# PaCkAgE DaTaStReAm wget 1 4914 # end of header 0707010005a66d000081a40000000000000000000000014fa8aa66000000f3000000b500010002ffffffffffffffff0000000d00000000wget/pkginfoPKG=wget NAME=GNU wget 1.13.4 i86pc Solaris 10 VERSION=1.13.4 PSTAMP=8th May 2012 VENDOR=GNU EMAIL=http://www.gnu.org/software/wget/ DESC=GNU file retriever ARCH=i386 CATEGORY=utility CLASSES=none BASEDIR=/ ISTATES=S s 1 2 3 RSTATES=S s 1 2 3 0707010005a66c000081a40000000000000000000000014fa8aa66000022e7000000b500010002ffffffffffffffff0000000c00000000wget/pkgmap: 1 4914 1 d none /usr ? ? ? 1 d none /usr/local ? ? ? 1 d none /usr/local/bin 0755 root root 1 f none /usr/local/bin/wget 0755 root root 537244 43048 1336452875 1 d none /usr/local/etc 0755 root root 1 f none /usr/local/etc/wgetrc 0644 root root 4224 41984 1143435724 1 d none /usr/local/share 0755 root root 1 d none /usr/local/share/info 0755 root root 1 f none /usr/local/share/info/dir 0644 root root 8383 35189 1336452875 1 f none /usr/local/share/info/wget.info 0644 root root 200545 37896 1336452875 1 d none /usr/local/share/locale 0755 root root 1 d none /usr/local/share/locale/be 0755 root root 1 d none /usr/local/share/locale/be/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/be/LC_MESSAGES/wget.mo 0644 root root 29289 29147 1336452875 1 d none /usr/local/share/locale/bg 0755 root root 1 d none /usr/local/share/locale/bg/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/bg/LC_MESSAGES/wget.mo 0644 root root 10492 38084 1336452875 1 d none /usr/local/share/locale/ca 0755 root root 1 d none /usr/local/share/locale/ca/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/ca/LC_MESSAGES/wget.mo 0644 root root 49445 64800 1336452875 1 d none /usr/local/share/locale/cs 0755 root root 1 d none /usr/local/share/locale/cs/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/cs/LC_MESSAGES/wget.mo 0644 root root 49659 49285 1336452875 1 d none /usr/local/share/locale/da 0755 root root 1 d none /usr/local/share/locale/da/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/da/LC_MESSAGES/wget.mo 0644 root root 46126 30156 1336452875 1 d none /usr/local/share/locale/de 0755 root root 1 d none /usr/local/share/locale/de/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/de/LC_MESSAGES/wget.mo 0644 root root 50076 44597 1336452875 1 d none /usr/local/share/locale/el 0755 root root 1 d none /usr/local/share/locale/el/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/el/LC_MESSAGES/wget.mo 0644 root root 11102 2506 1336452875 1 d none /usr/local/share/locale/en_GB 0755 root root 1 d none /usr/local/share/locale/en_GB/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/en_GB/LC_MESSAGES/wget.mo 0644 root root 8744 59571 1336452875 1 d none /usr/local/share/locale/eo 0755 root root 1 d none /usr/local/share/locale/eo/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/eo/LC_MESSAGES/wget.mo 0644 root root 11168 31329 1336452875 1 d none /usr/local/share/locale/es 0755 root root 1 d none /usr/local/share/locale/es/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/es/LC_MESSAGES/wget.mo 0644 root root 47731 4930 1336452875 1 d none /usr/local/share/locale/et 0755 root root 1 d none /usr/local/share/locale/et/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/et/LC_MESSAGES/wget.mo 0644 root root 44968 37747 1336452875 1 d none /usr/local/share/locale/eu 0755 root root 1 d none /usr/local/share/locale/eu/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/eu/LC_MESSAGES/wget.mo 0644 root root 9309 53232 1336452875 1 d none /usr/local/share/locale/fi 0755 root root 1 d none /usr/local/share/locale/fi/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/fi/LC_MESSAGES/wget.mo 0644 root root 48248 30591 1336452875 1 d none /usr/local/share/locale/fr 0755 root root 1 d none /usr/local/share/locale/fr/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/fr/LC_MESSAGES/wget.mo 0644 root root 48149 763 1336452875 1 d none /usr/local/share/locale/ga 0755 root root 1 d none /usr/local/share/locale/ga/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/ga/LC_MESSAGES/wget.mo 0644 root root 33216 8758 1336452875 1 d none /usr/local/share/locale/gl 0755 root root 1 d none /usr/local/share/locale/gl/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/gl/LC_MESSAGES/wget.mo 0644 root root 9383 60009 1336452875 1 d none /usr/local/share/locale/he 0755 root root 1 d none /usr/local/share/locale/he/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/he/LC_MESSAGES/wget.mo 0644 root root 7351 22610 1336452875 1 d none /usr/local/share/locale/hr 0755 root root 1 d none /usr/local/share/locale/hr/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/hr/LC_MESSAGES/wget.mo 0644 root root 28606 53009 1336452875 1 d none /usr/local/share/locale/hu 0755 root root 1 d none /usr/local/share/locale/hu/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/hu/LC_MESSAGES/wget.mo 0644 root root 47871 49754 1336452875 1 d none /usr/local/share/locale/id 0755 root root 1 d none /usr/local/share/locale/id/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/id/LC_MESSAGES/wget.mo 0644 root root 43906 60492 1336452875 1 d none /usr/local/share/locale/it 0755 root root 1 d none /usr/local/share/locale/it/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/it/LC_MESSAGES/wget.mo 0644 root root 47946 40695 1336452876 1 d none /usr/local/share/locale/ja 0755 root root 1 d none /usr/local/share/locale/ja/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/ja/LC_MESSAGES/wget.mo 0644 root root 51822 59997 1336452876 1 d none /usr/local/share/locale/lt 0755 root root 1 d none /usr/local/share/locale/lt/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/lt/LC_MESSAGES/wget.mo 0644 root root 33620 24563 1336452876 1 d none /usr/local/share/locale/nb 0755 root root 1 d none /usr/local/share/locale/nb/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/nb/LC_MESSAGES/wget.mo 0644 root root 6658 52495 1336452876 1 d none /usr/local/share/locale/nl 0755 root root 1 d none /usr/local/share/locale/nl/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/nl/LC_MESSAGES/wget.mo 0644 root root 47520 12149 1336452876 1 d none /usr/local/share/locale/pl 0755 root root 1 d none /usr/local/share/locale/pl/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/pl/LC_MESSAGES/wget.mo 0644 root root 48317 8370 1336452876 1 d none /usr/local/share/locale/pt 0755 root root 1 d none /usr/local/share/locale/pt/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/pt/LC_MESSAGES/wget.mo 0644 root root 33511 20923 1336452876 1 d none /usr/local/share/locale/pt_BR 0755 root root 1 d none /usr/local/share/locale/pt_BR/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/pt_BR/LC_MESSAGES/wget.mo 0644 root root 48964 41779 1336452876 1 d none /usr/local/share/locale/ro 0755 root root 1 d none /usr/local/share/locale/ro/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/ro/LC_MESSAGES/wget.mo 0644 root root 9097 41840 