi_middle pappend, pflushmbcb pdone set_status_col glineC null_line^ forw_raw_line back_raw_line5hshiftV0clr_linenum add_lnumfind_linenumsfind_poscurrline60lsystemdpipe_markpipe_datacB*init_mark]badmarksetmarklastmarkgomarkomarkposunmark=tagoptionVopt_o opt__OBopt_lopt_jcalc_jump_slineopt_shiftcalc_shift_countopt_kopt_topt__Topt_popt__Popt_bopt_iopt__V2opt_xopt_quotezopt_queryget_swindowZ5plusoptionOscan_optionztoggle_optionsingle_char_optionopt_promptYisoptpendingnopendoptgetnumFgetfractionget_quit_at_eofBK06jump_sline_fractionYshift_count_fractionless_is_moreinit_option;findoptfindopt_namehilite_search oldbot$ follow_mode? quit_on_intr[ use_lessopenw status_col shift_count show_attn twiddle no_keypad no_init chopline$ jump_sline> swindowU force_openo ctldisp bufspace autobuf linenums caseless forw_scroll back_scroll tabstop2 squeezeI quit_if_one_screenk quit_at_eof know_dumb bs_mode pr_type top_scroll how_search quietn{&ireadeintread}get_timeerrno_message,percentagepercent_posbreadingg.put_lineflushputchrputstr:postoalinenumtoa~inttoaqget_returnerrorierrorqueryGat_prompt`final_attrzneed_clrerrmsgs^+"}compile_patternLuncompile_patternis_null_patternmatch_pattern4Egpositionadd_forw_posadd_back_pos"pos_clearRpos_initonscreenempty_screenempty_lines\get_scrposadjslineCeqprotohprotowprotoinit_promptpr_expand3eq_messageSpr_stringwait_message prprotoYinit_searchrepaint_hilite)clear_attnundo_searchclr_hlistVclr_hiliterclr_filteris_filtered2is_hilitedchg_caselessf chg_hilite search prep_hilite+set_filter_pattern~is_filtering?vwinchinit_signalspsignalslsigs7tags#cleantagsgettagtypefindtagtagsearchnexttag.prevtagrntagscurr_tagedit_tagfileB-, ,open_getchrHclose_getchregetchrttyYkQversionyPOSITIONWscrpossize_td tm wint_t __FILE. off64_tV ssize_t>off_t<FILE]3tcflag_tScc_twtermiosvwinsizespeed_t8size_ttmwint_t__FILE[off64_tssize_tkoff_tFILEnD1 POSITIONFsize_t]tm|wint_t__FILE'off64_tOssize_t?off_t# FILEl?mode_tdev_t;bufnodeBLOCKNUMbuf"POSITION6LINENUMDpargPARGino_tnlink_tuid_tgid_toff_ttime_ttimespec@timestruc_tRblksize_tbblkcnt_tstat filestate ino64_t off64_t blkcnt64_t stat64 size_t#tmBwint_tw__FILEssize_tFILEZjacharsetcs_aliasLWCHARwchar_range size_t tmwint_t1__FILEoff64_tssize_toff_tFILE@Yr(mode_tdev_tmlistZLWCHARiLINENUM__FILEFILE+ino_t7nlink_tEuid_tQgid_tnoff_tztime_ttimespectimestruc_tblksize_tblkcnt_t stattextlistino64_toff64_tblkcnt64_tQstat64size_ttmwint_t!ssize_tLLINENUMparg*PARG:optnameloptionPOSITIONsize_ttmwint_t__FILE]off64_tssize_tmoff_tQFILElHLWCHARjsize_t(tmGwint_t__FILE7off64_t_ssize_tG off_t FILE ntablelistTPOSITIONLINENUM parg> PARG size_t tm wint_t __FILEfoff64_tssize_tvoff_tFILEU{mode_tdev_ttextlistPOSITIONscrposLINENUMparg"PARG\ino_thnlink_tuid_tgid_toff_ttime_ttimespectimestruc_tblksize_tblkcnt_tGstat7ino64_tVoff64_tdblkcnt64_tstat64 size_t tm)wint_to__FILEssize_tFILE*V mode_tdev_tLWCHARPOSITION"off_t__FILEFILE ino_t nlink_t uid_t gid_t* time_t7 timespecg timestruc_ty blksize_t blkcnt_t statino64_toff64_tblkcnt64_tstat64size_t<tm[wint_t-ssize_tzFSPOSITIONSLINENUMsize_ttmwint_tG__FILE off64_t ssize_t off_tFILEa, )size_t@tm_wint_t__FILEoff64_t?ssize_t/off_t FILEW9POSITIONscrpos,ifilensize_ttm wint_t __FILEO off64_tw ssize_t_ off_tCFILEnELKPOSITIONsize_ttmwint_t?__FILEoff64_tssize_t off_t FILE[POSITIONLINENUM pargGPARGscrpossize_t)tmHwint_t__FILE off64_t ssize_t off_tFILE*lLWCHARPOSITIONLINENUM]size_tttmwint_t__FILE-off64_tUssize_t=off_tFILEtPOSITIONLINENUMlinenum_info$size_t;tmZwint_t__FILE off64_t- ssize_t off_tFILEnPOSITION__FILEFILE\size_tRtmqwint_t) off64_tQ ssize_t9 off_tBPOSITIONscrposmark'size_t>tm]wint_t__FILE off64_t0 ssize_t off_t FILELINENUMpargPARGPOSITIONX size_tt tm wint_t __FILE>off64_tfssize_tNoff_t2FILEZIoptnameloption#LINENUM1pargoPARG size_t tm wint_t+ __FILE off64_t ssize_toff_tFILEyK0optname.loption size_t tmwint_t__FILEoff64_tssize_toff_tFILE{<Vsigset_ttime_tPOSITION;jmp_bufEsize_ttm6wint_t|__FILE off64_t ssize_t off_tFILEgPOSITION_LINENUM#pargaPARGGsize_t& tmE wint_t __FILE off64_t ssize_t5off_tFILE+"}size_t2regex_tregoff_tZregmatch_ttm& wint_tl __FILE off64_t ssize_t off_tFILEy4E?POSITIONscrpossize_ttmwint_tA__FILEoff64_tssize_t off_t FILEzCPOSITION7LINENUM size_t tm wint_t __FILEOoff64_twssize_t_off_tCFILEYPOSITION.hilite9size_tgregex_tpattern_infoXLWCHAR@ scrpos5 LINENUMutmwint_t__FILE[off64_tssize_tkoff_t>FILEkvsize_t*tmIwint_t__FILEoff64_t)ssize_t off_t pid_t FILE]LINENUMktagtaglistntag_resultPOSITION__FILEFILE size_t+ tmJwint_toff64_t*ssize_toff_ta-, size_ttmwint_t__FILEqoff64_tssize_toff_tm FILE}save_status]5init_donehattrmodecurr_onsave_termsaved_termzenvstbufsbuf costcount hardcopysc_deinit6sc_initLsc_e_keypadfsc_s_keypadsc_backspacesc_visual_bellsc_bl_outsc_bl_insc_b_outsc_b_insc_u_out+sc_u_inAsc_s_outXsc_s_innsc_eos_clearsc_eol_clearsc_clearsc_movesc_returnsc_lower_leftsc_addlinesc_home4sc_padB?ch_ungotcharmaxbufstriedY thisfileZj!binfmt6utfbinfmtbufXbufcomp_table!comp_tableJcomb_tableucomb_tableubin_tableubin_tablewide_table wide_table chardefYr(in_completion*curr_mlist+cmd_mbc_buf_indexKcmd_mbc_buf_lenzcmd_mbc_bufcurr_cmdflagstk_tlisttk_trialtk_ipoint(tk_originalBtk_textXliteralncmd_offsetcpprompt_colcmd_colcmdbufL=ungotpRshellcmd pipec" save_hshift< bottomposT optgetnamem optflag optchar fraction number search_type mca ungot nVcmdtablecmdtableedittableedittable)list_fcmd_tablesHlist_ecmd_tablesglist_var_tableslist_sysvar_tables{ curr_altpipe2V mchars>is_a_dirnot_regFSfirst_time$W9'anchor<ifiles*l7linebufMattrlast_overstrikembc_buf_lenmbc_buf_index"mbc_posImbc_buf_mid_ansi_chars|end_ansi_charspendpospendclmarginis_null_lineoverstrike column"currKcshiftTlstartimeloopcountsparepoolfreelistanchorBKsmmarks"ZbufpendoptK0a_optnameb_optnameB__optname'c_optname?d_optnameWe_optnameof_optnameF__optnameg_optnameh_optnamei_optnamej_optnameJ__optnamek_optname1K__optnameJL__optnamecm_optname{n_optnameo_optnameO__optnamep_optnameP__optnameq2_optnameq_optname&r_optname>s_optnameVS__optnameot_optnameT__optnameu_optnameV__optnamew_optnamex_optnameX__optnamey_optname2z_optnameJquote_optnameftilde_optnamequery_optnamepound_optnamekeypad_optnameoldbot_optnamefollow_optnameoptionoption3{consecutive_nullsIread_labelYgobreturn_to_continue5intr_to_abortcintr_to_abort4obuf'4EStabletable_sizeCRs_protoys_protom_protom_protoM_protoM_protoEe_protole_protoh_protoh_protow_protow_proto8more_protobmore_protompmessageYhilite_anchorfilter_anchorfilter_infosearch_infois_ucase_patternis_caseless prep_endpos'prep_startposChide_hiliteG taglistu circular curtag curseq total]ltget_envltgetflag ltgetnumwltgetstr$inc_costcountXcostcheapertmodes beep clear_eol_botS?&mknodbuffered2 ch_addbuf{ init_hashtbl ch_delbufsbZjeichardeficharset1ilocale^setbinfmtset_charset9 is_in_tableYr(.mknodcmd_step_common@cmd_step_rightcmd_step_leftDcmd_repaint+cmd_homecmd_lshifto cmd_rshift cmd_rightb cmd_left cmd_ichar cmd_erasec cmd_delete cmd_werase cmd_wdelete cmd_kill# cmd_updown cmd_edit8 cmd_istr delimit_wordinit_complnext_complMcmd_completehistfile_namesave_mlistLicmd_execstart_mcamca_search-mca_opt_toggleexec_mcamca_charclear_buffersmake_displaypromptmulti_search nexpand_special_keyskadd_cmd_table^add_var_tablecmd_searchQcmd_decodegintold_lesskey(new_lesskeyT{*mknodclose_file edit_istep edit_inexti edit_ipreviV 2mknodmetacharsmetachardirfileseek_filesize.readfdshellcmdFSWeof_bellZW9Qincr_indexlink_ifileunlink_ifilenew_ifilenfind_ifile*lUexpand_linebufpshiftdattr_swidthattr_ewidthpwidthLbackcin_ansi_esc_seqstore_char store_tabo store_prchar flush_mbc_buf[ do_appendIcalcgaplongloopmessagelongishabort_long'BagetumarkgetmarkQZ7flip_tripleypropt{nostringoptstring_num_errorK0|is_optchar@giprint_int]iprint_linenumless_printf-+"}0compile_pattern2matchCap_str>ap_charap_posap_linenumVap_intap_questcurr_bytecondLprotochar&skipcondmwherecharYset_pattern;clear_patternlinit_patternget_cvt_opsis_ucaseeprev_patternis_hilited_rangeadd_hilite hilite_line hilite_screen search_pos search_rangeC hist_pattern'v.u_interruptdstop|Tmaketagentfindctag#ctagsearchfindgtag nextgtag prevgtag gtagsearch getentry.interp.SUNW_cap.hash.SUNW_ldynsym.dynsym.dynstr.SUNW_version.SUNW_versym.SUNW_dynsymsort.SUNW_reloc.rel.plt.text.init.fini.rodata.rodata1.got.dynamic.data.bssf.bss.symtab.strtab.comment.debug_loc.debug_info.debug_line.debug_abbrev.debug_pubnames.debug_typenames.debug_varnames.debug_funcnames.shstrtab oo ' L"L"+/"LMLM/7oT|T|Eo||`RoDD c 0o B00P sx00ޓ~)),),)H)H)/XX!zz4{{xH}H}"XXXX2X`?G , ]uiuiī994Ha:%8v 5 F P0707010008d322000041ed0000000000000000000000034cad6b8700000000000000b600010002ffffffffffffffff0000001500000000root/usr/local/share0707010008d323000041ed0000000000000000000000034cad6b8700000000000000b600010002ffffffffffffffff0000001900000000root/usr/local/share/man0707010008d324000041ed0000000000000000000000024cad6b8700000000000000b600010002ffffffffffffffff0000001e00000000root/usr/local/share/man/man10707010008d327000081a40000000000000000000000014cad6b1f00002598000000b600010002ffffffffffffffff0000002800000000root/usr/local/share/man/man1/lesskey.1.TH LESSKEY 1 "Version 436: 07 Jul 2009" .SH NAME lesskey \- specify key bindings for less .SH SYNOPSIS .B "lesskey [-o output] [--] [input]" .br .B "lesskey [--output=output] [--] [input]" .br .B "lesskey -V" .br .B "lesskey --version" .SH DESCRIPTION .I Lesskey is used to specify a set of key bindings to be used by .I less. The input file is a text file which describes the key bindings, If the input file is "-", standard input is read. If no input file is specified, a standard filename is used as the name of the input file, which depends on the system being used: On Unix systems, $HOME/.lesskey is used; on MS-DOS systems, $HOME/_lesskey is used; and on OS/2 systems $HOME/lesskey.ini is used, or $INIT/lesskey.ini if $HOME is undefined. The output file is a binary file which is used by .I less. If no output file is specified, and the environment variable LESSKEY is set, the value of LESSKEY is used as the name of the output file. Otherwise, a standard filename is used as the name of the output file, which depends on the system being used: On Unix and OS-9 systems, $HOME/.less is used; on MS-DOS systems, $HOME/_less is used; and on OS/2 systems, $HOME/less.ini is used, or $INIT/less.ini if $HOME is undefined. If the output file already exists, .I lesskey will overwrite it. .PP The -V or --version option causes .I lesskey to print its version number and immediately exit. If -V or --version is present, other options and arguments are ignored. .PP The input file consists of