1336452876 1 d none /usr/local/share/locale/ru 0755 root root 1 d none /usr/local/share/locale/ru/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/ru/LC_MESSAGES/wget.mo 0644 root root 47766 23336 1336452876 1 d none /usr/local/share/locale/sk 0755 root root 1 d none /usr/local/share/locale/sk/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/sk/LC_MESSAGES/wget.mo 0644 root root 47861 28136 1336452876 1 d none /usr/local/share/locale/sl 0755 root root 1 d none /usr/local/share/locale/sl/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/sl/LC_MESSAGES/wget.mo 0644 root root 46773 37049 1336452876 1 d none /usr/local/share/locale/sr 0755 root root 1 d none /usr/local/share/locale/sr/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/sr/LC_MESSAGES/wget.mo 0644 root root 11371 52090 1336452876 1 d none /usr/local/share/locale/sv 0755 root root 1 d none /usr/local/share/locale/sv/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/sv/LC_MESSAGES/wget.mo 0644 root root 46211 55825 1336452876 1 d none /usr/local/share/locale/tr 0755 root root 1 d none /usr/local/share/locale/tr/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/tr/LC_MESSAGES/wget.mo 0644 root root 30306 31794 1336452876 1 d none /usr/local/share/locale/uk 0755 root root 1 d none /usr/local/share/locale/uk/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/uk/LC_MESSAGES/wget.mo 0644 root root 9224 9009 1336452876 1 d none /usr/local/share/locale/vi 0755 root root 1 d none /usr/local/share/locale/vi/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/vi/LC_MESSAGES/wget.mo 0644 root root 50412 33132 1336452876 1 d none /usr/local/share/locale/zh_CN 0755 root root 1 d none /usr/local/share/locale/zh_CN/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/zh_CN/LC_MESSAGES/wget.mo 0644 root root 45384 56128 1336452876 1 d none /usr/local/share/locale/zh_TW 0755 root root 1 d none /usr/local/share/locale/zh_TW/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/zh_TW/LC_MESSAGES/wget.mo 0644 root root 28741 63593 1336452876 1 d none /usr/local/share/man 0755 root root 1 d none /usr/local/share/man/man1 0755 root root 1 f none /usr/local/share/man/man1/wget.1 0644 root root 86117 27919 1336452875 1 i checkinstall 790 2504 1336453734 1 i pkginfo 243 18106 1336453734 07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!0707010005a66d000081a40000000000000000000000014fa8aa66000000f3000000b500010002ffffffffffffffff0000000800000000pkginfoPKG=wget NAME=GNU wget 1.13.4 i86pc Solaris 10 VERSION=1.13.4 PSTAMP=8th May 2012 VENDOR=GNU EMAIL=http://www.gnu.org/software/wget/ DESC=GNU file retriever ARCH=i386 CATEGORY=utility CLASSES=none BASEDIR=/ ISTATES=S s 1 2 3 RSTATES=S s 1 2 3 0707010005a66c000081a40000000000000000000000014fa8aa66000022e7000000b500010002ffffffffffffffff0000000700000000pkgmap: 1 4914 1 d none /usr ? ? ? 1 d none /usr/local ? ? ? 1 d none /usr/local/bin 0755 root root 1 f none /usr/local/bin/wget 0755 root root 537244 43048 1336452875 1 d none /usr/local/etc 0755 root root 1 f none /usr/local/etc/wgetrc 0644 root root 4224 41984 1143435724 1 d none /usr/local/share 0755 root root 1 d none /usr/local/share/info 0755 root root 1 f none /usr/local/share/info/dir 0644 root root 8383 35189 1336452875 1 f none /usr/local/share/info/wget.info 0644 root root 200545 37896 1336452875 1 d none /usr/local/share/locale 0755 root root 1 d none /usr/local/share/locale/be 0755 root root 1 d none /usr/local/share/locale/be/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/be/LC_MESSAGES/wget.mo 0644 root root 29289 29147 1336452875 1 d none /usr/local/share/locale/bg 0755 root root 1 d none /usr/local/share/locale/bg/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/bg/LC_MESSAGES/wget.mo 0644 root root 10492 38084 1336452875 1 d none /usr/local/share/locale/ca 0755 root root 1 d none /usr/local/share/locale/ca/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/ca/LC_MESSAGES/wget.mo 0644 root root 49445 64800 1336452875 1 d none /usr/local/share/locale/cs 0755 root root 1 d none /usr/local/share/locale/cs/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/cs/LC_MESSAGES/wget.mo 0644 root root 49659 49285 1336452875 1 d none /usr/local/share/locale/da 0755 root root 1 d none /usr/local/share/locale/da/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/da/LC_MESSAGES/wget.mo 0644 root root 46126 30156 1336452875 1 d none /usr/local/share/locale/de 0755 root root 1 d none /usr/local/share/locale/de/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/de/LC_MESSAGES/wget.mo 0644 root root 50076 44597 1336452875 1 d none /usr/local/share/locale/el 0755 root root 1 d none /usr/local/share/locale/el/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/el/LC_MESSAGES/wget.mo 0644 root root 11102 2506 1336452875 1 d none /usr/local/share/locale/en_GB 0755 root root 1 d none /usr/local/share/locale/en_GB/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/en_GB/LC_MESSAGES/wget.mo 0644 root root 8744 59571 1336452875 1 d none /usr/local/share/locale/eo 0755 root root 1 d none /usr/local/share/locale/eo/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/eo/LC_MESSAGES/wget.mo 0644 root root 11168 31329 1336452875 1 d none /usr/local/share/locale/es 0755 root root 1 d none /usr/local/share/locale/es/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/es/LC_MESSAGES/wget.mo 0644 root root 47731 4930 1336452875 1 d none /usr/local/share/locale/et 0755 root root 1 d none /usr/local/share/locale/et/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/et/LC_MESSAGES/wget.mo 0644 root root 44968 37747 1336452875 1 d none /usr/local/share/locale/eu 0755 root root 1 d none /usr/local/share/locale/eu/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/eu/LC_MESSAGES/wget.mo 0644 root root 9309 53232 1336452875 1 d none /usr/local/share/locale/fi 0755 root root 1 d none /usr/local/share/locale/fi/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/fi/LC_MESSAGES/wget.mo 0644 root root 48248 30591 1336452875 1 d none /usr/local/share/locale/fr 0755 root root 1 d none /usr/local/share/locale/fr/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/fr/LC_MESSAGES/wget.mo 0644 root root 48149 763 1336452875 1 d none /usr/local/share/locale/ga 0755 root root 1 d none /usr/local/share/locale/ga/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/ga/LC_MESSAGES/wget.mo 0644 root root 33216 8758 1336452875 1 d none /usr/local/share/locale/gl 0755 root root 1 d none /usr/local/share/locale/gl/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/gl/LC_MESSAGES/wget.mo 0644 root root 9383 60009 1336452875 1 d none /usr/local/share/locale/he 0755 root root 1 d none /usr/local/share/locale/he/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/he/LC_MESSAGES/wget.mo 0644 root root 7351 22610 1336452875 1 d none /usr/local/share/locale/hr 0755 root root 1 d none /usr/local/share/locale/hr/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/hr/LC_MESSAGES/wget.mo 