one or more .I sections. Each section starts with a line that identifies the type of section. Possible sections are: .IP #command Defines new command keys. .IP #line-edit Defines new line-editing keys. .IP #env Defines environment variables. .PP Blank lines and lines which start with a pound sign (#) are ignored, except for the special section header lines. .SH "COMMAND SECTION" The command section begins with the line .sp #command .sp If the command section is the first section in the file, this line may be omitted. The command section consists of lines of the form: .sp \fIstring\fP \fIaction\fP [extra-string] .sp Whitespace is any sequence of one or more spaces and/or tabs. The \fIstring\fP is the command key(s) which invoke the action. The \fIstring\fP may be a single command key, or a sequence of up to 15 keys. The \fIaction\fP is the name of the less action, from the list below. The characters in the \fIstring\fP may appear literally, or be prefixed by a caret to indicate a control key. A backslash followed by one to three octal digits may be used to specify a character by its octal value. A backslash followed by certain characters specifies input characters as follows: .IP \eb BACKSPACE .IP \ee ESCAPE .IP \en NEWLINE .IP \er RETURN .IP \et TAB .IP \eku UP ARROW .IP \ekd DOWN ARROW .IP \ekr RIGHT ARROW .IP \ekl LEFT ARROW .IP \ekU PAGE UP .IP \ekD PAGE DOWN .IP \ekh HOME .IP \eke END .IP \ekx DELETE .PP A backslash followed by any other character indicates that character is to be taken literally. Characters which must be preceded by backslash include caret, space, tab and the backslash itself. .PP An action may be followed by an "extra" string. When such a command is entered while running .I less, the action is performed, and then the extra string is parsed, just as if it were typed in to .I less. This feature can be used in certain cases to extend the functionality of a command. For example, see the "{" and ":t" commands in the example below. The extra string has a special meaning for the "quit" action: when .I less quits, first character of the extra string is used as its exit status. .SH EXAMPLE The following input file describes the set of default command keys used by less: .sp .nf #command \er forw-line \en forw-line e forw-line j forw-line \ekd forw-line ^E forw-line ^N forw-line k back-line y back-line ^Y back-line ^K back-line ^P back-line J forw-line-force K back-line-force Y back-line-force d forw-scroll ^D forw-scroll u back-scroll ^U back-scroll \e40 forw-screen f forw-screen ^F forw-screen ^V forw-screen \ekD forw-screen b back-screen ^B back-screen \eev back-screen \ekU back-screen z forw-window w back-window \ee\e40 forw-screen-force F forw-forever R repaint-flush r repaint ^R repaint ^L repaint \eeu undo-hilite g goto-line \ekh goto-line < goto-line \ee< goto-line p percent % percent \ee[ left-scroll \ee] right-scroll \ee( left-scroll \ee) right-scroll { forw-bracket {} } back-bracket {} ( forw-bracket () ) back-bracket () [ forw-bracket [] ] back-bracket [] \ee^F forw-bracket \ee^B back-bracket G goto-end \ee> goto-end > goto-end \eke goto-end = status ^G status :f status / forw-search ? back-search \ee/ forw-search * \ee? back-search * n repeat-search \een repeat-search-all N reverse-search \eeN reverse-search-all & filter m set-mark ' goto-mark ^X^X goto-mark E examine :e examine ^X^V examine :n next-file :p prev-file t next-tag T prev-tag :x index-file :d remove-file - toggle-option :t toggle-option t s toggle-option o _ display-option | pipe v visual ! shell + firstcmd H help h help V version 0 digit 1 digit 2 digit 3 digit 4 digit 5 digit 6 digit 7 digit 8 digit 9 digit q quit Q quit :q quit :Q quit ZZ quit .fi .sp .SH PRECEDENCE Commands specified by .I lesskey take precedence over the default commands. A default command key may be disabled by including it in the input file with the action "invalid". Alternatively, a key may be defined to do nothing by using the action "noaction". "noaction" is similar to "invalid", but .I less will give an error beep for an "invalid" command, but not for a "noaction" command. In addition, ALL default commands may be disabled by adding this control line to the input file: .sp #stop .sp This will cause all default commands to be ignored. The #stop line should be the last line in that section of the file. .PP Be aware that #stop can be dangerous. Since all default commands are disabled, you must provide sufficient commands before the #stop line to enable all necessary actions. For example, failure to provide a "quit" command can lead to frustration. .SH "LINE EDITING SECTION" The line-editing section begins with the line: .sp #line-edit .sp This section specifies new key bindings for the line editing commands, in a manner similar to the way key bindings for ordinary commands are specified in the #command section. The line-editing section consists of a list of keys and actions, one per line as in the example below. .SH EXAMPLE The following input file describes the set of default line-editing keys used by less: .sp .nf #line-edit \et forw-complete \e17 back-complete \ee\et back-complete ^L expand ^V literal ^A literal \eel right \ekr right \eeh left \ekl left \eeb word-left \ee\ekl word-left \eew word-right \ee\ekr word-right \eei insert \eex delete \ekx delete \eeX word-delete \eekx word-delete \ee\eb word-backspace \ee0 home \ekh home \ee$ end \eke end \eek up \eku up \eej down .fi .sp .SH "LESS ENVIRONMENT VARIABLES" The environment variable section begins with the line .sp #env .sp Following this line is a list of environment variable assignments. Each line consists of an environment variable name, an equals sign (=) and the value to be assigned to the environment variable. White space before and after the equals sign is ignored. Variables assigned in this way are visible only to .I less. If a variable is specified in the system environment and also in a lesskey file, the value in the lesskey file takes precedence. Although the lesskey file can be used to override variables set in the environment, the main purpose of assigning variables in the lesskey file is simply to have all .I less configuration information stored in one file. .SH EXAMPLE The following input file sets the -i option whenever .I less is run, and specifies the character set to be "latin1": .sp .nf #env LESS = -i LESSCHARSET = latin1 .fi .sp .SH "SEE ALSO" less(1) .SH WARNINGS It is not possible to specify special keys, such as uparrow, in a keyboard-independent manner. The only way to specify such keys is to specify the escape sequence which a particular keyboard sends when such a key is pressed. .PP On MS-DOS and OS/2 systems, certain keys send a sequence of characters which start with a NUL character (0). This NUL character should be represented as \e340 in a lesskey file. .SH COPYRIGHT Copyright (C) 2000-2009 Mark Nudelman .PP lesskey is part of the GNU project and is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2, or (at your option) any later version. .PP lesskey is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. .PP You should have received a copy of the GNU General Public License along with lesskey; see the file COPYING. If not, write to the Free Software Foundation, 59 Temple Place, Suite 330, Boston, MA 02111-1307, USA. .SH AUTHOR .PP Mark Nudelman .br Send bug reports or comments to the above address or to bug-less@gnu.org. 0707010008d325000081a40000000000000000000000014cad6b1f0000fcf6000000b600010002ffffffffffffffff0000002500000000root/usr/local/share/man/man1/less.1.TH LESS 1 "Version 436: 07 Jul 2009" .SH NAME less \- opposite of more .SH SYNOPSIS .B "less \-?" .br .B "less \-\-help" .br .B "less \-V" .br .B "less \-\-version" .br .B "less [\-[+]aBcCdeEfFgGiIJKLmMnNqQrRsSuUVwWX~]" .br .B " [\-b \fIspace\fP] [\-h \fIlines\fP] [\-j \fIline\fP] [\-k \fIkeyfile\fP]" .br .B " [\-{oO} \fIlogfile\fP] [\-p \fIpattern\fP] [\-P \fIprompt\fP] [\-t \fItag\fP]" .br .B " [\-T \fItagsfile\fP] [\-x \fItab\fP,...] [\-y \fIlines\fP] [\-[z] \fIlines\fP]" .br .B " [\-# \fIshift\fP] [+[+]\fIcmd\fP] [\-\-] [\fIfilename\fP]..." .br (See the OPTIONS section for alternate option syntax with long option names.) .SH DESCRIPTION .I Less is a program similar to .I more (1), but which allows backward movement in the file as well as forward movement. Also, .I less does not have to read the entire input file before starting, so with large input files it starts up faster than text editors like .I vi (1). .I Less uses termcap (or terminfo on some systems), so it can run on a variety of terminals. There is even limited support for hardcopy terminals. (On a hardcopy terminal, lines which should be printed at the top of the screen are prefixed with a caret.) .PP Commands are based on both .I more and .I vi. Commands may be preceded by a decimal number, called N in the descriptions below. The number is used by some commands, as indicated. .SH COMMANDS In the following descriptions, ^X means control-X. ESC stands for the ESCAPE key; for example ESC-v means the two character sequence "ESCAPE", then "v". .IP "h or H" Help: display a summary of these commands. If you forget all the other commands, remember this one. .IP "SPACE or ^V or f or ^F" Scroll forward N lines, default one window (see option \-z below). If N is more than the screen size, only the final screenful is displayed. Warning: some systems use ^V as a special literalization character. .IP "z" Like SPACE, but if N is specified, it becomes the new window size. .IP "ESC-SPACE" Like SPACE, but scrolls a full screenful, even if it reaches end-of-file in the process. .IP "RETURN or ^N or e or ^E or j or ^J" Scroll forward N lines, default 1. The entire N lines are displayed, even if N is more than the screen size. .IP "d or ^D" Scroll forward N lines, default one half of the screen size. If N is specified, it becomes the new default for subsequent d and u commands. .IP "b or ^B or ESC-v" Scroll backward N lines, default one window (see option \-z below). If N is more than the screen size, only the final screenful is displayed. .IP "w" Like ESC-v, but if N is specified, it becomes the new window size. .IP "y or ^Y or ^P or k or ^K" Scroll backward N lines, default 1. The entire N lines are displayed, even if N is more than the screen size. Warning: some systems use ^Y as a special job control character. .IP "u or ^U" Scroll backward N lines, default one half of the screen size. If N is specified, it becomes the new default for subsequent d and u commands. .IP "ESC-) or RIGHTARROW" Scroll horizontally right N characters, default half the screen width (see the \-# option). If a number N is specified, it becomes the default for future RIGHTARROW and LEFTARROW commands. While the text is scrolled, it acts as though the \-S option (chop lines) were in effect. .IP "ESC-( or LEFTARROW" Scroll horizontally left N characters, default half the screen width (see the \-# option). If a number N is specified, it becomes the default for future RIGHTARROW and LEFTARROW commands. .IP "r or ^R or ^L" Repaint the screen. .IP R Repaint the screen, discarding any buffered input. Useful if the file is changing while it is being viewed. .IP "F" Scroll forward, and keep trying to read when the end of file is reached. Normally this command would be used when already at the end of the file. It is a way to monitor the tail of a file which is growing while it is being viewed. (The behavior is similar to the "tail \-f" command.) .IP "g or < or ESC-<" Go to line N in the file, default 1 (beginning of file). (Warning: this may be slow if N is large.) .IP "G or > or ESC->" Go to line N in the file, default the end of the file. (Warning: this may be slow if N is large, or if N is not specified and standard input, rather than a file, is being read.) .IP "p or %" Go to a position N percent into the file. N should be between 0 and 100, and may contain a decimal point. .IP "P" Go to the line containing byte offset N in the file. .IP "{" If a left curly bracket appears in the top line displayed on the screen, the { command will go to the matching right curly bracket. The matching right curly bracket is positioned on the bottom line of the screen. If there is more than one left curly bracket on the top line, a number N may be used to specify the N-th bracket on the line. .IP "}" If a right curly bracket appears in the bottom line displayed on the screen, the } command will go to the matching left curly bracket. The matching left curly bracket is positioned on the top line of the screen. If there is more than one right curly bracket on the top line, a number N may be used to specify the N-th bracket on the line. .IP "(" Like {, but applies to parentheses rather than curly brackets. .IP ")" Like }, but applies to parentheses rather than curly brackets. .IP "[" Like {, but applies to square brackets rather than curly brackets. .IP "]" Like }, but applies to square brackets rather than curly brackets. .IP "ESC-^F" Followed by two characters, acts like {, but uses the two characters as open and close brackets, respectively. For example, "ESC ^F < >" could be used to go forward to the > which matches the < in the top displayed line. .IP "ESC-^B" Followed by two characters, acts like }, but uses the two characters as open and close brackets, respectively. For example, "ESC ^B < >" could be used to go backward to the < which matches the > in the bottom displayed line. .IP m Followed by any lowercase letter, marks the current position with that letter. .IP "'" (Single quote.) Followed by any lowercase letter, returns to the position which was previously marked with that letter. Followed by another single quote, returns to the position at which the last "large" movement command was executed. Followed by a ^ or $, jumps to the beginning or end of the file respectively. Marks are preserved when a new file is examined, so the ' command can be used to switch between input files. .IP "^X^X" Same as single quote. .IP /pattern Search forward in the file for the N-th line containing the pattern. N defaults to 1. The pattern is a regular expression, as recognized by the regular expression library supplied by your system. The search starts at the second line displayed (but see the \-a and \-j options, which change this). .sp Certain characters are special if entered at the beginning of the pattern; they modify the type of search rather than become part of the pattern: .RS .IP "^N or !" Search for lines which do NOT match the pattern. .IP "^E or *" Search multiple files. That is, if the search reaches the END of the current file without finding a match, the search continues in the next file in the command line list. .IP "^F or @" Begin the search at the first line of the FIRST file in the command line list, regardless of what is currently displayed on the screen or the settings of the \-a or \-j options. .IP "^K" Highlight any text which matches the pattern on the current screen, but don't move to the first match (KEEP current position). .IP "^R" Don't interpret regular expression metacharacters; that is, do a simple textual comparison. .RE .IP ?pattern Search backward in the file for the N-th line containing the pattern. The search starts at the line immediately before the top line displayed. .sp Certain characters are special as in the / command: .RS .IP "^N or !" Search for lines which do NOT match the pattern. .IP "^E or *" Search multiple files. That is, if the search reaches the beginning of the current file without finding a match, the search continues in the previous file in the command line list. .IP "^F or @" Begin the search at the last line of the last file in the command line list, regardless of what is currently displayed on the screen or the settings of the \-a or \-j options. .IP "^K" As in forward searches. .IP "^R" As in forward searches. .RE .IP "ESC-/pattern" Same as "/*". .IP "ESC-?pattern" Same as "?*". .IP n Repeat previous search, for N-th line containing the last pattern. If the previous search was modified by ^N, the search is made for the N-th line NOT containing the pattern. If the previous search was modified by ^E, the search continues in the next (or previous) file if not satisfied in the current file. If the previous search was modified by ^R, the search is done without using regular expressions. There is no effect if the previous search was modified by ^F or ^K. .IP N Repeat previous search, but in the reverse direction. .IP "ESC-n" Repeat previous search, but crossing file boundaries. The effect is as if the previous search were modified by *. .IP "ESC-N" Repeat previous search, but in the reverse direction and crossing file boundaries. .IP "ESC-u" Undo search highlighting. Turn off highlighting of strings matching the current search pattern. If highlighting is already off because of a previous ESC-u command, turn highlighting back on. Any search command will also turn highlighting back on. (Highlighting can also be disabled by toggling the \-G option; in that case search commands do not turn highlighting back on.) .IP "&pattern" Display only lines which match the pattern; lines which do not match the pattern are not displayed. If pattern is empty (if you type & immediately followed by ENTER), any filtering is turned off, and all lines are displayed. While filtering is in effect, an ampersand is displayed at the beginning of the prompt, as a reminder that some lines in the file may be hidden. .sp Certain characters are special as in the / command: .RS .IP "^N or !" Display only lines which do NOT match the pattern. .IP "^R" Don't interpret regular expression metacharacters; that is, do a simple textual comparison. .RE .IP ":e [filename]" Examine a new file. If the filename is missing, the "current" file (see the :n and :p commands below) from the list of files in the command line is re-examined. A percent sign (%) in the filename is replaced by the name of the current file. A pound sign (#) is replaced by the name of the previously examined file. However, two consecutive percent signs are simply replaced with a single percent sign. This allows you to enter a filename that contains a percent sign in the name. Similarly, two consecutive pound signs are replaced with a single pound sign. The filename is inserted into the command line list of files so that it can be seen by subsequent :n and :p commands. If the filename consists of several files, they are all inserted into the list of files and the first one is examined. If the filename contains one or more spaces, the entire filename should be enclosed in double quotes (also see the \-" option). .IP "^X^V or E" Same as :e. Warning: some systems use ^V as a special literalization character. On such systems, you may not be able to use ^V. .IP ":n" Examine the next file (from the list of files given in the command line). If a number N is specified, the N-th next file is examined. .IP ":p" Examine the previous file in the command line list. If a number N is specified, the N-th previous file is examined. .IP ":x" Examine the first file in the command line list. If a number N is specified, the N-th file in the list is examined. .IP ":d" Remove the current file from the list of files. .IP "t" Go to the next tag, if there were more than one matches for the current tag. See the \-t option for more details about tags. .IP "T" Go to the previous tag, if there were more than one matches for the current tag. .IP "= or ^G or :f" Prints some information about the file being viewed, including its name and the line number and byte offset of the bottom line being displayed. If possible, it also prints the length of the file, the number of lines in the file and the percent of the file above the last displayed line. .IP \- Followed by one of the command line option letters (see OPTIONS below), this will change the setting of that option and print a message describing the new setting. If a ^P (CONTROL-P) is entered immediately after the dash, the setting of the option is changed but no message is printed. If the option letter has a numeric value (such as \-b or \-h), or a string value (such as \-P or \-t), a new value may be entered after the option letter. If no new value is entered, a message describing the current setting is printed and nothing is changed. .IP \-\- Like the \- command, but takes a long option name (see OPTIONS below) rather than a single option letter. You must press RETURN after typing the option name. A ^P immediately after the second dash suppresses printing of a message describing the new setting, as in the \- command. .IP \-+ Followed by one of the command line option letters this will reset the option to its default setting and print a message describing the new setting. (The "\-+\fIX\fP" command does the same thing as "\-+\fIX\fP" on the command line.) This does not work for string-valued options. .IP \-\-+ Like the \-+ command, but takes a