0644 root root 28606 53009 1336452875 1 d none /usr/local/share/locale/hu 0755 root root 1 d none /usr/local/share/locale/hu/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/hu/LC_MESSAGES/wget.mo 0644 root root 47871 49754 1336452875 1 d none /usr/local/share/locale/id 0755 root root 1 d none /usr/local/share/locale/id/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/id/LC_MESSAGES/wget.mo 0644 root root 43906 60492 1336452875 1 d none /usr/local/share/locale/it 0755 root root 1 d none /usr/local/share/locale/it/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/it/LC_MESSAGES/wget.mo 0644 root root 47946 40695 1336452876 1 d none /usr/local/share/locale/ja 0755 root root 1 d none /usr/local/share/locale/ja/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/ja/LC_MESSAGES/wget.mo 0644 root root 51822 59997 1336452876 1 d none /usr/local/share/locale/lt 0755 root root 1 d none /usr/local/share/locale/lt/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/lt/LC_MESSAGES/wget.mo 0644 root root 33620 24563 1336452876 1 d none /usr/local/share/locale/nb 0755 root root 1 d none /usr/local/share/locale/nb/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/nb/LC_MESSAGES/wget.mo 0644 root root 6658 52495 1336452876 1 d none /usr/local/share/locale/nl 0755 root root 1 d none /usr/local/share/locale/nl/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/nl/LC_MESSAGES/wget.mo 0644 root root 47520 12149 1336452876 1 d none /usr/local/share/locale/pl 0755 root root 1 d none /usr/local/share/locale/pl/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/pl/LC_MESSAGES/wget.mo 0644 root root 48317 8370 1336452876 1 d none /usr/local/share/locale/pt 0755 root root 1 d none /usr/local/share/locale/pt/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/pt/LC_MESSAGES/wget.mo 0644 root root 33511 20923 1336452876 1 d none /usr/local/share/locale/pt_BR 0755 root root 1 d none /usr/local/share/locale/pt_BR/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/pt_BR/LC_MESSAGES/wget.mo 0644 root root 48964 41779 1336452876 1 d none /usr/local/share/locale/ro 0755 root root 1 d none /usr/local/share/locale/ro/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/ro/LC_MESSAGES/wget.mo 0644 root root 9097 41840 1336452876 1 d none /usr/local/share/locale/ru 0755 root root 1 d none /usr/local/share/locale/ru/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/ru/LC_MESSAGES/wget.mo 0644 root root 47766 23336 1336452876 1 d none /usr/local/share/locale/sk 0755 root root 1 d none /usr/local/share/locale/sk/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/sk/LC_MESSAGES/wget.mo 0644 root root 47861 28136 1336452876 1 d none /usr/local/share/locale/sl 0755 root root 1 d none /usr/local/share/locale/sl/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/sl/LC_MESSAGES/wget.mo 0644 root root 46773 37049 1336452876 1 d none /usr/local/share/locale/sr 0755 root root 1 d none /usr/local/share/locale/sr/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/sr/LC_MESSAGES/wget.mo 0644 root root 11371 52090 1336452876 1 d none /usr/local/share/locale/sv 0755 root root 1 d none /usr/local/share/locale/sv/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/sv/LC_MESSAGES/wget.mo 0644 root root 46211 55825 1336452876 1 d none /usr/local/share/locale/tr 0755 root root 1 d none /usr/local/share/locale/tr/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/tr/LC_MESSAGES/wget.mo 0644 root root 30306 31794 1336452876 1 d none /usr/local/share/locale/uk 0755 root root 1 d none /usr/local/share/locale/uk/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/uk/LC_MESSAGES/wget.mo 0644 root root 9224 9009 1336452876 1 d none /usr/local/share/locale/vi 0755 root root 1 d none /usr/local/share/locale/vi/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/vi/LC_MESSAGES/wget.mo 0644 root root 50412 33132 1336452876 1 d none /usr/local/share/locale/zh_CN 0755 root root 1 d none /usr/local/share/locale/zh_CN/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/zh_CN/LC_MESSAGES/wget.mo 0644 root root 45384 56128 1336452876 1 d none /usr/local/share/locale/zh_TW 0755 root root 1 d none /usr/local/share/locale/zh_TW/LC_MESSAGES 0755 root root 1 f none /usr/local/share/locale/zh_TW/LC_MESSAGES/wget.mo 0644 root root 28741 63593 1336452876 1 d none /usr/local/share/man 0755 root root 1 d none /usr/local/share/man/man1 0755 root root 1 f none /usr/local/share/man/man1/wget.1 0644 root root 86117 27919 1336452875 1 i checkinstall 790 2504 1336453734 1 i pkginfo 243 18106 1336453734 0707010005a6f8000041ed0000000000000000000000024fa8aa6600000000000000b500010002ffffffffffffffff0000000800000000install0707010005a6f9000081ed0000000000000000000000014fa8aa6600000316000000b500010002ffffffffffffffff0000001500000000install/checkinstall#!/bin/sh # expected_bits="64" expected_release="5.10" expected_platform="i386" # release=`uname -r` platform=`uname -p` bits=`isainfo -b` # if [ ${platform} != ${expected_platform} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_platform} architecture\n" echo "\tAborting installation.\n\n\n" exit 1 fi if [ ${release} != ${expected_release} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_release} machine\n" echo "\tAborting installation.\n\n\n" exit 1 fi #if [ ${bits} != ${expected_bits} ]; then # echo "\n\n\n\tThis package must be installed on a ${expected_bits} bit machine\n" # echo "\tYour machine is running a ${bits} bit O.S. currently\n" # echo "\tAborting installation.\n\n\n" # exit 1 #fi exit 0 0707010005a66e000041ed0000000000000000000000034fa8aa6600000000000000b500010002ffffffffffffffff0000000500000000root0707010005a66f000041ed0000000000000000000000034fa8aa6600000000000000b500010002ffffffffffffffff0000000900000000root/usr0707010005a670000041ed0000000000000000000000054fa8aa6600000000000000b500010002ffffffffffffffff0000000f00000000root/usr/local0707010005a673000041ed0000000000000000000000024fa8aa6600000000000000b500010002ffffffffffffffff0000001300000000root/usr/local/etc0707010005a674000081a4000000000000000000000001442771cc00001080000000b500010002ffffffffffffffff0000001a00000000root/usr/local/etc/wgetrc### ### Sample Wget initialization file .wgetrc ### ## You can use this file to change the default behaviour of wget or to ## avoid having to type many many command-line options. This file does ## not contain a comprehensive list of commands -- look at the manual ## to find out what you can put into this file. ## ## Wget initialization file can reside in /usr/local/etc/wgetrc ## (global, for all users) or $HOME/.wgetrc (for a single user). ## ## To use the settings in this file, you will have to uncomment them, ## as well as change them, in most cases, as the values on the ## commented-out lines are the default values (e.g. "off"). ## ## Global settings (useful for setting up in /usr/local/etc/wgetrc). ## Think well before you change them, since they may reduce