long option name rather than a single option letter. .IP \-! Followed by one of the command line option letters, this will reset the option to the "opposite" of its default setting and print a message describing the new setting. This does not work for numeric or string-valued options. .IP \-\-! Like the \-! command, but takes a long option name rather than a single option letter. .IP _ (Underscore.) Followed by one of the command line option letters, this will print a message describing the current setting of that option. The setting of the option is not changed. .IP __ (Double underscore.) Like the _ (underscore) command, but takes a long option name rather than a single option letter. You must press RETURN after typing the option name. .IP +cmd Causes the specified cmd to be executed each time a new file is examined. For example, +G causes .I less to initially display each file starting at the end rather than the beginning. .IP V Prints the version number of .I less being run. .IP "q or Q or :q or :Q or ZZ" Exits .I less. .PP The following four commands may or may not be valid, depending on your particular installation. .PP .IP v Invokes an editor to edit the current file being viewed. The editor is taken from the environment variable VISUAL if defined, or EDITOR if VISUAL is not defined, or defaults to "vi" if neither VISUAL nor EDITOR is defined. See also the discussion of LESSEDIT under the section on PROMPTS below. .IP "! shell-command" Invokes a shell to run the shell-command given. A percent sign (%) in the command is replaced by the name of the current file. A pound sign (#) is replaced by the name of the previously examined file. "!!" repeats the last shell command. "!" with no shell command simply invokes a shell. On Unix systems, the shell is taken from the environment variable SHELL, or defaults to "sh". On MS-DOS and OS/2 systems, the shell is the normal command processor. .IP "| shell-command" represents any mark letter. Pipes a section of the input file to the given shell command. The section of the file to be piped is between the first line on the current screen and the position marked by the letter. may also be ^ or $ to indicate beginning or end of file respectively. If is . or newline, the current screen is piped. .IP "s filename" Save the input to a file. This only works if the input is a pipe, not an ordinary file. .PP .SH OPTIONS Command line options are described below. Most options may be changed while .I less is running, via the "\-" command. .PP Most options may be given in one of two forms: either a dash followed by a single letter, or two dashes followed by a long option name. A long option name may be abbreviated as long as the abbreviation is unambiguous. For example, \-\-quit-at-eof may be abbreviated \-\-quit, but not --qui, since both \-\-quit-at-eof and \-\-quiet begin with \-\-qui. Some long option names are in uppercase, such as \-\-QUIT-AT-EOF, as distinct from \-\-quit-at-eof. Such option names need only have their first letter capitalized; the remainder of the name may be in either case. For example, \-\-Quit-at-eof is equivalent to \-\-QUIT-AT-EOF. .PP Options are also taken from the environment variable "LESS". For example, to avoid typing "less \-options ..." each time .I less is invoked, you might tell .I csh: .sp setenv LESS "-options" .sp or if you use .I sh: .sp LESS="-options"; export LESS .sp On MS-DOS, you don't need the quotes, but you should replace any percent signs in the options string by double percent signs. .sp The environment variable is parsed before the command line, so command line options override the LESS environment variable. If an option appears in the LESS variable, it can be reset to its default value on the command line by beginning the command line option with "\-+". .sp For options like \-P or \-D which take a following string, a dollar sign ($) must be used to signal the end of the string. For example, to set two \-D options on MS-DOS, you must have a dollar sign between them, like this: .sp LESS="-Dn9.1$-Ds4.1" .sp .IP "\-? or \-\-help" This option displays a summary of the commands accepted by .I less (the same as the h command). (Depending on how your shell interprets the question mark, it may be necessary to quote the question mark, thus: "\-\e?".) .IP "\-a or \-\-search-skip-screen" Causes searches to start after the last line displayed on the screen, thus skipping all lines displayed on the screen. By default, searches start at the second line on the screen (or after the last found line; see the \-j option). .IP "\-b\fIn\fP or \-\-buffers=\fIn\fP" Specifies the amount of buffer space .I less will use for each file, in units of kilobytes (1024 bytes). By default 64K of buffer space is used for each file (unless the file is a pipe; see the \-B option). The \-b option specifies instead that \fIn\fP kilobytes of buffer space should be used for each file. If \fIn\fP is \-1, buffer space is unlimited; that is, the entire file can be read into memory. .IP "\-B or \-\-auto-buffers" By default, when data is read from a pipe, buffers are allocated automatically as needed. If a large amount of data is read from the pipe, this can cause a large amount of memory to be allocated. The \-B option disables this automatic allocation of buffers for pipes, so that only 64K (or the amount of space specified by the \-b option) is used for the pipe. Warning: use of \-B can result in erroneous display, since only the most recently viewed part of the piped data is kept in memory; any earlier data is lost. .IP "\-c or \-\-clear-screen" Causes full screen repaints to be painted from the top line down. By default, full screen repaints are done by scrolling from the bottom of the screen. .IP "\-C or \-\-CLEAR-SCREEN" Same as \-c, for compatibility with older versions of .I less. .IP "\-d or \-\-dumb" The \-d option suppresses the error message normally displayed if the terminal is dumb; that is, lacks some important capability, such as the ability to clear the screen or scroll backward. The \-d option does not otherwise change the behavior of .I less on a dumb terminal. .IP "\-D\fBx\fP\fIcolor\fP or \-\-color=\fBx\fP\fIcolor\fP" [MS-DOS only] Sets the color of the text displayed. \fBx\fP is a single character which selects the type of text whose color is being set: n=normal, s=standout, d=bold, u=underlined, k=blink. \fIcolor\fP is a pair of numbers separated by a period. The first number selects the foreground color and the second selects the background color of the text. A single number \fIN\fP is the same as \fIN.M\fP, where \fIM\fP is the normal background color. .IP "\-e or \-\-quit-at-eof" Causes .I less to automatically exit the second time it reaches end-of-file. By default, the only way to exit .I less is via the "q" command. .IP "\-E or \-\-QUIT-AT-EOF" Causes .I less to automatically exit the first time it reaches end-of-file. .IP "\-f or \-\-force" Forces non-regular files to be opened. (A non-regular file is a directory or a device special file.) Also suppresses the warning message when a binary file is opened. By default, .I less will refuse to open non-regular files. Note that some operating systems will not allow directories to be read, even if \-f is set. .IP "\-F or \-\-quit-if-one-screen" Causes .I less to automatically exit if the entire file can be displayed on the first screen. .IP "\-g or \-\-hilite-search" Normally, .I less will highlight ALL strings which match the last search command. The \-g option changes this behavior to highlight only the particular string which was found by the last search command. This can cause .I less to run somewhat faster than the default. .IP "\-G or \-\-HILITE-SEARCH" The \-G option suppresses all highlighting of strings found by search commands. .IP "\-h\fIn\fP or \-\-max-back-scroll=\fIn\fP" Specifies a maximum number of lines to scroll backward. If it is necessary to scroll backward more than \fIn\fP lines, the screen is repainted in a forward direction instead. (If the terminal does not have the ability to scroll backward, \-h0 is implied.) .IP "\-i or \-\-ignore-case" Causes searches to ignore case; that is, uppercase and lowercase are considered identical. This option is ignored if any uppercase letters appear in the search pattern; in other words, if a pattern contains uppercase letters, then that search does not ignore case. .IP "\-I or \-\-IGNORE-CASE" Like \-i, but searches ignore case even if the pattern contains uppercase letters. .IP "\-j\fIn\fP or \-\-jump-target=\fIn\fP" Specifies a line on the screen where the "target" line is to be positioned. The target line is the line specified by any command to search for a pattern, jump to a line number, jump to a file percentage or jump to a tag. The screen line may be specified by a number: the top line on the screen is 1, the next is 2, and so on. The number may be negative to specify a line relative to the bottom of the screen: the bottom line on the screen is \-1, the second to the bottom is \-2, and so on. Alternately, the screen line may be specified as a fraction of the height of the screen, starting with a decimal point: .5 is in the middle of the screen, .3 is three tenths down from the first line, and so on. If the line is specified as a fraction, the actual line number is recalculated if the terminal window is resized, so that the target line remains at the specified fraction of the screen height. If any form of the \-j option is used, forward searches begin at the line immediately after the target line, and backward searches begin at the target line. For example, if "\-j4" is used, the target line is the fourth line on the screen, so forward searches begin at the fifth line on the screen. .IP "\-J or \-\-status-column" Displays a status column at the left edge of the screen. The status column shows the lines that matched the current search. The status column is also used if the \-w or \-W option is in effect. .IP "\-k\fIfilename\fP or \-\-lesskey-file=\fIfilename\fP" Causes .I less to open and interpret the named file as a .I lesskey (1) file. Multiple \-k options may be specified. If the LESSKEY or LESSKEY_SYSTEM environment variable is set, or if a lesskey file is found in a standard place (see KEY BINDINGS), it is also used as a .I lesskey file. .IP "\-K or \-\-quit-on-intr" Causes .I less to exit immediately when an interrupt character (usually ^C) is typed. Normally, an interrupt character causes .I less to stop whatever it is doing and return to its command prompt. Note that use of this option makes it impossible to return to the command prompt from the "F" command. .IP "\-L or \-\-no-lessopen" Ignore the LESSOPEN environment variable (see the INPUT PREPROCESSOR section below). This option can be set from within \fIless\fP, but it will apply only to files opened subsequently, not to the file which is currently open. .IP "\-m or \-\-long-prompt" Causes .I less to prompt verbosely (like \fImore\fP), with the percent into the file. By default, .I less prompts with a colon. .IP "\-M or \-\-LONG-PROMPT" Causes .I less to prompt even more verbosely than .I more. .IP "\-n or \-\-line-numbers" Suppresses line numbers. The default (to use line numbers) may cause .I less to run more slowly in some cases, especially with a very large input file. Suppressing line numbers with the \-n option will avoid this problem. Using line numbers means: the line number will be displayed in the verbose prompt and in the = command, and the v command will pass the current line number to the editor (see also the discussion of LESSEDIT in PROMPTS below). .IP "\-N or \-\-LINE-NUMBERS" Causes a line number to be displayed at the beginning of each line in the display. .IP "\-o\fIfilename\fP or \-\-log-file=\fIfilename\fP" Causes .I less to copy its input to the named file as it is being viewed. This applies only when the input file is a pipe, not an ordinary file. If the file already exists, .I less will ask for confirmation before overwriting it. .IP "\-O\fIfilename\fP or \-\-LOG-FILE=\fIfilename\fP" The \-O option is like \-o, but it will overwrite an existing file without asking for confirmation. .sp If no log file has been specified, the \-o and \-O options can be used from within .I less to specify a log file. Without a file name, they will simply report the name of the log file. The "s" command is equivalent to specifying \-o from within .I less. .IP "\-p\fIpattern\fP or \-\-pattern=\fIpattern\fP" The \-p option on the command line is equivalent to specifying +/\fIpattern\fP; that is, it tells .I less to start at the first occurrence of \fIpattern\fP in the file. .IP "\-P\fIprompt\fP or \-\-prompt=\fIprompt\fP" Provides a way to tailor the three prompt styles to your own preference. This option would normally be put in the LESS environment variable, rather than being typed in with each .I less command. Such an option must either be the last option in the LESS variable, or be terminated by a dollar sign. -Ps followed by a string changes the default (short) prompt to that string. -Pm changes the medium (\-m) prompt. -PM changes the long (\-M) prompt. -Ph changes the prompt for the help screen. -P= changes the message printed by the = command. -Pw changes the message printed while waiting for data (in the F command). All prompt strings consist of a sequence of letters and special escape sequences. See the section on PROMPTS for more details. .IP "\-q or \-\-quiet or \-\-silent" Causes moderately "quiet" operation: the terminal bell is not rung if an attempt is made to scroll past the end of the file or before the beginning of the file. If the terminal has a "visual bell", it is used instead. The bell will be rung on certain other errors, such as typing an invalid character. The default is to ring the terminal bell in all such cases. .IP "\-Q or \-\-QUIET or \-\-SILENT" Causes totally "quiet" operation: the terminal bell is never rung. .IP "\-r or \-\-raw-control-chars" Causes "raw" control characters to be displayed. The default is to display control characters using the caret notation; for example, a control-A (octal 001) is displayed as "^A". Warning: when the \-r option is used, .I less cannot keep track of the actual appearance of the screen (since this depends on how the screen responds to each type of control character). Thus, various display problems may result, such as long lines being split in the wrong place. .IP "\-R or \-\-RAW-CONTROL-CHARS" Like \-r, but only ANSI "color" escape sequences are output in "raw" form. Unlike \-r, the screen appearance is maintained correctly in most cases. ANSI "color" escape sequences are sequences of the form: .sp ESC [ ... m .sp where the "..." is zero or more color specification characters For the purpose of keeping track of screen appearance, ANSI color escape sequences are assumed to not move the cursor. You can make .I less think that characters other than "m" can end ANSI color escape sequences by setting the environment variable LESSANSIENDCHARS to the list of characters which can end a color escape sequence. And you can make .I less think that characters other than the standard ones may appear between the ESC and the m by setting the environment variable LESSANSIMIDCHARS to the list of characters which can appear. .IP "\-s or \-\-squeeze-blank-lines" Causes consecutive blank lines to be squeezed into a single blank line. This is useful when viewing .I nroff output. .IP "\-S or \-\-chop-long-lines" Causes lines longer than the screen width to be chopped rather than folded. That is, the portion of a long line that does not fit in the screen width is not shown. The default is to fold long lines; that is, display the remainder on the next line. .IP "\-t\fItag\fP or \-\-tag=\fItag\fP" The \-t option, followed immediately by a TAG, will edit the file containing that tag. For this to work, tag information must be available; for example, there may be a file in the current directory called "tags", which was previously built by .I ctags (1) or an equivalent command. If the environment variable LESSGLOBALTAGS is set, it is taken to be the name of a command compatible with .I global (1), and that command is executed to find the tag. (See http://www.gnu.org/software/global/global.html). The \-t option may also be specified from within .I less (using the \- command) as a way of examining a new file. The command ":t" is equivalent to specifying \-t from within .I less. .IP "\-T\fItagsfile\fP or \-\-tag-file=\fItagsfile\fP" Specifies a tags file to be used instead of "tags". .IP "\-u or \-\-underline-special" Causes backspaces and carriage returns to be treated as printable characters; that is, they are sent to the terminal when they appear in the input. .IP "\-U or \-\-UNDERLINE-SPECIAL" Causes backspaces, tabs and carriage returns to be treated as control characters; that is, they are handled as specified by the \-r option. .sp By default, if neither \-u nor \-U is given, backspaces which appear adjacent to an underscore character are treated specially: the underlined text is displayed using the terminal's hardware underlining capability. Also, backspaces which appear between two identical characters are treated specially: the overstruck text is printed using the terminal's hardware boldface capability. Other backspaces are deleted, along with the preceding character. Carriage returns immediately followed by a newline are deleted. other carriage returns are handled as specified by the \-r option. Text which is overstruck or underlined can be searched for if neither \-u nor \-U is in effect. .IP "\-V or \-\-version" Displays the version number of .I less. .IP "\-w or \-\-hilite-unread" Temporarily highlights the first "new" line after a forward movement of a full page. The first "new" line is the line immediately following the line previously at the bottom of the screen. Also highlights the target line after a g or p command. The highlight is removed at the next command which causes movement. The entire line is highlighted, unless the \-J option is in effect, in which case only the status column is highlighted. .IP "\-W or \-\-HILITE-UNREAD" Like \-w, but temporarily highlights the first new line after any forward movement command larger than one line. .IP "\-x\fIn\fP,... or \-\-tabs=\fIn\fP,..." Sets tab stops. If only one \fIn\fP is specified, tab stops are set at multiples of \fIn\fP. If multiple values separated by commas are specified, tab stops are set at those positions, and then continue with the same spacing as the last two. For example, \fI-x9,17\fP will set tabs at positions 9, 17, 25, 33, etc. The default for \fIn\fP is 8. .IP "\-X or \-\-no-init" Disables sending the termcap initialization and deinitialization strings to the terminal. This is sometimes desirable if the deinitialization string does something unnecessary, like clearing the screen. .IP "\-y\fIn\fP or \-\-max-forw-scroll=\fIn\fP" Specifies a maximum number of lines to scroll forward. If it is necessary to scroll forward more than \fIn\fP lines, the screen is repainted instead. The \-c or \-C option may be used to repaint from the top of the screen if desired. By default, any forward movement causes scrolling. .IP "\-[z]\fIn\fP or \-\-window=\fIn\fP" Changes the default scrolling window size to \fIn\fP lines. The default is one screenful. The z and w commands can also be used to change the window size. The "z" may be omitted for compatibility with some versions of .I more. If the number .I n is negative, it indicates .I n lines less than the current screen size. For example, if the screen is 24 lines, \fI\-z-4\fP sets the scrolling window to 20 lines. If the screen is resized to 40 lines, the scrolling window automatically changes to 36 lines. .IP "\-\fI\(dqcc\fP\ or\ \-\-quotes=\fIcc\fP" Changes the filename quoting character. This may be necessary if you are trying to name a file which contains both spaces and quote characters. Followed by a single character, this changes the quote character to that character. Filenames containing a space should then be surrounded by that character rather than by double quotes. Followed by two characters, changes the open quote to the first character, and the close quote to the second character. Filenames containing a space should then be preceded by the open quote character and followed by the close quote character. Note that even after the quote characters are changed, this option remains \-" (a dash followed by a double quote). .IP "\-~ or \-\-tilde" Normally lines after end of file are displayed as a single tilde (~). This option causes lines after end of file to be displayed as blank lines. .IP "\-# or \-\-shift" Specifies the default number of positions to scroll horizontally in the RIGHTARROW and LEFTARROW commands. If the number specified is zero, it sets the default number of positions to one half of the screen width. Alternately, the number