wget's ## functionality, and make it behave contrary to the documentation: ## # You can set retrieve quota for beginners by specifying a value # optionally followed by 'K' (kilobytes) or 'M' (megabytes). The # default quota is unlimited. #quota = inf # You can lower (or raise) the default number of retries when # downloading a file (default is 20). #tries = 20 # Lowering the maximum depth of the recursive retrieval is handy to # prevent newbies from going too "deep" when they unwittingly start # the recursive retrieval. The default is 5. #reclevel = 5 # By default Wget uses "passive FTP" transfer where the client # initiates the data connection to the server rather than the other # way around. That is required on systems behind NAT where the client # computer cannot be easily reached from the Internet. However, some # firewalls software explicitly supports active FTP and in fact has # problems supporting passive transfer. If you are in such # environment, use "passive_ftp = off" to revert to active FTP. #passive_ftp = off # The "wait" command below makes Wget wait between every connection. # If, instead, you want Wget to wait only between retries of failed # downloads, set waitretry to maximum number of seconds to wait (Wget # will use "linear backoff", waiting 1 second after the first failure # on a file, 2 seconds after the second failure, etc. up to this max). waitretry = 10 ## ## Local settings (for a user to set in his $HOME/.wgetrc). It is ## *highly* undesirable to put these settings in the global file, since ## they are potentially dangerous to "normal" users. ## ## Even when setting up your own ~/.wgetrc, you should know what you ## are doing before doing so. ## # Set this to on to use timestamping by default: #timestamping = off # It is a good idea to make Wget send your email address in a `From:' # header with your request (so that server administrators can contact # you in case of errors). Wget does *not* send `From:' by default. #header = From: Your Name # You can set up other headers, like Accept-Language. Accept-Language # is *not* sent by default. #header = Accept-Language: en # You can set the default proxies for Wget to use for http and ftp. # They will override the value in the environment. #http_proxy = http://proxy.yoyodyne.com:18023/ #ftp_proxy = http://proxy.yoyodyne.com:18023/ # If you do not want to use proxy at all, set this to off. #use_proxy = on # You can customize the retrieval outlook. Valid options are default, # binary, mega and micro. #dot_style = default # Setting this to off makes Wget not download /robots.txt. Be sure to # know *exactly* what /robots.txt is and how it is used before changing # the default! #robots = on # It can be useful to make Wget wait between connections. Set this to # the number of seconds you want Wget to wait. #wait = 0 # You can force creating directory structure, even if a single is being # retrieved, by setting this to on. #dirstruct = off # You can turn on recursive retrieving by default (don't do this if # you are not sure you know what it means) by setting this to on. #recursive = off # To always back up file X as X.orig before converting its links (due # to -k / --convert-links / convert_links = on having been specified), # set this variable to on: #backup_converted = off # To have Wget follow FTP links from HTML files by default, set this # to on: #follow_ftp = off 0707010005a671000041ed0000000000000000000000024fa8aa6600000000000000b500010002ffffffffffffffff0000001300000000root/usr/local/bin0707010005a672000081ed0000000000000000000000014fa8a70b0008329c000000b500010002ffffffffffffffff0000001800000000root/usr/local/bin/wgetELF0l4.4 (44o//// 6؋33 /usr/lib/ld.so.1_[  "#$&'()+.024589:;<=ACDGHIKLNPRSTWXYZ\^`abcefhjklmoprsvwz|}~    !"#$%&()*+-/023469;<>@BCEGHIJKLMOPQRUVWZ]^_acdfhjkmopquvwxyz{|   "#$%&(*+,.02456789:;<=>@BDEFHIJLMNRTUVWY !%*,-/1367>?@BEFJMOQUV[]_dginqtuxy{  ',.1578:=?ADFNSTXY[\`begilnrst}~   !')-/13?ACGKOPQSXZa+ ( P +`4 =\ G/ ],. jЖ0 vjeckpj PkfxC  (F  tF g$i=J LD  b rdzI KD j jX9  | 84  T h4  "5 0xX 94J5 Q$+ [PabeiK }D e'` 0be< _k@f]c \c c@N k*& ;ȌZ E( a\e p}2 _E 0 A XA __< Q t pq a $<| 7@g@tNw FJ UhbK% ocy4^  s3 hHb ܔ? _0 P! *) ^ l{  j4,F G8 N  \Pgdfqlzphbs T   J < eipgps~ fhz Pd *H7 2u ? aD0F SK& [XX k{|  E ظ D I paI (8 iD  xr |L   % - $ ; D)V T@c\`cL n  ~`c@eP  @ f N  j z x^   +  - ' pc0 , D eK `W I+ h ; w  Ȅ ?b  Pj /   0e h8      T^# , E ; `jC `S  X `_ ki  z s h @k ( 2 M ,u 4+ k l  df  dm  h& b. TC" = 7N N p _ i xV v e} i j d Ph ȍ 8 b k=T cS  !H! lgI -0k6,,) Ahf LI@ Y<* i x)  B" d3 ~5   l"hTK  !* +bLK 3hQ* Z4  d_pLC i$u vU D* @dpdPbG $LJ b@ g,_ ^# < pf t- $`e;' J? Xd ^K mgyif7 MR a4 x<4 8 b d& h bih; D@bLv ^ gdam. |_ 0iF ( J `Tw  i0jN[ 0cI, #f 1H8; E  !LhYf_J wH  cG.   h`d+ H cPe L" `i`h, @4 F| NjV gbn  84 !w} LV t  l Lx @` d g0 a= 0 pt d"Ps /\ ;e N| dP&s p ypii`g T4 $M# @(x `, 4 k lJ ] .( 7c@jT8- ct x+ 4$ i+& He X 0 F @j    != 0peChI R`gZLf oi}ap  h.>   bq J ľ dgHM >d `aTc@i d pa{ $FM )e2F d`  D XH7 i  |܀ +N t @ e\   U `f cH; @aP` cT2 `S &``1TR[  bDaK $^} fdz7 t,  \  49b WO 7 # ^   T 0d`7 L .0a5 * H `W4 l w gT j+ c8J `b`ddD  K \`(  #0K 9I PcB  Pp  \TX geoN }|| iĪ j =z hH L `LI |  8F d  `v /0 @  K0`T bD lX, vQ J tcP  0f0hpk f|X Lw9 p@ hM/ 'P+ 1 8`K  Qlf ^ggt vLQ g @h `k0 j J | hC  *K \ b:fI`YL  kd_pe}pq Q t75 pf6 eQU+kdW+_tU+iҐ+3ҋFi~k<Nj>8k eF iQ _^[USV] u6jjuRuf EPJfFCFQuPj juuf EPfFCKFN C KFNCF^[^[USUu1E t JH]tc BPLuM] t$BJ CKBJC KBC]t BPu[Ã[MUEu u #US=f t*=f tjhf uef f j5 +؅tnjSP f f HP f f H@ f f  S_ jhf uf ; h k5 P5< Sjf 3[US]ss3-C [ÐUSE]EE EEEShpE$Ru { u8u C [ÐUSVWu}tk u/SWu! hl _u SPj, 6ŏh 2u SWPj辊 u uPZ jjP6؅Y= t4Dž jPj'j)S = tA p t  tC }8сH#+ȉ jPhhS = t= Pt' P PQSy|m PP $PQS |<>t h( Pj`= t@Sh -8 S 8>u>8Á_^[ 0PhL 芉 h 9O 0 PSj赈USVW$ju=؅E E܍E0EPEPSE8E;8}3WS VuP}DWSGE;8|̓ St8 SAjV؅u, SSG S 4 hܣ .uqP5< Sj談ƃ_^[ÐUSVWjj}7؅} P jPjhShjPR u 6WPP PQS= tSh w>uy PPQSt|hVjP= t% E0 M 1Ph jS/}7 S $ S  S Á_^[USDžP D@t#jP $ut>~EPQu؀= t#Shx  Á[US$hjPYEt'PQu PQu] u6@C= t SPhX CUufHP KSHPK S@C= t SrPhX 3$[wFm㐐USUJw`uAt<= ȁ؁ ؁ #3[ÐUSVWhjhSUʃ hEȃ3t3ɅtE <$$ fD$l$T$,$D$`PۅP 8eݝP݅P<$$ fD$l$\$,$D$dZ\ `Pj\VS } 78tԋǁĬ_^[ÐUSVhjxPUʃ xpDžpt PjxjPBPH Đ^[ÐUSVWEE} ]SWuu o8tߋƃ_^[USVWEE} ]SWuu /8tߋƃ_^[UME EE] MUSVWEE} ]jSWuu 8tƃ_^[ÐUS]S= tShh 貁[ÐUSV]}hh4 hH I j(E EF=f ujjjf VS5f f ^[Uu5f  @ÐUSEK]E EԋEEEuE0V5f ؅?