may be specified as a fraction of the width of the screen, starting with a decimal point: .5 is half of the screen width, .3 is three tenths of the screen width, and so on. If the number is specified as a fraction, the actual number of scroll positions is recalculated if the terminal window is resized, so that the actual scroll remains at the specified fraction of the screen width. .IP "\-\-no-keypad" Disables sending the keypad initialization and deinitialization strings to the terminal. This is sometimes useful if the keypad strings make the numeric keypad behave in an undesirable manner. .IP "\-\-follow-name" Normally, if the input file is renamed while an F command is executing, .I less will continue to display the contents of the original file despite its name change. If \-\-follow-name is specified, during an F command .I less will periodically attempt to reopen the file by name. If the reopen succeeds and the file is a different file from the original (which means that a new file has been created with the same name as the original (now renamed) file), .I less will display the contents of that new file. .IP \-\- A command line argument of "\-\-" marks the end of option arguments. Any arguments following this are interpreted as filenames. This can be useful when viewing a file whose name begins with a "\-" or "+". .IP + If a command line option begins with \fB+\fP, the remainder of that option is taken to be an initial command to .I less. For example, +G tells .I less to start at the end of the file rather than the beginning, and +/xyz tells it to start at the first occurrence of "xyz" in the file. As a special case, + acts like +g; that is, it starts the display at the specified line number (however, see the caveat under the "g" command above). If the option starts with ++, the initial command applies to every file being viewed, not just the first one. The + command described previously may also be used to set (or change) an initial command for every file. .SH "LINE EDITING" When entering command line at the bottom of the screen (for example, a filename for the :e command, or the pattern for a search command), certain keys can be used to manipulate the command line. Most commands have an alternate form in [ brackets ] which can be used if a key does not exist on a particular keyboard. (Note that the forms beginning with ESC do not work in some MS-DOS and Windows systems because ESC is the line erase character.) Any of these special keys may be entered literally by preceding it with the "literal" character, either ^V or ^A. A backslash itself may also be entered literally by entering two backslashes. .IP "LEFTARROW [ ESC-h ]" Move the cursor one space to the left. .IP "RIGHTARROW [ ESC-l ]" Move the cursor one space to the right. .IP "^LEFTARROW [ ESC-b or ESC-LEFTARROW ]" (That is, CONTROL and LEFTARROW simultaneously.) Move the cursor one word to the left. .IP "^RIGHTARROW [ ESC-w or ESC-RIGHTARROW ]" (That is, CONTROL and RIGHTARROW simultaneously.) Move the cursor one word to the right. .IP "HOME [ ESC-0 ]" Move the cursor to the beginning of the line. .IP "END [ ESC-$ ]" Move the cursor to the end of the line. .IP "BACKSPACE" Delete the character to the left of the cursor, or cancel the command if the command line is empty. .IP "DELETE or [ ESC-x ]" Delete the character under the cursor. .IP "^BACKSPACE [ ESC-BACKSPACE ]" (That is, CONTROL and BACKSPACE simultaneously.) Delete the word to the left of the cursor. .IP "^DELETE [ ESC-X or ESC-DELETE ]" (That is, CONTROL and DELETE simultaneously.) Delete the word under the cursor. .IP "UPARROW [ ESC-k ]" Retrieve the previous command line. .IP "DOWNARROW [ ESC-j ]" Retrieve the next command line. .IP "TAB" Complete the partial filename to the left of the cursor. If it matches more than one filename, the first match is entered into the command line. Repeated TABs will cycle thru the other matching filenames. If the completed filename is a directory, a "/" is appended to the filename. (On MS-DOS systems, a "\e" is appended.) The environment variable LESSSEPARATOR can be used to specify a different character to append to a directory name. .IP "BACKTAB [ ESC-TAB ]" Like, TAB, but cycles in the reverse direction thru the matching filenames. .IP "^L" Complete the partial filename to the left of the cursor. If it matches more than one filename, all matches are entered into the command line (if they fit). .IP "^U (Unix and OS/2) or ESC (MS-DOS)" Delete the entire command line, or cancel the command if the command line is empty. If you have changed your line-kill character in Unix to something other than ^U, that character is used instead of ^U. .SH "KEY BINDINGS" You may define your own .I less commands by using the program .I lesskey (1) to create a lesskey file. This file specifies a set of command keys and an action associated with each key. You may also use .I lesskey to change the line-editing keys (see LINE EDITING), and to set environment variables. If the environment variable LESSKEY is set, .I less uses that as the name of the lesskey file. Otherwise, .I less looks in a standard place for the lesskey file: On Unix systems, .I less looks for a lesskey file called "$HOME/.less". On MS-DOS and Windows systems, .I less looks for a lesskey file called "$HOME/_less", and if it is not found there, then looks for a lesskey file called "_less" in any directory specified in the PATH environment variable. On OS/2 systems, .I less looks for a lesskey file called "$HOME/less.ini", and if it is not found, then looks for a lesskey file called "less.ini" in any directory specified in the INIT environment variable, and if it not found there, then looks for a lesskey file called "less.ini" in any directory specified in the PATH environment variable. See the .I lesskey manual page for more details. .P A system-wide lesskey file may also be set up to provide key bindings. If a key is defined in both a local lesskey file and in the system-wide file, key bindings in the local file take precedence over those in the system-wide file. If the environment variable LESSKEY_SYSTEM is set, .I less uses that as the name of the system-wide lesskey file. Otherwise, .I less looks in a standard place for the system-wide lesskey file: On Unix systems, the system-wide lesskey file is /usr/local/etc/sysless. (However, if .I less was built with a different sysconf directory than /usr/local/etc, that directory is where the sysless file is found.) On MS-DOS and Windows systems, the system-wide lesskey file is c:\e_sysless. On OS/2 systems, the system-wide lesskey file is c:\esysless.ini. .SH "INPUT PREPROCESSOR" You may define an "input preprocessor" for .I less. Before .I less opens a file, it first gives your input preprocessor a chance to modify the way the contents of the file are displayed. An input preprocessor is simply an executable program (or shell script), which writes the contents of the file to a different file, called the replacement file. The contents of the replacement file are then displayed in place of the contents of the original file. However, it will appear to the user as if the original file is opened; that is, .I less will display the original filename as the name of the current file. .PP An input preprocessor receives one command line argument, the original filename, as entered by the user. It should create the replacement file, and when finished, print the name of the replacement file to its standard output. If the input preprocessor does not output a replacement filename, .I less uses the original file, as normal. The input preprocessor is not called when viewing standard input. To set up an input preprocessor, set the LESSOPEN environment variable to a command line which will invoke your input preprocessor. This command line should include one occurrence of the string "%s", which will be replaced by the filename when the input preprocessor command is invoked. .PP When .I less closes a file opened in such a way, it will call another program, called the input postprocessor, which may perform any desired clean-up action (such as deleting the replacement file created by LESSOPEN). This program receives two command line arguments, the original filename as entered by the user, and the name of the replacement file. To set up an input postprocessor, set the LESSCLOSE environment variable to a command line which will invoke your input postprocessor. It may include two occurrences of the string "%s"; the first is replaced with the original name of the file and the second with the name of the replacement file, which was output by LESSOPEN. .PP For example, on many Unix systems, these two scripts will allow you to keep files in compressed format, but still let .I less view them directly: .PP lessopen.sh: .br #! /bin/sh .br case "$1" in .br *.Z) uncompress -\c $1 >/tmp/less.$$ 2>/dev/null .br if [ \-s /tmp/less.$$ ]; then .br echo /tmp/less.$$ .br else .br rm \-f /tmp/less.$$ .br fi .br ;; .br esac .PP lessclose.sh: .br #! /bin/sh .br rm $2 .PP To use these scripts, put them both where they can be executed and set LESSOPEN="lessopen.sh\ %s", and LESSCLOSE="lessclose.sh\ %s\ %s". More complex LESSOPEN and LESSCLOSE scripts may be written to accept other types of compressed files, and so on. .PP It is also possible to set up an input preprocessor to pipe the file data directly to .I less, rather than putting the data into a replacement file. This avoids the need to decompress the entire file before starting to view it. An input preprocessor that works this way is called an input pipe. An input pipe, instead of writing the name of a replacement file on its standard output, writes the entire contents of the replacement file on its standard output. If the input pipe does not write any characters on its standard output, then there is no replacement file and .I less uses the original file, as normal. To use an input pipe, make the first character in the LESSOPEN environment variable a vertical bar (|) to signify that the input preprocessor is an input pipe. .PP For example, on many Unix systems, this script will work like the previous example scripts: .PP lesspipe.sh: .br #! /bin/sh .br case "$1" in .br *.Z) uncompress \-c $1 2>/dev/null .br ;; .br esac .br .PP To use this script, put it where it can be executed and set LESSOPEN="|lesspipe.sh %s". When an input pipe is used, a LESSCLOSE postprocessor can be used, but it is usually not necessary since there is no replacement file to clean up. In this case, the replacement file name passed to the LESSCLOSE postprocessor is "\-". .PP For compatibility with previous versions of .I less, the input preprocessor or pipe is not used if .I less is viewing standard input. However, if the first character of LESSOPEN is a dash (\-), the input preprocessor is used on standard input as well as other files. In this case, the dash is not considered to be part of the preprocessor command. If standard input is being viewed, the input preprocessor is passed a file name consisting of a single dash. Similarly, if the first two characters of LESSOPEN are vertical bar and dash (|\-), the input pipe is used on standard input as well as other files. Again, in this case the dash is not considered to be part of the input pipe command. .SH "NATIONAL CHARACTER SETS" There are three types of characters in the input file: .IP "normal characters" can be displayed directly to the screen. .IP "control characters" should not be displayed directly, but are expected to be found in ordinary text files (such as backspace and tab). .IP "binary characters" should not be displayed directly and are not expected to be found in text files. .PP A "character set" is simply a description of which characters are to be considered normal, control, and binary. The LESSCHARSET environment variable may be used to select a character set. Possible values for LESSCHARSET are: .IP ascii BS, TAB, NL, CR, and formfeed are control characters, all chars with values between 32 and 126 are normal, and all others are binary. .IP iso8859 Selects an ISO 8859 character set. This is the same as ASCII, except characters between 160 and 255 are treated as normal characters. .IP latin1 Same as iso8859. .IP latin9 Same as iso8859. .IP dos Selects a character set appropriate for MS-DOS. .IP ebcdic Selects an EBCDIC character set. .IP IBM-1047 Selects an EBCDIC character set used by OS/390 Unix Services. This is the EBCDIC analogue of latin1. You get similar results by setting either LESSCHARSET=IBM-1047 or LC_CTYPE=en_US in your environment. .IP koi8-r Selects a Russian character set. .IP next Selects a character set appropriate for NeXT computers. .IP utf-8 Selects the UTF-8 encoding of the ISO 10646 character set. UTF-8 is special in that it supports multi-byte characters in the input file. It is the only character set that supports multi-byte characters. .IP windows Selects a character set appropriate for Microsoft Windows (cp 1251). .PP In rare cases, it may be desired to tailor .I less to use a character set other than the ones definable by LESSCHARSET. In this case, the environment variable LESSCHARDEF can be used to define a character set. It should be set to a string where each character in the string represents one character in the character set. The character "." is used for a normal character, "c" for control, and "b" for binary. A decimal number may be used for repetition. For example, "bccc4b." would mean character 0 is binary, 1, 2 and 3 are control, 4, 5, 6 and 7 are binary, and 8 is normal. All characters after the last are taken to be the same as the last, so characters 9 through 255 would be normal. (This is an example, and does not necessarily represent any real character set.) .PP This table shows the value of LESSCHARDEF which is equivalent to each of the possible values for LESSCHARSET: .sp ascii\ 8bcccbcc18b95.b .br dos\ \ \ 8bcccbcc12bc5b95.b. .br ebcdic 5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b .br \ \ \ \ \ \ 9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b. .br IBM-1047 4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc .br \ \ \ \ \ \ 191.b .br iso8859 8bcccbcc18b95.33b. .br koi8-r 8bcccbcc18b95.b128. .br latin1 8bcccbcc18b95.33b. .br next\ \ 8bcccbcc18b95.bb125.bb .PP If neither LESSCHARSET nor LESSCHARDEF is set, but any of the strings "UTF-8", "UTF8", "utf-8" or "utf8" is found in the LC_ALL, LC_TYPE or LANG environment variables, then the default character set is utf-8. .PP If that string is not found, but your system supports the .I setlocale interface, .I less will use setlocale to determine the character set. setlocale is controlled by setting the LANG or LC_CTYPE environment variables. .PP Finally, if the .I setlocale interface is also not available, the default character set is latin1. .PP Control and binary characters are displayed in standout (reverse video). Each such character is displayed in caret notation if possible (e.g. ^A for control-A). Caret notation is used only if inverting the 0100 bit results in a normal printable character. Otherwise, the character is displayed as a hex number in angle brackets. This format can be changed by setting the LESSBINFMT environment variable. LESSBINFMT may begin with a "*" and one character to select the display attribute: "*k" is blinking, "*d" is bold, "*u" is underlined, "*s" is standout, and "*n" is normal. If LESSBINFMT does not begin with a "*", normal attribute is assumed. The remainder of LESSBINFMT is a string which may include one printf-style escape sequence (a % followed by x, X, o, d, etc.). For example, if LESSBINFMT is "*u[%x]", binary characters are displayed in underlined hexadecimal surrounded by brackets. The default if no LESSBINFMT is specified is "*s<%X>". The default if no LESSBINFMT is specified is "*s<%02X>". Warning: the result of expanding the character via LESSBINFMT must be less than 31 characters. .PP When the character set is utf-8, the LESSUTFBINFMT environment variable acts similarly to LESSBINFMT but it applies to Unicode code points that were successfully decoded but are unsuitable for display (e.g., unassigned code points). Its default value is "". Note that LESSUTFBINFMT and LESSBINFMT share their display attribute setting ("*x") so specifying one will affect both; LESSUTFBINFMT is read after LESSBINFMT so its setting, if any, will have priority. Problematic octets in a UTF-8 file (octets of a truncated sequence, octets of a complete but non-shortest form sequence, illegal octets, and stray trailing octets) are displayed individually using LESSBINFMT so as to facilitate diagnostic of how the UTF-8 file is ill-formed. .SH "PROMPTS" The \-P option allows you to tailor the prompt to your preference. The string given to the \-P option replaces the specified prompt string. Certain characters in the string are interpreted specially. The prompt mechanism is rather complicated to provide flexibility, but the ordinary user need not understand the details of constructing personalized prompt strings. .sp A percent sign followed by a single character is expanded according to what the following character is: .IP "%b\fIX\fP" Replaced by the byte offset into the current input file. The b is followed by a single character (shown as \fIX\fP above) which specifies the line whose byte offset is to be used. If the character is a "t", the byte offset of the top line in the display is used, an "m" means use the middle line, a "b" means use the bottom line, a "B" means use the line just after the bottom line, and a "j" means use the "target" line, as specified by the \-j option. .IP "%B" Replaced by the size of the current input file. .IP "%c" Replaced by the column number of the text appearing in the first column of the screen. .IP "%d\fIX\fP" Replaced by the page number of a line in the input file. The line to be used is determined by the \fIX\fP, as with the %b option. .IP "%D" Replaced by the number of pages in the input file, or equivalently, the page number of the last line in the input file. .IP "%E" Replaced by the name of the editor (from the VISUAL environment variable, or the EDITOR environment variable if VISUAL is not defined). See the discussion of the LESSEDIT feature below. .IP "%f" Replaced by the name of the current input file. .IP "%i" Replaced by the index of the current file in the list of input files. .IP "%l\fIX\fP" Replaced by the line number of a line in the input file. The line to be used is determined by the \fIX\fP, as with the %b option. .IP "%L" Replaced by the line number of the last line in the input file. .IP "%m" Replaced by the total number of input files. .IP "%p\fIX\fP" Replaced by the percent into the current input file, based on byte offsets. The line used is determined by the \fIX\fP as with the %b option. .IP "%P\fIX\fP" Replaced by the percent into the current input file, based on line numbers. The line used is determined by the \fIX\fP as with the %b option. .IP "%s" Same as %B. .IP "%t" Causes any trailing spaces to be removed. Usually used at the end of the string, but may appear anywhere. .IP "%x" Replaced by the name of the next input file in the list. .PP If any item is unknown (for example, the file size if input is a pipe), a question mark is printed instead. .PP The format of the prompt string can be changed depending on certain conditions. A question mark followed by a single character acts like an "IF": depending on the following character, a condition is evaluated. If the condition is true, any characters following the question mark and condition character, up to a period, are included in the prompt. If the condition is false, such characters are not included. A colon appearing between the question mark and the period can be used to establish an "ELSE": any characters between the colon and the period are included in the string if and only if the IF condition is false. Condition characters (which follow a question mark) may be: .IP "?a" True if any characters have been included in the prompt so far. .IP "?b\fIX\fP" True if the byte offset of the specified line is known. .IP "?B" True if the size of current input file is known. .IP "?c" True if the text is horizontally shifted (%c is not zero). .IP "?d\fIX\fP" True if the page number of the specified line is known. .IP "?e" True if at end-of-file. .IP "?f" True if there is an input filename (that is, if input is not a pipe). .IP "?l\fIX\fP" True if the line number of the specified line is known. .IP "?L" True if the line number of the last line in the file is known. .IP "?m" True if there is more than one input file. .IP "?n" True if this is the first prompt in a new input file. .IP "?p\fIX\fP" True if the percent into the current input file, based on byte offsets, of the specified line is known. .IP "?P\fIX\fP" True if the percent into the current input file, based on line numbers, of the specified line is known. .IP "?s" Same as "?B". .IP "?x" True if there is a next input file (that is, if the current input file is not the last one). .PP Any characters other than the special ones (question mark, colon, period, percent, and backslash) become literally part of the prompt. Any of the special characters may be included in the prompt literally by preceding it with a backslash. .PP Some examples: .sp ?f%f:Standard input. .sp This prompt prints the filename, if known; otherwise the string "Standard input". .sp ?f%f .?ltLine %lt:?pt%pt\e%:?btByte %bt:-... .sp This prompt would print the filename, if known. The filename is followed by the line number, if known, otherwise the percent if known, otherwise the byte offset if known. Otherwise, a dash is printed. Notice how each question mark has a matching period, and how the % after the %pt is included literally by escaping it with a backslash. .sp ?n?f%f\ .?m(file\ %i\ of\ %m)\ ..?e(END)\ ?x-\ Next\e:\ %x..