= tSVh {}ujjSVESVEЋ]ЅCECt Cjh j0 ű658 [t4C W6C= tHW6h {3EuCC t6h z Vu[4uVE uJ= tVh zEE@E;Ere_^[ÐUSV3E؃EPj5  EPj50 S]蛃 ht E$mPuVjVySi ^[ÐUSVWHh`  uPj#yM 3tyt@IuR u8EE0j = ttPE0_ E0/}#8dh E0E] HEE`EẺuЉ}ECE܋C<; s{u'= P0h̥ xuԋEЋ+QjP}ЅUsuCPVEċK u<t s uusW E*uusW,EPusWEЀ= t űE0V0h w VuEE P7 C u7t s VusWB E*VusWuEuusWBEЀ= tűE0uhd w VEuh` usWEЋ[EHE؉EċuЋ}-E؉EċuЋ}Ԁ= t h vEH+;}W+QjV Wue7uuhX ju$ hܤ 3ɉE M<_^[s<_^[7 h@  0PE0SjGuEE<_^[6 h$ ؍E0ʯ 0PVSjtEE<_^[|6 h@ 7M 0PE0SjtUSVW]u 3;utN;uuE ‰EE 3ۅt P*G+3VhP D>P=f u jEf 35f 5u%V3u35f 5e_^[à h(  0,PV3WjYr UuuGEE USVWu] "t'"Eu FEuEPuuEP}WSVtE0E+PjQW<}tGE0u] uǃ_^[ÐUSV]PS9;u D0+uSh VcVuu ue^[ÐUSVWUM ;s6u]3:#uu&u3B;r  3U_^[ÐUS h ]u 3`D@+ԋʅtd<#u%A2A3H<%u%A2A54<;u%A3AB t<"t < u CAuу AP貸υƀ u&A#A3A2A;q"u&AqAuAoAtA;P&u&AaAmApA;3u&&q8Ehpj Pu33EԅEԍHM̋}}3|vEԃE؉uЉ]܋7 v蟻v蒻ÉEw v|voËM܋U\ ؉]܃uЃu;u~;u7E p5E Ep!E\ F;u~ɋEԍDCE܃ P臥EE3]3 vܺ]؃ vɺ}SvEEP辺]ԋE=WvDP蠺D;EԋM;M}M;D Eԋ] }G;}pEԋ]EE܃ Pʤ3@;Eth+hx hD 趹3ۋÍe_^[ÐUSVW E EM+Pj:3QtL~;}s9 FP觃t,k \G;}s P脃uE033ۋÃ_^[USVWdh@ u >؅ jf  SBEE؉]Eޅt+ P蕃tCt PzuP#G] t Ct uE܉9]$;{C}  tG u9}_G] tC u9]CEKEą tE@E uE9E|HMM@EEE̋E[ tE@ED uE9E3E@EЋE@EEЉEԋE tE@E uE9EE@E PqEЍHMU;v8 uE;vEHx uMEuuMAuuvMASuaMAMċE+t3jh QUJ  B E+tjh P軷UJ  B EP0ujtMAE8.u@EE0uMf @eMEQh u贶ED@f v؃ uC<$$ fD$l$\$,$D$MAI uu V?uG]]\_^[U\_^[à h ؍E 01 0-PVSj\PkUSVW,= tu h P j襵f h u 蝴Vh 5f  Phħ VŵVh ǴEPE0nEP肛E؋MԋXC u =  S{ C uVj.QVuBCtPh Vu  u   ssC$PsQh Vʴ$Vu"[3 EP苚 V说u1 V?|a= t h< O,_^[à hl 躱u ñ 0PWSj(N돃 hT zu 轈胱 0蹲PVSjM\ h 7؍E 0x> 0tPVSjM0USVW$EPE0=]SQM؅t:s Qӱt~ Vu S uƃ ]38S菱,_^[USVW u(tEHM@(u@j VPڋtq P{tH@t P{ut3 P"|bfjht 6譱J33 3333ۋNjӃ _^[USVWj] u uV;u-= uhd jIuWV]cup= uhT jIuWVe$u.= uhD jIE03V_ _^[詮U蟮USV$juV]Su,= uh4 jIu SW`ul= uh$ jHu S[ u,= uh jHE 0SY ^[ۭ\ѭ萐USVW(h ٭u] SVK PWjWJÃ|SVY Ph j-JEU3;}v+ځÃ}* hܴ bSVK PWjI; h 8SV\KESVPuWjI}tĴ  hȴ E E_^[sGUSVW] s3EE9Cuhh h 螭ƃEu$u>h h h< r"th h ht NEMUJ}G(EG,EjEPEPw\mEu u Mu E0 Eu u Mu E( E[ (C t:Ht@ pjwh$ E0pEtGO UUQPCE}Tu CEC h xE0j PxjG= thĴ jrEE0uu|QE{ t u蹫E u-=  hP 脪PjEp uHhĴ jDh\ PPjDu~CE  uHhĴ jDhp PjDu1CE VuAhĴ j_DhԳ 趩PjGDuCuAhĴ jDh pPjDuC4hĴ jCh &PjCuTC= uh@ jESu_eE t~uFhĴ jTChԳ 諨PjPj@ulE @=  h4 Pj@h{ t u 0?u E3E'{ t u触ECE_ ;l= t ht B/M 9tG Pltptlt {:GG wB~W|/uH~| /t Mq ttJpD+ĉlRM xqPtl/SpQӥ= t hH vA= uxxusl8/nlSxph 3AE xuVE@* h 螡Pj/< h 聡Pj<E#E E= t,= u#Ep$j+ Phl j=EPEp$u+`E u ERt hĴ jv;hԳ ͠Pj^;uE @$= uBM Au h 腠( Ep0> PSj<3MU;}3M3U ƃ EE>= EȍMQPupE uDhĴ j}:hԳ ԟPje:uE @+#u,hĴ j4:h 苟Pj:~$u,hĴ j:h( ZPj9M4hĴ j9h %Pj9uSE @|} u= t" EP蒌 M1Ph  <jEȍM1P؅E=  h 苞Pj9]SuEE 3 u\hĴ j8h -Pj8u[M A jC39l Eu\hĴ ji8hԳ PjQ8uM A jֽ3̽ 4 hĴ j8h [Pj7u艽M A jq3g = Eu h Pj7EEM| u;Ex=ij  = = Eg= uQP: Ph| j9|uuuVE Eu[hĴ j6hԳ Pj6uDE @ S.u#V u$ hT śPjV6Ed4 hĴ j26h 艛Pj6u跻E @ S衻u薻 }t$= u h .Pj5=ij T = t>= u5hĴ j5Ep$jτ Ph jc7}w$uUE uQhĴ j,5h 胚w$q PVj7S襺u蚺 u[hĴ j4hԳ -Pj4u[E @ SEu:m 4O hĴ jr4h əPjZ4uE @ Suֹ = u h tPj4}u h@ EU}u}w=ij e= uh j3} wjuTE uShĴ js3hԯ ʘhЯ  p PVjK5Su߸uXhĴ j3hԳ rPj3u蠸G S荸u肸4hĴ j2h Pj2u?G S,u!T= u h 迗PjP2}u h@ *EU}tu } tY| EtNMEx t>+E|W_33x u!= t h g4E0x}u u諭؅ EtE @a E Ep= t Ep| EtE@= u*= u!= u= u= u}$~@= t Epch EpeEjEpbE'8| hx  MqPj|2uE@ SuE$h pŖE} uHEM u"3ҋ| Et }t3EEd j|uQPP  j|uWV6 u}3ҋ| Et }t3EEċE} u33 +u|RE PuEP|uWVuS贠$jȖP7Eu F $uuE F   u裴= t Ft u菕Tt Se]SuV8 682 Ptu uF= F vyh vɔ؅ StljV试;v$H t uH;vH t tVj1} Ph( j/V0Ssu SUE'u Puuh$ jt/uuh$ jZ/ h0 詒S莲PuuWj(/ = thĴ j - S該]Su6 uR82t3 PN h .Pj,E PE{ h Pj,uFEBE'6uVu u M ItaM9w$p詑t @$u:hĴ j+h@ Iw$h PVj-;hĴ j+h, Ep$Oh PVj- u)E @ SuE'7 hH 諐Pj<+uٰE @E'Ee_^[QkG=3:)}E,D0 u[E @ h ؍EP}VDPE0WSjn,VAu E5E)腏{Lqg Ep蔐!脏 0躐PEph, j+u}E@ Sgu\E7$ 0ZPvh, j+ hP Ҏ 0PvWjK+uF SծE蝎 0ӏPEph, j*u薮E@ S耮uuE= 0s Ph j*EshĴ j(h ؍ 0$ PSjT*j%hĴ j3(词 0 Ph j*u训M A j薭3茭USVW3PT9E u E@t؀= t|= us+juXMA uQ؀= tF Pt6 hĮ 蹌؋Epc PSj9) uvtFLH3G Wج]u2{t CC CCuC(C {tC Cu}= t+XVH蛎uF%=t5Dž8Dž@BP8T@(F48F8@Dž8Dž@ jnP= ju0؃h P臌~! h  WPP行 H bPPSVh jS'S0踋E 4t 8tH@ 33WS@8PRPQu E{t #7$5 WyuaCt P)jE0kHC14tPI3B3J t[5 W a;YCtt PܩC)_8DH< j}PH3=ij u0C $PI+D@QPuVjպt s3C=ij t(= u = C t.8-u)xu# hl 蓈4L 8( hP p4 V_8Pp0r&P8WH4j$ = uW= uNjE0Pp0& LucK]t VsƁ_^[Ć 0 PhЭ j&#랐USVW] CE#CCjuhĭ WWk= t% h BV\PWi" VYrC V"jSjE0؍E 0v&rvEFuvW`M= t #E W貅fÃ_^[à W訅u/ h tE W[ Puj m 0装 PhЭ j 냐USVW\u Dž4 @4  tG;~C= t% hh  5 54 P ! 4 Dž Xuhh h\ 蕄]ȃ t CC CCC{|Cx  | Cx  | DžV} t ; (C w$*pFvWĹjW-CDžDž= 6>-QPY@ Ct tF3V 3 9N~>t> h  sXY Pju@ h ށ PjL? h 螁 sX PjDžu%jSVWuL=  h " 0YX PjP= t%yjSVWaF~XPst< 0فp  @+̉PQs+;Pv蚂 h`  s>W v*WPj_Dž\ h Pj8?u: h  0V PjsP蚣t\>uWNu3= u= OPhԫ 4QP= tU>u = tGF~t>tX st00m)~u# h ]~ 1Pj sLCW#3t9t4t/cx  | v$ 4 Dž3n= t_ t894 |0= tD h } 5 54 Puu 4 u e_^[à hD @} s|T vhTPjs~svu"| 01~ Ph4 j]hĴ jKOUSVWu x  | ]EE3 t ; QȋY^>J s }E v}MD~+C Et!/uxtvuht W}vuh| W}= t- h< = tWvuh  WtXE s hu܋WS7 juSVSVuc|x  | 9 hЪ 5{E WvR Pujx  | v$ t ; }3u e_^[ÐUE8/uh$ P}USVWE HuVPu؃r=ȳ u =̳ tf6t`>t ~vtv$= h .zE 7nQ PujEPVuut[ ~vuv$= h yE 7 Q PujJEPVauuF$8u} Etw:Et} =س u@` b]t-sv$׃u[$EPS؅uӃ}E jPju=س u@cutEjFEvEEp$׃tv$EPVGu}tu uu;, h SxEp$O PVj uIx  |  t ; }3Ã_^[à h w؋E0jaw 0$yPVEp$SjMu-뚐USVW3u>j$j(S2w0(<Dž@EH}G$8u }}t'j/wHyuG Pu/}u"= u(u PjW#3P(PE0 $P(PWt = =ij  t Pc9(@t PacjE0s$0E0R = = t1 h< uL PWj:XWQxtDžDžG4G8 h\ Eu ~LHPW j v$0! u$0t $00t P˔@t Pu@Ct P`uǁ_^[USVW }_ w$ w3uGt P u Wut^ ts$E 0ƃ _^[ÐUSVut6ދs$ stCt Pt Stuʉu^[USVW =4 t  f 4 =4 u4 =4 u 4  =4 u 4 ( 4 t 4 <u*h@54 s  4 4   f 54 4    t f 5f f~ ?He;t0Pt =| f~ ?He;uF=z f f   +ã f  4  ,$ f +4 4  y,u7I f  4 4  4 @,4  4  OAf 94 vzeu- 4 f 4 Hy,I4  4 @f 4  4  = =4  P uI f f f  f f = =4 }54  54 F54  f 54 j5 Rq f 3]UKA7-#|ung` Y R K D =6/(!  _^[à h   f }vlbXND:0&rUSVW 4 4  q f D94 y(=4 += GEW|j+Ë3ȋE;|T3Ʌ}3|, D DD DD D;~;  A;~4  4  U3ɋE}3|, D DD DD D;~;  A;~4  4  y,A U+HBU=4 u3ɍqQ4 +ڃyt2y I  ~ PR u h Y ã4 4  4  A +EtЁ H# y3vy 54 |o4  4  t>} I9F;s; 54 >o4  4  u‹EƋ I F5f jh V[tVh̸ jh j] ƍe^[ÐUSVWu}W]Sl 82 PZu ht pWMZhjPWSw  WY}WS 2a3E3 4`5 Y SE04`5 _ZtGrlEte 3P#tk |8C Pm#u; uVCSW E0Y uXVh SS0YhjPS}Wsv |O SX]SW 82t PX p PX ] SlX4J QYX 7 QFX $ W3X4 P Xu_^[ÐUSVu>thh4 h@ W]shh4 h W E QPFPFPFPFPh Su#Z0ED^[USVW`j]SuVm;thh4 h 5W3E}EWP!k] } EjPE7PEPh ]W:WhjPWVt |f WV}WV u782t PV3u D PV 1 3u" WbV3u4ƃ\_^[ÐUSVu]TshJh4 h Vu8E QPjFPFPFPFPjjhк SuhX0wuvE QPjFPFPFPFPFPFPF PF PF PF PF PFPFPFPFPFPjjh SuW`^[^[ TUSVWjhSuV^k)tthsh4 h\ T3``hWPh] } EjUPh7P}EPhT WThjPWV3r |i W{TdWV u782t PQT3{s D P4T 1 3Ts" WT382t PG$ PG  SG4^[ÐUSVu h SGhjPSuVe |f S_G]SV uY5t+2t P2G7 PG $ P G SF4^[ÐUSVuu PhP /S GhjPSuVOd |K SF]SV u>83t PrF$ P_F  SLF4^[ÐUSVu hH SlFhjPSuVc |f SE]SV uY5t+1t PE7 PE $ PE SE4^[ÐUSVW,   ME3}u\M M؋}Eԃu3VE $PVWb |r V EEPW3 u*E܋5t 1t- PDE@Eԃo$ PD VD4ƃ,_^[USVjh8 SDhjPSuVa M S@D]SVg <85 h PFh jFh VDh0 VDh$ VDt`h VDtKh VDt+h VsDt E >E 3E (E 3M E  E  3C $ PC SB4^[USVW$jh 7SChjPSuVW`  SB]SV 85t]h P Eh jDt7u t PCB W_. 3(B % 3B SB4_^[ÐUSVu h CS BhjPSuVc_  SA]SV 85t_@3ɉj jPCuVl@8u 3MA _ 39A3F D PA3MA '3ɋU J S@3ɋEH4^[ÐUEt2jh PAuE@t P IUSu@ EAxt s9rywBAxt syrywAxt syrywC3[ÐUS] S@t9| u Ht%| uH t u C u33][ÐUSVWh uk?؅ 3S E EDžLPT W=Xjhx W?4 ht WoA؅  M3҉M -u*M hh  zdu&Mth h\  Olu&Mt= hP _ $Mt hD 9 }tSM uU#uUUtAQh, . CPM= tPh ht 3Dž\Dž`Hj?؅DždDžhDžlDžpDž@Dž<(Htx|Ntk DžxDžlDžpPDžh Pt*xk |8C Pu≽x;:DžhC xhDžxPFt*pk |8C P"u≽p;:Dž`uHC Pt4lk |8C Pu≽lDž`xu1= lphh = Ph dKuЉdk d= dh DžHH45 S9H@H45 S9tgH@H45 S9tCH@H45 So9tH@H ] |9t"9j jt;Ѹ3 u 88"t E0x 3MA= uH\REp0Ph H\= t45 h ht tj;؅Kx|Dž@Dž<1x| SL9+X;} E8ush S:USVW]s{ u ;r34[uߋƃ_^[ÐUu u8t@3ÐUSVW]s{ u ;r34[t5TUU :MPWӃu;utuutMtEtN3_^[ÐUSVW]s{ u ;r34[t5TUU :MPWӃu;utuu_^[ÐUSVW,MEQU؋A ‰UQPE܋]C EE < ]EЛ<$ $ fL$l$\$,$L$K4 V VhW{M؋ًE;sVHEE܍t3t: PUM;r3 ǃuߋE@@MAE EF_^[ÐUSVW]s{ u ;r34[t5TUU :MPWӃu;utuuEP x}܋H\;t~?tbUM7 VU;Er 3ҋM‹U܍ ƒu(A9Fu A9FuA 9F uA9FuA9Ft B;|3^[򐐐US]C9E thh h C@C;|C[UE@ UE@ USVWU3Jtu@RuEjj*؋EkP=CECKUBtu>B@A*rF~ AyF~A yFARu+K*+;Uthh h 3ۋÃ_^[UE8ЋE 8ȋ+ÐUE8ЋE 8ȋ+ÐUS]s^][NUS]CHC= uB3PSjhx J{)= tSjh\ (][|[ÐUS]s ss3 C[ÐUS$E]؉E؋E E܋EEEESh9us"{;u]{tH>E9lCE;tX9u CPM@M{t<9us"{;u]{t<EqCE;tf9u CPMMuk{uu`{ouU{tuJ"9us4{;u.]