%t .sp This prints the filename if this is the first prompt in a file, followed by the "file N of N" message if there is more than one input file. Then, if we are at end-of-file, the string "(END)" is printed followed by the name of the next file, if there is one. Finally, any trailing spaces are truncated. This is the default prompt. For reference, here are the defaults for the other two prompts (\-m and \-M respectively). Each is broken into two lines here for readability only. .nf .sp ?n?f%f\ .?m(file\ %i\ of\ %m)\ ..?e(END)\ ?x-\ Next\e:\ %x.: ?pB%pB\e%:byte\ %bB?s/%s...%t .sp ?f%f\ .?n?m(file\ %i\ of\ %m)\ ..?ltlines\ %lt-%lb?L/%L.\ : byte\ %bB?s/%s.\ .?e(END)\ ?x-\ Next\e:\ %x.:?pB%pB\e%..%t .sp .fi And here is the default message produced by the = command: .nf .sp ?f%f\ .?m(file\ %i\ of\ %m)\ .?ltlines\ %lt-%lb?L/%L.\ . byte\ %bB?s/%s.\ ?e(END)\ :?pB%pB\e%..%t .fi .PP The prompt expansion features are also used for another purpose: if an environment variable LESSEDIT is defined, it is used as the command to be executed when the v command is invoked. The LESSEDIT string is expanded in the same way as the prompt strings. The default value for LESSEDIT is: .nf .sp %E\ ?lm+%lm.\ %f .sp .fi Note that this expands to the editor name, followed by a + and the line number, followed by the file name. If your editor does not accept the "+linenumber" syntax, or has other differences in invocation syntax, the LESSEDIT variable can be changed to modify this default. .SH SECURITY When the environment variable LESSSECURE is set to 1, .I less runs in a "secure" mode. This means these features are disabled: .RS .IP "!" the shell command .IP "|" the pipe command .IP ":e" the examine command. .IP "v" the editing command .IP "s \-o" log files .IP "\-k" use of lesskey files .IP "\-t" use of tags files .IP " " metacharacters in filenames, such as * .IP " " filename completion (TAB, ^L) .RE .PP Less can also be compiled to be permanently in "secure" mode. .SH "COMPATIBILITY WITH MORE" If the environment variable LESS_IS_MORE is set to 1, or if the program is invoked via a file link named "more", .I less behaves (mostly) in conformance with the POSIX "more" command specification. In this mode, less behaves differently in these ways: .PP The \-e option works differently. If the \-e option is not set, .I less behaves as if the \-E option were set. If the \-e option is set, .I less behaves as if the \-e and \-F options were set. .PP The \-m option works differently. If the \-m option is not set, the medium prompt is used, and it is prefixed with the string "--More--". If the \-m option is set, the short prompt is used. .PP The \-n option acts like the \-z option. The normal behavior of the \-n option is unavailable in this mode. .PP The parameter to the \-p option is taken to be a .I less command rather than a search pattern. .PP The LESS environment variable is ignored, and the MORE environment variable is used in its place. .SH "ENVIRONMENT VARIABLES" Environment variables may be specified either in the system environment as usual, or in a .I lesskey (1) file. If environment variables are defined in more than one place, variables defined in a local lesskey file take precedence over variables defined in the system environment, which take precedence over variables defined in the system-wide lesskey file. .IP COLUMNS Sets the number of columns on the screen. Takes precedence over the number of columns specified by the TERM variable. (But if you have a windowing system which supports TIOCGWINSZ or WIOCGETD, the window system's idea of the screen size takes precedence over the LINES and COLUMNS environment variables.) .IP EDITOR The name of the editor (used for the v command). .IP HOME Name of the user's home directory (used to find a lesskey file on Unix and OS/2 systems). .IP "HOMEDRIVE, HOMEPATH" Concatenation of the HOMEDRIVE and HOMEPATH environment variables is the name of the user's home directory if the HOME variable is not set (only in the Windows version). .IP INIT Name of the user's init directory (used to find a lesskey file on OS/2 systems). .IP LANG Language for determining the character set. .IP LC_CTYPE Language for determining the character set. .IP LESS Options which are passed to .I less automatically. .IP LESSANSIENDCHARS Characters which may end an ANSI color escape sequence (default "m"). .IP LESSANSIMIDCHARS Characters which may appear between the ESC character and the end character in an ANSI color escape sequence (default "0123456789;[?!"'#%()*+\ ". .IP LESSBINFMT Format for displaying non-printable, non-control characters. .IP LESSCHARDEF Defines a character set. .IP LESSCHARSET Selects a predefined character set. .IP LESSCLOSE Command line to invoke the (optional) input-postprocessor. .IP LESSECHO Name of the lessecho program (default "lessecho"). The lessecho program is needed to expand metacharacters, such as * and ?, in filenames on Unix systems. .IP LESSEDIT Editor prototype string (used for the v command). See discussion under PROMPTS. .IP LESSGLOBALTAGS Name of the command used by the \-t option to find global tags. Normally should be set to "global" if your system has the .I global (1) command. If not set, global tags are not used. .IP LESSHISTFILE Name of the history file used to remember search commands and shell commands between invocations of .I less. If set to "\-" or "/dev/null", a history file is not used. The default is "$HOME/.lesshst" on Unix systems, "$HOME/_lesshst" on DOS and Windows systems, or "$HOME/lesshst.ini" or "$INIT/lesshst.ini" on OS/2 systems. .IP LESSHISTSIZE The maximum number of commands to save in the history file. The default is 100. .IP LESSKEY Name of the default lesskey(1) file. .IP LESSKEY_SYSTEM Name of the default system-wide lesskey(1) file. .IP LESSMETACHARS List of characters which are considered "metacharacters" by the shell. .IP LESSMETAESCAPE Prefix which less will add before each metacharacter in a command sent to the shell. If LESSMETAESCAPE is an empty string, commands containing metacharacters will not be passed to the shell. .IP LESSOPEN Command line to invoke the (optional) input-preprocessor. .IP LESSSECURE Runs less in "secure" mode. See discussion under SECURITY. .IP LESSSEPARATOR String to be appended to a directory name in filename completion. .IP LESSUTFBINFMT Format for displaying non-printable Unicode code points. .IP LESS_IS_MORE Emulate the .I more (1) command. .IP LINES Sets the number of lines on the screen. Takes precedence over the number of lines specified by the TERM variable. (But if you have a windowing system which supports TIOCGWINSZ or WIOCGETD, the window system's idea of the screen size takes precedence over the LINES and COLUMNS environment variables.) .IP PATH User's search path (used to find a lesskey file on MS-DOS and OS/2 systems). .IP SHELL The shell used to execute the ! command, as well as to expand filenames. .IP TERM The type of terminal on which .I less is being run. .IP VISUAL The name of the editor (used for the v command). .SH "SEE ALSO" lesskey(1) .SH COPYRIGHT Copyright (C) 1984-2009 Mark Nudelman .PP less is part of the GNU project and is free software. You can redistribute it and/or modify it under the terms of either (1) the GNU General Public License as published by the Free Software Foundation; or (2) the Less License. See the file README in the less distribution for more details regarding redistribution. You should have received a copy of the GNU General Public License along with the source for less; see the file COPYING. If not, write to the Free Software Foundation, 59 Temple Place, Suite 330, Boston, MA 02111-1307, USA. You should also have received a copy of the Less License; see the file LICENSE. .PP less is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. .SH AUTHOR .PP Mark Nudelman .br See http://www.greenwoodsoftware.com/less/bugs.html for the latest list of known bugs in less. .br Send bug reports or comments to the above address or to .br bug-less@gnu.org. .br For more information, see the less homepage at .br http://www.greenwoodsoftware.com/less. 0707010008d326000081a40000000000000000000000014cad6b1f000004c9000000b600010002ffffffffffffffff0000002900000000root/usr/local/share/man/man1/lessecho.1.TH LESSECHO 1 "Version 436: 07 Jul 2009" .SH NAME lessecho \- expand metacharacters .SH SYNOPSIS .B lessecho .I "[-ox] [-cx] [-pn] [-dn] [-mx] [-nn] [-ex] [-a] file ..." .SH "DESCRIPTION" .I lessecho is a program that simply echos its arguments on standard output. But any argument containing spaces is enclosed in quotes. .SH OPTIONS A summary of options is included below. .TP .B \-ox Specifies "x" to be the open quote character. .TP .B \-cx Specifies "x" to be the close quote character. .TP .B \-pn Specifies "n" to be the open quote character, as an integer. .TP .B \-dn Specifies "n" to be the close quote character, as an integer. .TP .B \-mx Specifies "x" to be a metachar. .TP .B \-nn Specifies "n" to be a metachar, as an integer. .TP .B \-ex Specifies "x" to be the escape char for metachars. .TP .B \-fn Specifies "n" to be the escape char for metachars, as an integer. .TP .B \-a Specifies that all arguments are to be quoted. The default is that only arguments containing spaces are quoted. .SH "SEE ALSO" less(1) .SH AUTHOR This manual page was written by Thomas Schoepf , for the Debian GNU/Linux system (but may be used by others). .PP Send bug reports or comments to bug-less@gnu.org. 07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!