&{uu'{ou{tu"Eǃ_^[ÐUSVW,u ]E@MEuuE;sX PtF;s@ Pu CPtK;v CPuE@E+ΉMȋUR;};|;tYEEЀx u1 WqE؃Mq1PM؋EЉ@ W0fMЉEЉx@uVMPUBE܉BHR;};|;t\EEЀx u1 WE܃Mq1PNM܋EЉ@ W0MЉEЉx@HUJ  uE+։UЋ}};};|;}t_EEЀx u4 WGEԃMq1PMUԋEЉ@ W09MUЉEЉx@U‹;}uS&t EAG.SEP t EGU A G;rE@c&t t t EAG6AE.SEPt EGU A G;rE@‹+;M~hh< hL $E+‹UBHR;};|;t\EEЀx u1 WE܃Mq1P@M܋EЉ@ W0MЉEЉx@HUJ Et,EM<t PGu]u ,_^[ÐUSVWEE܋} ; uFuE;u $a-uF-thh< h F -u qFh-uFUK-thh< h lF:]thh< h ?F:]t F 't+"t&hh< h E܉EEEF]ع À-t(E߃^sEăv /tFmf_À>w$$bH߃^săv /t4- &3"F!t Ftu܋E܃_^[Ðaaata=a`k`S`&` ````aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaUEU ;si-u6x-t;sF-t>u-x-u'.@;t3-t>t#>u x-ux-t;r@3 @ 3@3ÐUS}tB]M +ٍC+ĉESQPEPE0oe[ÐUSVWl]M 4 3Dž ƅEDžFDž+Pjt@<_5PPtH@u/t)jPDž DžDžDž P%tC; P u/C<>H߃^sHăv/t C;U݉9; PtC;( PuH߃^s Hăq/h<_>V=C; P-tC; Pu"tw'tr Pu6t)C;i Pu u׋ˋ;3K;  Ћ;t93Ʉt<<<>< t C; ;uɍCˋ;t*#u LT@;};|9us kPkQPyDž9kPD jPD PD+ȋL C;B PtC;& Put CCut ;uAEȋE̋EЍH}33Ƀ3ɋZZZZ(ZZ,ZZ@Z0ZDZ4ZXZHZ\ZL`;~;GBBBA;~鋝EԋE؋E3EE䃽tRt1HtU M䋕PPP)EuPU;<;s ;t 3CCCCt JQPl_^[USVW j(g 6 3ɋVvPs^ Sv5(g [ Sv5(g C(g s ~΃QqP!(g  t! tQP(g  u= t` j t.P5(g gtP3Vu҃ 5(g 5(g  j ,g hD 55 P_ hD 55 5,g F hD 55 5,g - hD 55 5,g  hD 55 5,g  hD 55 5,g  hD 55 5,g ,g 5 3һD S6P Sv 5,g  Sv5,g  Sv$5,g o,g 0~hD 6PL _^[ÐUSVWu~~HE EEE33ۃuF 48t C;^|EtkF D3_^[USVW(uE]sus+E0V1= t\s jjE܃VjEE0j WjjXPVuuh ߋ jjjWLtn W= t 6Phx 蚋j j0M HMH}M 9/H= tWs h ? W3= tE0s h  }jjjE0j= t 6Phx j j=0M HMHHst23ɅtU ;V~^΋t;SptAWMAOCJ= tE0s h @3% h M1s Pjy3_^[USV]ShH ut?EP k] L+3D  't"uF~PVS^[ÐUSVW,5 3ɋ]9tNB q9Z tE34c3+ 5` At>333 ^[ÐUS]C t PC$t PC(t PCt PCHt PCPt PC0t P3C C$C([USh ku讝 PSjb]  u!t [ÐUSVWLƅE= À= LjƅEDžxu+x"3M AAA A3AA A$A(A0Pt = u= , t Etxt 0_ PWVjpDh` Vt*jhx h V]jhd hp VHH@ t,PQbPhP ojPh\ V  ttDj5 hD V,h( 50F h4 jPhD Vjh( h VE8G( G,$j$P Pw u u  $u u $Dž t0t,(t  tVR 0w w9G ǃj:wuσw wǍH48 jPh V ÉuLt,jh h Vajh h VL,jh h V5jh h V= u!= DžDžjh h V t PDž) 5  j`PjPhl V^ Dž=ش u A yPqq q5Dg  jPhd V t$t3PV 8u3tj 8 t < u H(@,ttPQd1xu u;jWhP VBtDžxuPyPq Aq=u8Dž ` l  h( 5d j5h Pj|\= tSh ]=m Džth VWp po؃4x#p ph   PhP ( t8tIjPhD 1h( 50F h4  jPhD UtjWhP ;SE SuE (8 = th e[ <(QP; (0A0 Lʾ5 (t P覾xu; SztpSvQDžSV t>= tPh` GZ @ $PS ' t& tQRPSt0   h8 蓼 WPj#Y Svu= tWh Y Wf(QP_`Hds== t h *Y WSg (0רA0= u9(tPjk PhH jW%h jWh 7= DžDžhXPhl 3ɉj jXP舽Љ3 t|v 迺8"tjuO tEhXPh t"h XPN!hXPh Dž t"h@ XP =ش =Dg uhht h 贺 0P,Pjhx  ,0+P+ԉPQR襺 Qpp p5Dg 80P,PGWhx ) kuWPSp pYu! PSu)=| t;` u? Slm 8 8~$8o 8P4Pjhd  84QP/uN 8P4PGWhd  84u48+P+ԉPQRqNtJjh< 踸u. @P莂&x QVQWP$0 0. jPh V jh4 u& @Pupxtdx(ubjh< ϷuF @P襁u xu p Dž W虶(t P聶 b VAh 4؋0rP5< SjQm jPWh$ jsQh ʴh 軴Pj訞PWSj9Q蟵 P艵(tPjWt  hx F VPjPt P8 h S PVjP=| t;` u S0=| t;` u S4 hD 苳PjN h pPjNV\(t PV 72tm ] {H3<= tpXhPh ^tM|uh A] C h %C$XhPh 3DžtbPPHPX@QP?3t8@8@HI+Njʃ 8dsE7$=,tC u h $C  PP{ t ht p  h خSWPjgKt/u& P?u.=| t` 9u t Ve T3t  8 Et hd j Phd Vt+ hL G PhL VȯtE E h@  Ph@ V藯uE@ EE = t9Mu@t&Qh0 SM'Qh8 S9'== u=| t;` u` S V==| t;` u& SS V4c S46P S!= V* jFh 詢Pj:?5e_^[à h| 聢5 y胢 0蹣PSj>DžDž3 sH@0 0fPsHh0 j>=| t` 9u   Ģ7¡ 0PsHh0 j!>=| t` 9us  V V0H 0薹u wmUSVW,]t!;t hF ht hH ѡt& t8-u xu3 Pߍ3ۋEش t t3 Ept h [Pj:j`jVE< t PTFH1 3uw tEE jPMFH vHt9 t)= uuvH!r E=ij  tEE jP t# VZu  t V7DžDžDž33F VtjPq=ij tu h 躞PjK;= t{juv؃SWh j;9 h f VPXPXSPWh j: S;ttE E= t4t+XW@詠uG%=t/3 F ,G4O8BJ E t= tM!M Vu$PuPuj?Pt P2M8w$85 V-誜E= ux$u$x$tP p$ u h FPj6  h Pj6= PH 83@3 txu} usDžpHWtEt)@$t8t P t79@<$p8p4肮 G< OW_ 33 ~ҋЋ t} h 訚p08p p8 qPWj65 V舺 h +p0F8qPWj65 V.<֋ i;‹Ӌ|3B3J 2 h 莙p07PWj55 V蚹= xPx$9A\|hpP Ћ AT3ƋIX3  h( ˜pXpT6 PVj<5% h 莘Pj3Džh j3@M=ij t:=  h %Pj2 Dž3^3ۃ= u,jE0 Sh@ jp4@,  ;)e[E8O hH ` q,Pj3"!h j1ht #؍pH`n& 0\PVSj3 h ږPjk3h jT1h 論؍pHm讖 0PVSj3QG t$8-uxu hD ,$  h( sHVm؃p04PSVjk2s33 sHPE0h j82 <8   S8C4ʣ   usHj*sHj t(8-u#xu h  & h  sH!ls32؍p p2 PSVj 1s32s s2sHPE0hl j0 <8   S8C4ʣ   usHjsHj h\ Ɠ؍pPk PSjC0| hl 臓Pj0Lu h VPj/ h 9Pj/C0tPj}  h Vs,M 1Pj/ =ij tIE$x u>ujE0؃ Szh 蕒Pj&/@ h xp(j[|Pp,Vj. h j,"t S1u]t @< P<_^[辑7A**)AA*AAAAAAAAAAAAAAI*IAA**AAAAAAF*AAA*AAAAA*US]tn P\tC P\ut9Gt!+t-u CP[{Mt3{T 3][ÐUSVWDjj3؅t3 S衑@=r ƅPSP茑ƅhp ju}3ۃj$jV詏 V47 WPu Cr̻ V؀tPjsÁ<_^[ÐUSVWuϐu \C+u uhh VKVUUU+э+WSV1 jWh` ye_^[ÐUMU L L ABL ABL ABL ABL ABL ABL ABL ABL A BL A BL A BL A BL A BL ABL ABL ABL AB L AB L AB L AB L AB L AB L AB L AB L AB L AB L ABL ABL ABL ABL AA USVWl3Hg Lg Pg EEj,QSP访s+338  3;uV30ǎtGr̍%v6 8 j,VSEP#uPg t1=Hg t} tut]tMuE PLg t PHg t Pˌ3Ɓl_^[à PXW QPE 0jZ Pjh0 TZ5Pg 貌 QP5Pg 0Z Pjh0 ZV} QPE0YHPQXHXPQP=W QPE0Y Pjh0 YS QPE0jYHPQWHMPQUPV PXj PY Pjh0 Y5Hg b QP5Hg X Pjh0 X PEj PXHPQVHMPQLg t P3 E 0ˊE 0輊 5Pg 襊 5Hg 莊؍E0ϋʍ1Pt EPE05Hg 5Pg E 0h V葊 =Lg  Vh S蔌5Lg S腌h SwUS] E;+؃s2jh4 P7jh< Pu" E@PSuur9jh E0̉utP E@PSu7jh4 E0蓉u# E@PjS 3[ÐUSV ]PSBuEE MM E^[Du)EE MUuuUME ]^[NuASp S4Gu E3E MUUME ]^[M^[蝆U=Dg u 蜺Dg =ܴ t'=} u5ܴ 5Dg U} ÐUDg t5 PÐUd t P@Dg t PÐUSVW$j.}wH.u QujE 0EPdEt1EPṠE 0S資 wH؍DPwHqGHM 1P= un= ue= u\= uS= uJ wH:t8E E܍FuVh OHˋQ轆wHuՋE _^[USVW3EE7k u轆}s~ {;~лÃ_^[ÐUShjh ,ش           hP ,t P, 3   @ l  3     2         d      [ÐU= u> hH < u% PtF@t? t 5 p3 (8 t Pσ 3ÐUSh@ 迆؅t#;t St So3[à h ^S5< Ph8 لjρ빐USVt@Vh Vt Su S33ۋ^[U%t8uÐUSVW4h 3u܂ V؅UEE؉}ԿE3ɉEMQPEPSuRE0E0E0L h (Wu5< Ph8 蠃 Et|u- h Wu5< Ph8 f EJ ht 踀EЃ E0WWuP5< uh8  EԍE܋t P肁Et Pm SaG V؅}ԃ V{,_^[덃 h  0PPE05< Sh8 f USVWhd ك؅t# St S؃. hL t hL ؃txvtehL Vrt Vn#0 h VcVP5< Wh8 莁tF V _^[à h ~ hL Ph8 SjI~V j7~뫐UMхt<_t <-tBABuÐUSVWu V<t( P)JtFt PJu;v/ GPIt3O;v GPIun#ebV#M PHu _t-u/C;s% P_Hu_t-tۉ] ]2u;s+ PJItC;s P2Iu;;=CE;s2 CPItE@E;s PHuuVM WuME+ƉEH+܃PVS)~E SSt M3 ue_^[ÐUSV]|rhhh hp A}k = tu u hP X E M UM E^[ᐐUSVWuu uVpk =|t=uutqE8~ugx/ua itP W|ׅt|/uHt| /tEHx/uA9/tjQhL Rà _^[USV u|+-C-uCP|u uhhh h@ { u VSPgte^[à jKzꐐUSVW}W]SuVu#uC367t 6{3w{_^[à jy҃ h @z؍E0QP5< Sh8 |jy멐USV ] P@Fou CP+Fnu{t^ PFyu0 CPEeu CPEsu{t PE1u{u  PEou0 CPEfu CPEfu{tI PeEnu CPPEou{t P6E0u{u3M5 h xS PPu5< Vh8 2{ 3^[ÐUSu y uM PQ tE8|9 h Nx؍E 0OPu5< Sh8 z 3[ÐUh u zuEUE MME U@ÐUS]t Px u d[ÐUS]t Px u d[ÐUSuu uu34E Sx ;vI|/u ;vI9/t[ÐUS]E 8u 3T PP3u[ÐUSVW uE 8tV P߅t0t* Pw~ |/uDtuփW6 6 _^[ÐUSVW] Sow4;h S)v?;s. D;PAtN;s FPAu; ~FPAgu ]؛?ku ]؛,mu ]؛tu ]؛]؛;sX PAtC;s@ PAu FP@tN;s FP@u;t8EPVS EtwM؋E 333 E ]_^[USEPu ]Et5<$$ fD$l$|$,$XYUJ;؃ h 2t؍E 0sKPu5< Sh8 v 3[ÐUSEPu Et5<$$ fD$l$|$,$XYUJ;؃ h s؍E 0JPu5< Sh8 v 3[ÐUSVWu Vt<;s. DP?tO;s GP>u; _GPG?du ]؛Nhu ]؛;muĞ ]؛(su ]؛wuȞ ]؛]؛;sX Pk>tF;s@ PS>u GP?>tO;s GP&>u;t']SWVtM؋E5 h rVLIPu5< Sh8 tt 3u _^[ÐUSVujh u - ؄u7 hl qE 0HPu5< Vh8  t ^[ÐU h u uNt=  3ÐUSE 8tm P t"E 05 F [ hP p؍E 0'HPu5< Sh8 Os 3 5  [ÐU h u ujt= u ÐUS]Su u6t;;t/ = u    3[ÐUSVWEuVjhh u E؄u7 hl oE 0FPu5< Wh8 $r  Ã_^[ÐUSV ] u 7t.4 t P`p 3{\4 6 h 'o3kFPu5< Vh8 q 3^[ÐU h u ut = t= u 3USVW] 5  E E E؋EEj,Spu So<+à t2jh SpυEj h S|pυu Ej h SUpυu E_j h S1pυuzE;jh SpυuXjh Soυu839t Y;5 E Eܣ Eآ 5 h| !mSfDPu5< Vh8 o 3] _^[ÐUSVujhH u E؄u7 hl lE 0CPu5< Vh8 $o ^[ÐUS]Su ut@ P H 3[USVj ] u onu. t P&m 3AY 6 hl k31CPu5< Vh8 Yn 3^[ÐUS]Su uu3  [ÐUSVW ]} 3;s- PC7tC;s P+7u;r;] -t+uCM ;-tJ; P>6tvk D;|C;] s` P6uK3^;sC P5t0k  +0;C;] s P5u3;] t3E03 _^[ÐUSVWj VgtX V gSV;uƋƉE^[ÐU= u u 8 3UtyMu = ti'u = uYu= uI= u@Pu f= t E 0=48 u  ÐUSVW?d= uFht>uu SWitM;}/ WdWftA Pde3XS6UP^35ۃS6FtGEE WI+τu$E C C C>Fu_^[e_USVW utCthhl ht S` ut$ < ' uuEz < @ uZ`\t9_}SQJ_VE PQE0c XVUUU+ЍR+؉  _^[ÐU jj\uU jj%uU= t 5 [_=Ȕ t 5Ȕ A_=Д t 5Д '_ÐUSVW ]Sjh` 藰 tB h4 ]3"5P5 Vh8 M`3^Z h$ ] 5 P8 V`h z]] 0^P3WV_  _^[U=,8 u,8 ÐU ,8 u= tE  ,8 Uh jah h bh bÐUSV88  u^p88 =ؘ s+nCoC-E0CP]588 ^[B\USVW,ؘ E33EX X: E؅M܉MЍQUGq CECt,MAMX uԋM+ʋʋu Ku!MAE:@Eu = 1 = t\ C 8: = t= t 54 8A+0A43ۅ~Jhf u 4Gtthf  45hf @hf C;4~0P5 = th 50F hd  8-uxu (  c= u\ ` QPGI  5 )MXSPiMuC%=t=$ u= t $ jj9Mth!j"Mh!jMjj MhHjL?zD3Hjh LP7s u = t) 7gpuC Vju3  jh PPPjHPS7V[09  7 pu jV5 D= tY 3耗tH= t h  h CF 3Pj3LGHt PGt P G V}? tNTQ QPaPeTu! h E 5 Pj'= t=ij t j= u= u 8~   u= f   U < 1ݝ( <0݅ ܭ($P2 $P1hT D< jFP.5 5 8 $5 5 WPV5<8 SWt E8}ETtWP?t [ uJt.Ps=tT]CTPCCtDT:}t4E 8u,( t#8t @ uHU M9u@e_^[USVWEE8u tEu:t P>Gt P>Gt" P=_ ߃ j(jjW}<E8_^[ÐUM9tQAAʄuÐUSVW,3EEhh u=؅ S譗dEE3]3C]߅t( PtCt Puu 3 PtCt Pu#"tD ]Pv uu\u SC t\ QJ uI҃ S]Ѕt""t<\u SCt"u Su tC$'E8 E80 vE8t u'M A8 LEPEPdu'M jE8t u'M AJD tA h EL:Ẽ uPuu5< uh8 < t3h u0:u h u:hD u9u h0 u9u~h u9u`h8 u9uB h L9uuu5< Ph8 ; EPEPt !]؃ W :uL]ԃ S':uV]Su9MM3E3tQ I  u,_^[à hL 88 09PE05< Sh8 : E볐%%%'%d%:%USVutM^ Ft P!9Ft P9t P8 V8uu^[USVj:uu9t+ 69؃S658D 9u!S65PD 9t3^[USVW ]u j:Sx9t+ S8WS58D [9u.8D   tFLD tNu _^[WS5PD 9u6PD   tFdD t VЃ] _^[à _^[]6U ÐUSV= t#= u h   @MU ]uu]U M^[U졌 @ÐUS @ MU ]E]]U M[U @ME ] MUSVWDj$jj"؋ME CEMCK 3{  U䡠 ʋ ʋUEʉMЉuԅx ;ű|uuWV:EԋEԋ+u؋E܋ ȉMuEؙjhPV:E Et^VW<]ċ؃ h8 4EȃVWPh4 ˃H#+ȋ]ăQuj VW Ph, jCu;u|N x;|…uh( jh$ jC@CM+;}u; |hh h 4EԉCM̋U3 Eu EؙM RQuut9CÃ<_^[ÐUSVWl   Ӌ׉UԋUUBEEzȋʋUE‹}ÉEщUEEExE}U‰EEP@ E EE؋EEm U؋EEm]E<$$ fD$l$\$,$D$Ph j)ExMHM  ʋUʋE@EE߉]ċEEEP@ tqMM؋MMm U؉Em]E<$$ fD$l$\$,$D$Ph jdE@EEuċEԉEE8X 3M uǙ uVSW?73E3U u)x ;Eԋ|uVSW 7)}ċEÉE ]SE UțE`$uuE ]E s s 3 $D Q$Ph jr EțUZ}E s1؃E$CEE  El_^[j ]E<$$ fD$l$\$,$D$PCEE  El_^[BJ ]+ËuΉE؉MmMȋB+]؉um]E vhj ]E<$$ fD$l$\$,$D$PEE  El_^[l_^[USVWEE  ˋ щU؃ jp}GE G;E؉E܉]Ouf_Mȋʋ tjhQS4 ÙșRQ Ph, j=O x;|ʅuh( jh jG@G; |"GGjE$WGM+G;E_^[OUSVW} Eࡘ Eܡ E j wt zE]ˋUы_ʙ уtjhQP;3 RP Ph, j  w;}C( ƅx;|…uSjSj F;5 |jE $WGh jxj}_^[-USV]t;u ,h S.u-     2h Sa.u-     0h S.u*    0ih S-u*     * h +S PVh8 .]^[ÐUSVWhj؋}E ;CMU;|ϋЉKS = t = t4t΃-J#+5   P3  HK cPC$h jYjjjS6s$_^[ÐUSVW,]SE EMMCʉCK{S 3;}s;}CK EU؛$uuSL = tF5 Ѕtʃ-H#+Љ   P ;u Ec w_6HK cPs$C$ Ec jE$S s$nE[,_^[USVW ]sK 3;}{CS;;}{C jE $Ss$ h js$ *] _^[)USV]Eܣ]E𛋃U M s, t ƃ݃pC,d0ݛpx|S,+Ήx|C,T0S,܃pݛpx|ʉx|ݛ3C,HK,u>C,5 r(ƃhTjVQ'3^[󐐐USVW] S(3;teVSEP-tu"Gh h hx E(E+ E0,u;u]ǃ_^[ÐUS= u9 hО &  P(5 .+؉ Mt  [ÐUSVWluuԋ^$FNVUEPR豇E PE u'M+E +H#‹MԋI t3E}3E8OW 3;EE؋EEm M؉Um]E<$$ fD$l$\$,$D$Ed~hh hd q&Ed|hT S&Ph\ S'jhL S&? OW 3;d uG(x;|N;| +ȍT1P[C]č~Z]+H#؉]K]d+H#X]ЍJMȅ}3Ƀ|ZEEċ]3;t @<@A;t @<@A;t @<@A;t @<@A;M~Eĉ];M-Eċ]]]Љ];Mt @<@A;M~EċEEE+H#‹#;Et;t E @EE=@E E<@Eċ#‹+MH#] MAMM;5+]H#EEHE;`E+EH;M~3|8E̍H]ȋE @ @ @ @ @ ;~߉]ȉE;]Mȋ]ЋE @A;~EċE̋M+E;M'H#EЋM+;Mt E @E E<@EċE+MH#M++MH#]ÍH;S;~3|2EXE @ @ @ @ @ ;~߉E;MEċ] @A;~Eą|JE#J;t-;t;Et E @E"E>@EE=@E E<@EċE#ȉM+H#;+H#‰EHEEЋ+H#;EhEЋ+H#ωMABE]+H#EEX];Q+EH;~3|2EXE @ @ @ @ @ ;~߉E;ME @A;M~Eċ]M+H#ȋ]+H#Ƌ+H#+;Mt E @E E<@EċEЋ+H#ƋM+H#++MH#EH];S;~3|2EXE @ @ @ @ @ ;~߉E;M]E @A;~EċEЋ+H#ƋM+ȉMċM+K#;9H#EM+ȍB;t;t E @EE=@E E<@EċEЋ+H#Ƌ+H#++H#;EЋ+H#Ƌ+H#++H#8]CBEȋ+H#EȉEHM;Q+EH;~3|2EHE @ @ @ @ @ ;~߉E;]M AC;]~MċEЋ+H#Ƌ+H#++H#ƋM+ȉMċM+K#ˍ1+K#+K#;'H#E̋M+;Mt E @E E<@EċEЋ+H#Ƌ+H#++H#ƋMȋ+H#++H#ǍH;}L+;~3҃|.WE @ @ @ @ @ ;~߉E;E @A;~Eċ]]CMA(@A(M؉Um]EuEOE؉Mm]E<$$ fD$l$\$,$|$EE؋EEm]E<$$ fD$l$\$,$D$E;~hh h4 ;}~hh h$ [KMЅ~UGE̍L;ׅ}33|/W3D+D+D+D+D+D+;~;E UD+@;~E+߅~fC~[{TM̋ʅ}3|33U=D=D=D=D=D=;~܉U; U=@;~>AEЋ+;}  A+;|]Yuh SjSظ +M~@ًх3҃|& @ @ @ @ @ }ޅ~ @IE݀pUԋx |3E䋲x|}E ܧ܂p]E }W$PV. ]E s s 34(D $Ph ShjSjh  S}]uVN 3;|E FEԋ~}3;}E  E3‹}3 t&EЅtܦ +UEȉU؉MmɋEԉE؋EEm]E  ]E<$$ fD$l$\$,$D$EЃݞ؃ EPju^ PVSjS؋Ej h SE h  PSSYS~+ȉME  s $l Ph SyMj ]E<$$ fD$l$\$,$D$PxPSjS؍EU+J$u+;J }} C+B$+;B |l_^[USj肴h j色uj|ÉE[QUSh ؋Et*h Pu = ua = u h8 Pu = u0t*h Sr  uE [[U hHjÐUSVW } u(  M; D N D d)pփ|,E.+Rh| h ? ų +*+k+WSE.+Qh h  ++k<+WSų +Qh h  H+Ѓ k<+QSRh h _ Qh h G  _^[USVW( 3ۍ4, t P8|EP73}CruFLM(  E5@   D@u H  _^[à hP  0 PSj? H  믐US jj<؀=ȩ u ȩ  S[ÐUEEFUu5 0EPXÐUS]S5 EUM+EEE+AEE5@ ]EA]EAv؋[Y@PP[UE@U Ujj5ÐUEEfUSVWj0E FEEF]^EF E F3FMA@AI +H#+ȋ}O  E0jju SPhd  thw whD E tI t>tPj  E0j SPh( 華Gtpw?u7 _^[USVuCuFCM MCMCMC MCM N= tA3jji sPh = tv vhD ծ S3^[ÐUSVW|E ] tDt P3M Ct Pl3MBC A j؋}75 jjjjPE0V7Swp]Ex |  t ; =4EPEPEP]SEPEPVF E8 QPSM Q58 xPcM= tPE0h CEM3ۀ9t0  3ۅt$PQou E3 EM9E 0 EPQoouEEEEEEjEȍU2PQ;E jM1jMQ3MQMQM1P/$0MċUE8u83ۅE3ۃEuyE3۩uI3E`3ۅEtS3ۃEuEE3۩Et03۩t@uE8Et EtcuE@E0uuE0uQ M tQumE3ۃ Q(EċM" E0 E0'M uDE%M ;E|PtK= t ;t7A;t2= 5 E0h 趪EEE}uM̍U2QM1P'EM1P貰E=l t È8]}LjE0j]E09|M Mt3|9A(E!hh| h  E}tj|xRE}EEEE|EEECE0uuE0uS ti 0iE uXEECQPBRuuh V0usk[\E|EEEEEECE0uuE0|S ti 0E uEECQPBRuuh V0uj[M}t u  |Au,EE u,E= t= Q=ij t = ty/ P_= t6= u=ij t@   L Ph\ _= u=ij u h   h  uPjzu 5h jUE09 u Et P EE P EEEMPEQPEPEԍMPQV MԄtK]؃ Q: t P( EPEPEPSEPEPV Mԋ u Vzuix |  t ; |t 3|_^[ 0  Ph jUSVW];7= tVh 聥Vuhtr=ij tGju M؀= t E 0LPh * S=  hl sjwQt1= tYCuS= \ h 輤.u = u"= + hH 苤 WEM܉M؄u"=  h P= EEpwE؉EIPM܉M؄EpwE؉EM܉M؅ueEH9Ou@ 9G uR= tCuCw Ep \u+= 8Ep w h 菣=Գ u =г t8 w ^u&= w Vh EG$8ta P`t tGH9E|A= u8 w$Q[u&= w$Vhx ܢNE EpwNtL= uCwEpst+= Epwh< u=l }w w ؅u{uEPVO ujh8 < E0؀= =ij  E0Sw ws wS uH= tVh 蚡VE0c= t h p3= t h S_^[ÃE0h j茠E0. 0) Ph jUUSVW ] uhh| h jjju00uhh| h Xj j7uuuuSWVA:W(u= tE0h 2à _^[UM uE8*t9tEE2jh uMM EEÐUSVW] E;s;/uCPS%NuEEEEE}@OW;~.tɉO GQR.ЉWvLt] _^[USVWE033҅~S~Hƅ}3|/9tCAytCxtCxtCH;~;9tCB;~ PkEU ME~>E33B<|t!}؋}E؉GGEE܋E؃F;u|9]thh| h   uv EF^_^[ÐUSVW<]} EEj Ej3ɋ;ߋ7MEũ+Pj Stp; PHtC; P,u;#;t APMMt9#tA;r;v8 APMt@EHE;v @Puhh| hp  ]Plu-u%C;] PGu-tۃ ]PEtC;] P(uE9E;:C];]s2 PtE@E;Es PuEH];s#+;v3|E;v;wC;vEԋM+ tYjh4 uE8t# EPM;PSQu Ejh@ u0uBE8t EPjSuu Ej hH Qt= tkuh V}uE8uEPEPE+SPE8 EE= tuhT šEȋ;Eċūu#9F~(PvjFF VHƃ<_^[ÐUSV u`Yt!v6&V7[^[à h  05PE0Sj`3USVW u3>~3ۃ F4G;>|]Ct P] _^[yUSVW}u x% GEGPM@M܄ GEGPMM܄tbEA} RM6M܍PɋEA} PM܉UU؋M܃/tȋ}% FEFPMM܄ FEFPMmM܄tbEA} RMM܍PɋEA} PM܉U_U؋M܃/t؋u:uGF3 3_^[ÐUSVW]t{;~oE E33uC48u F;3|CC\= t>u   4PuWh q Ã_^[ÐUSVW(ugE܋} VW[`M܍D+܃QuSAE܍ :VWAQ`=̩ u j>̩ uV}WS5̩ t*t Pu75̩  S uP5̩ e_^[ÐUSVW(u{؋} VWp_D+ĉESuPVE :VWAQ_̩ tuP3e_^[ÐUSVW$h uF; Eij E  h aPju  ij jh EPS$tw jh jjjjVSW $W/Eࢃ Eܢij  StE t P_^[ÃE0S)VSh j&VEࢃ Eܢij  Sp낐USVh u9VuAV:^[US̩ tdMQP[]SoMt& QsSH uڃ 5̩ i̩ [U jjhЩ PÐUSV<]u]E %ة ]EЛЩ  ԩ U uʉ5Щ  ԩ uMmp t UEm]E8]EP ؀= t2QV $PX M$h  3]E$踖3z]Eem  \ w I >= tdQV]؛PE$PX M$h : 3Щ ԩ  3Oة 0^[ɐUSVWu ]EEtFEE@;ً| t=3+ًMAu-+‹U B]u _^[uSjV}OG E0\E0릐USVWx h EЋU,ŰʃME3ɉM؉M܉MMEu = t:EMU؉J= up 3 t Etm3W uMU33ҋEuPVRQE P*p  t u}u${}up  t u 3}(t*yp t  ʋt= ʃ}ȃ}tE3;UE ẼEE]}E3EM@ }u(}u]y]E+]M9]̋M}a]\E uA ]S]}MjQPEE B9}̋EċM}]߀}@ D@` tV؃ V2]Ee]E` @ ` -@ ]E$SuuL ؅}]z8}up  t u 3ۃ}( V3$Suu ؅P}up  t u}(t V؃ V6]E]ME EPEPSuu }t'+EME u up  t tVPS}t, V]E$PSu }|EM9MMhE1*}3؃ S3ۅu }˃H#+؅t# V]E $W蟹}(t Vt Vu tFMU‰Fu$tFMUF u|_^[USVW,u V؋EEEt;}hh h EEԋE E؍FE܉uMЍ< h $E+HPWuG rVWSU؃+x uhh h| 4E9E}!HMQS)ˋ؋}M܃$VWu MȉM ;u3$VWu MȉM tlE;EE}t;E}7U+H#44VSsE^ SS[ 3C}u= S2:3"t S3 S3ۋÃ,_^[U uj u At@3ÐUhhh,suÐUS ]SE$u u_ ]Ep sx s 3 4hD $Ph h 4 [ÐUSV Es&كh^h hX ]E蛋]u }%كh_h hL ]ED@u]E \ ]E]um]E wj]Ew=]EwًE]E=؋E]E'؋E ]E ؋E] ^[ÐUSVWLEEԋ]E E}EEEEEu ]E u E̋EtEt}]u E3E܉E Wn tB jjEPV؅ZKG;wG3ۃt3 S!3 }u!PEPSEuPWr ijEPSuEPWq EEt>u8 PKDt(E u$SuEuPEPuWEH t SS 8EU]${ 4C 9}t W jSju = t uPh  7EE/3M9uhh h rEt PmE0u+؍E0K M܉M$MA At P%E܋juEPS؍E܋ P3M܉E@E; L uE܋E9}t W8)} Eġ E3 E  h M VPj݃SXu=}tEģ Eȣ 1M]= t u@Pht M9M]9M]917OM=ij u0t,7u Mt7E 0MEt17ME@t17M}t9u&9t( }t 1 }t3M9}t Wu#}uEt uEtM̉ u}Eģ Eȣ w]Ћ]̃ h _ 5 Pjuc9}t WR S6E0)}tEģ Eȣ "}(t V蜑EE EEEԉEƃL_^[ÍE0VEЃ h( uVPj9uu}tEģ Eȣ 1gM1PhEЃ E0ŅuPh jʀ9}t W= uE0u}Eģ Eȣ USVW<3EЋu }uujh EP7H؅=0 u 70  j PjEPjjEP7S[$S\} E؋t0   t P EЋ6   t P EЋM th jjPE P EȍEЋt P]ȅۿ8E3M܉MCx |  t ; jh j0 u = xt  E) PtZ Eċxu th W-E̋EĢ Vh 3E̋EĢ q t: jh PEPjEPEP0WY0Ẽ WV, jh PEPjEPEP1Q0E̍E܋= u E8uw P1tP= t h4 } h$  M1Pj8}E0uoE E8u E8t( E0sE܃8t E0[[}3 uǃ<_^[4 0j Ph j|jE07S7h jk|S뗐UE 9Et h  h E EzUd \ =yD D@u/D@ =X }0MED@=X tc~]E\  \ ]E蛀= t)$\ $h ]{ E$Y$Hr؃IME$z$i yD USVut:ދst P$Ct P SuƉu^[ÐUSVWu  PQDD+T+܃XVuMuF%=uz5 ~OE8FPPWh TVWh SSTP}juh SSue_^[ÐUS= u35, ]sCu uX h Du( u5 h !uY$ u h j؅t9;t4 St*hPh   33ۋÃ[ÐUEt P3ÐUM tEE M|3ÐU t=$ tME MÐUEt' PBt=xD txD 3U t Px;ÐUuu1= u j  E05 :USV  Pv؅jPhD hP Sh h,  SPjwEP5 ]St+3 h O VPjvSuՃh jt h` Pjv^[USVWMم<%sSC{ REͥτtp EP賥τtV6A} VҥύpɋEA} P该σЅt]CAD_^[USVWM3҅t]  tAuu }t}EE_^[u+΍E @P߅tH}M  uFC#F%" Cƒ" Cu‹}+;Ethh" h" ;ǃ_^[ÐU jjuU jjuU jjuUSVW]3tO<%t t2u+( CPȣt CP责uGCuu}u+ލ{ CPTˋ߅M<%t t5u-4 FP@t FP,t FC&F%" C" CuM+;thh" h" ǃ_^[ÐUSVW 39D tOD D }3 P P3WYt FuD t ƃ _^[ÐUSV]t Pؠu-t +t3SsCtC P謠uC-t+u%Ft P膠u-t+t<:^[ÐUuUED ÐUED ÐUh" ut8@u@EÐUSVW M} ;tyE0+Pj:Qx;tWt#WCP M P E߃SV M P33 _^[ÐUSV ut3h" E03؍E0;totX;:uSC{/u {/u3Uh" PtD/t!tVh"  M+D/Vh"  3^[USV] 3t5 Pɟt PC uϋƉ]^[U칂D ED t D ;D t?At#AD ÐUSVW\3EE uEt x t@ }uE E0؋E܃ D 8ÉE؃ Pk]؃ ]V#;[t*WSoȅujuȉM\Cj]SE#uSu  EHM@PWqM;] VMMMEOMЋE8:xQWEujWEE;tdHM3ɉMM;sRu Pt2Ek DЉE=G;}vЋEEu* M/EEu8E@AMăPQEuju[EMMȋ}ЃM܋D EEtJ<;u@E@ẼWPEujuEE܋D UU}ЃEEtEu [C ][US]s$u +C$][US]ss3Ct PCt PCt PC(t P}C,t Pj s \s$Q][AUSVu}M</t;t J:/t;u;Uu3Ru؍hVSuGF%=@t(= tSh,! d S S3 S u S}ƁĐ^[y 0PSh$! jcÐUSVWu؋E p<P;}3ҋʃH#+;|} WtR7wSuE 0V=E X _^[USVE XsP;}3ҋʃH#+;|u VtR6萲^EM A^[ÐUSVW,EEE EЃ= t EE= tM}tGE]+؍K+̉MSPQoE PuAEEЋMЋE+ȉM؃u 8.ux.u! E"! M+ȉM؋EЍHM3ۋu;rEHuP;+;v3|yMЃ}Ԁ= t PMM̄t tCF= t PM͏M̄t tCF;v};uwBM܋}Ԁ= t PM艏M̄t tCF;vʉM܉}ԋE؍4Xu؋EHP;}MҋH#+;|uVtRP聰N؋U9UrruM܋+@;v3EHEEԉEʀ= t Q贎ʄt Et%%ɋ" C" CC~Nр= t RUфt Et%%ʋ" C" C Cw;u:EȉE;uwc}ʀ= t Qʄt Et%%ɋ" C" CCF;vEH+;]t<hh" h! EHuuPEH}؍9 HwJu;s<= t P迎 P蘎CV;r׋EPEЉE EEe_^[ÐUSVW5 EXj/S@tRE EF΋*;t&ExtPj/ujWS__j/Su_^[ÐUSVW< 3uuu tء tB}WP* J ta9wt>EPj/v+ Q u EEPE@D  E90tEPj/h }wtEPw\EPh! F wO ;tNPEQP;'= u+:MQPoEMPQEPu9u tE90t2EPj/0E90t@EPj/-9u t( u MQjM PQHu~$u WMQjPW^tNtGtC= u@?MQPSMQjPSEPjT] u! u u  t& St5 Su"jV ;t V詿Ã<_^[USVW] jS9E UU.t";t;/uES;/uPY{/totk.u{/tu ;w:}uJq;t;sGCA;s?/uCA1;s-AC;s';/uACI;vy/t I;vy/u;S;t;_^[ÐUS]uu3 PP35uj3蒿[ÐUSVW(} u  u7rE?^#/Ex/EE܋+Qj/P-t+x/t}#+Qj/Pu}+}܍7E @Pa؅tWuSϽVuW载EEE+Sj/P蘾tx/tE+}7E܃ @P؅tWuS]VuWKEE8+߉]Sj/WtWO;rMx:uGx/uAEHMƍHM؃ Pk؃}tuWS׼E/3@+ljEƉE؃ @P.؋E܅tPWS蛼VuEP膼Ej#E08u E0DMM M+7E܃ @P謦 WuS! VuWEkEE+7E܃ @Pf WuSۻ VuW̻E%EE_^[tE_^[cÃ_^[ÐUSVWu jϝ؉]E<_^[ÐUSEP|؅t"Su j h ӷt [le琐Uh\$ uÐUhH$ uÐUS= = t = t}h jh<$ tb PV>؅ty h$ SPIh# ̰5  PS")؅|{t' h$ 葰SP j ¶h h# h# 軶 h( h# h# 褶 h8 h# h# 荶[à h4$ 躵j蠯딐UE E jEEPuMt 0$PE0h# jKLՐUSVWXV3ukuCF%=u4= tE0h# L E0j؅u ÁĜ_^[à h# 'E0h. 0dPWVjK뱐UhPu許@UShSu蓱uC%=@3Ĕ[USVWh# u覯t'jjjWW؋W蛯 Ëփ _^[USVW u|E܍H+̉MPuQl]E܍ .AM3ƃσWVuSuՃ Se_^[ÐUuu} tEEE騚EE2USVjuE PSuEP8u^ S2juuE PSMu 8t#Ett S Sԭ^[ÐU hhu@|} u# # M E+3ÐUSVuĭ@+܃uSͭˀ9/tTs3S蒇 uڃ[ÐU=8 uJH P 9u'8,t  t#   p#  l# 8  M M ÐUSVWy ǃu ƙjhWV$y0Cx ǃ|jhWVx ǃu ƙd jjdWVx0C x dǃ|jjdWVx ǃu ƙ jj WVx0C x ǃ| jj WVcxF0C C  ǃu ƙ Tjh TWV=x0x Tǃ|jh TWV x ǃu ƙʚ;jhʚ;WVw0Cx ʚ;ǃ|jhʚ;WVw ǃu ƙjhWVw0Cx ǃ|jhWVkw ǃu ƙjhWVQw0Cx ǃ|jhWVw ǃu ƙ@Bjh@BWVw0Cx @Bǃ|jh@BWVv ǃu ƙjhWVv0Cx ǃ|jhWV~v ǃu ƙ'jh'WVdv0Cx 'ǃ|jh'WV/v ǃu ƙjhWVv0Cx ǃ|jhWVu ǃu ƙd jjdWVu0Cx dǃ|jjdWVu ǃu ƙ jj WVu0C x ǃ| jj WVTuF0C C  ǃu ƙʚ;jhʚ;WV.u0x ʚ;ǃ|jhʚ;WVt ǃu ƙjhWVt0Cx ǃ|jhWVt ǃu ƙjhWVt0Cx ǃ|jhWV\t ǃu ƙ@Bjh@BWVBt0Cx @Bǃ|jh@BWV t ǃu ƙjhWVs0Cx ǃ|jhWVs ǃu ƙ'jh'WVs0Cx 'ǃ|jh'WVos ǃu ƙjhWVUs0Cx ǃ|jhWV s ǃu ƙd jjdWV s0Cx dǃ|jjdWVr ǃu ƙ jj WVr0Cx ǃ| jj WVrF0C C  ǃu ƙjhWVnr0x ǃ|jhWV:r ǃu ƙjhWV r0Cx ǃ|jhWVq ǃu ƙ@Bjh@BWVq0Cx @Bǃ|jh@BWVq ǃu ƙjhWVq0Cx ǃ|jhWVMq ǃu ƙ'jh'WV3q0Cx 'ǃ|jh'WVp ǃu ƙjhWVp0Cx ǃ|jhWVp ǃu ƙd jjdWVp0Cx dǃ|jjdWVip ǃu ƙ jj WVRp0Cx ǃ| jj WV#pF0CC ~ ǃu ƙjhWVo0x ǃ|jhWVo ǃu ƙ@Bjh@BWVo0Cx @Bǃ|jh@BWVzo ǃu ƙjhWV`o0Cx ǃ|jhWV+o ǃu ƙ'jh'WVo0Cx 'ǃ|jh'WVn ǃu ƙjhWVn0Cx ǃ|jhWVn ǃu ƙd jjdWVvn0Cx dǃ|jjdWVGn ǃu ƙ jj WV0n0Cx ǃ| jj WVnF0CC\ ǃu ƙ@Bjh@BWVm0x @Bǃ|jh@BWVm ǃu ƙjhWVm0Cx ǃ|jhWVXm ǃu ƙ'jh'WV>m0Cx 'ǃ|jh'WV m ǃu ƙjhWVl0Cx ǃ|jhWVl ǃu ƙd jjdWVl0Cx dǃ|jjdWVtl ǃu ƙ jj WV]l0Cx ǃ| jj WV.lF0CC ǃu ƙjhWVl0x ǃ|jhWVk ǃu ƙ'jh'WVk0Cx 'ǃ|jh'WVk ǃu ƙjhWVkk0Cx ǃ|jhWV6k ǃu ƙd jjdWVk0Cx dǃ|jjdWVj ǃu ƙ jj WVj0Cx ǃ| jj WVjF0CC ǃu ƙ'jh'WVj0x 'ǃ|jh'WVPj ǃu ƙjhWV6j0Cx ǃ|jhWVj ǃu ƙd jjdWVi0Cx dǃ|jjdWVi ǃu ƙ jj WVi0Cx ǃ| jj WVuiF0CC ǃu ƙjhWVOi0x ǃ|jhWVi ǃu ƙd jjdWVi0Cx dǃ|jjdWVh ǃu ƙ jj WVh0Cx ǃ| jj WVhF0CC ǃu ƙd jjdWVlh0x dǃ|jjdWV>h ǃu ƙ jj WV'h0Cx ǃ| jj WVgF0CCV ǃu ƙ jj WVg0x ǃ| jj WVgF0CCN0 CMt@_^[USV kl u uS pVUUU+ЍR+5 ^[ÐUS= t3. h8 f ]ShhTP]h|C3[US= u, j>c4h 3P9h 7h؋Mx;|ÙڋÃ[ÐUS= u, jbg 3Pg [gU}thh$# hP# majh gÐU,jjEP`E<$$ fD$l$T$,$L$MME P ]E<$$ fD$l$\$,$D$E u EEjPj&gUjEjPa_ EjPjgÐUSED@hjdjh ftjjdSE$uU1_Vjjd_3 uU3[ÐUSV E<$$ fD$l$T$,$D$]EEE T ]E<$$ fD$l$\$,$D$EuVSe}/e^8u%FCVSe} @^8tۃ ^[USVWE u|}M;GEY+OVUUU+B;uv3҃dU F>8 F~ CF? CF AF~8 CF~ CF? CF AF~8 CF~ C F? C F  A F ~ 8 C F ~  C F ? C ;;uw_U F>8 F~ CF? C;v] VUUU+ЍR+؃u-  AA=A=Eu@ F AF AA=+E_^[ÐUSVWu] >F W,'uc=SǀG E5>F W&u=ǀ E EC>F W&uǀu^ |S=tS EEĈC>F WR&utU=ǀu= |2 EC=u>>F W&ut=u=6/(! +E _^[ÐUSVWL]EE;ËuWSEEPu u GEuuPuu u ;EU;EM ME؍E E̍EEԋEEUMẺE܋EȉEĉuЉM}EEuuVUԃ0CuVEEPFZEEEuFuЋ};vCu؋EЉEMM}EQVMQZuu؋uF;w E;EK};EEMME E+@;v33EE3u܉]ԃuEPEPYEPEPEPgYEPEPEPJYEEPEPEP)Y}]ԃ];]vu;]w0EEEEFuEPEPX}C;]v܋EM;}]u u+B;v33r{E3W3PEPXW3PEPrXW3PEPZXW3PEPBXEE;Ev;Ew/}EE]܋]WEPEPXC;]vu}ߋE+A;v3ɃEEEE Eu܃WEPEPW߃WEPEPW߃WEPEP{W߃WEPEPaWߋu܃u;uv;uw5EEE E}EE܃WEPEPWF;uvL_^[US]v+M +ԃuAPjSRu e[UEsX ` skh sAp s؃h,# h |Vx$h0# j h X [؃$h8# j h `X <؃$h@# j h AX ؃$hH# j h "X UE7w$  ,% 3Ð                                                        Uut E t;}E ÐUE  uUSVU u \ D Ë]yJB+ʃ+#^[ÐUSVW,Ej jEPQR jEu PS33ۍ}؃jSWZjSWFjSW2jSW?~Gj EjP j4F PuuaS]{t!{t{t  M j Mj QMAj4F PQRǀ|t#|t|t Eԍ MD j EjP'MЃj4F PQREԀ|t)EԀ|tEԀ|t EЍD j Ej!PKj4F PQRϋEЀ|t)EЀ|tEЀ|t  MD j Mj,Q@Mԃj4F PQQǀ|t#|t|t Eԍ<D j Ej7P j4F PW?QED = t 6'Ph' ,_^[ÐUSVW8Pu P 8QPu RuP 8QPu4E؍8PQUE1E؋E1E܃Ej0PQyPEp~i}؍8 SZ Sj0PWSEE܋U13M܉jW0PPF΋0Phذ _^[UVuiд uƅhPUt8th@PUUuԴ t8t PUUÐUUuÃjPU Ph+ jdUuՐUEu usMU= tFUt< hl+ ^MPj t P>UB3:UEUPU+U uMU)uQUuUUuYUL PYU t PTU 5ȴ 5̴ 5 JU jj5 HU tG= u  Ĵ  5  P5 5 U= t/ 5Ĵ v P5 5 Tjjj!5 Tjjj!5 TUSVWEE} ]SWuTt ƃ_^[ÃjuTuK8tՐUSVWEE} ]SWuhTt ƃ_^[Ãju7TuJK8tՐUE 0-Tu0E D@u ظEMM] EcÐUSVWE8 Pjjju t"] EEuSWSt3ƃ_^[ÃjWlSuu|J8tuѐUSVWu R؅tdFt P9KjS RWpKEPj6 uWS]KQuE^3ۋÃ_^[ËM ;D  jPQWKEEEPS5 uWEDPJEEGQu뀐USVu  SRSRFt PAJ V5JuV J= tSjVhT+ ;^[USV= t h8+ = uhh,+ h' I 5  R؅uVSQt SQSR~{4t,= t h* W SQbjj4Ph8f Vc= tSjVh* ? = t h* 3^[ÐUSVW] Ex P<*t7 P;uCG Pu3 PE*uG P*tEtBu Pb;uSW9u;.t Cu 3};_^[ÐUSVW< t h* F h' F ub0uhh,+ h* \G VO؅  SO jjPOSO jjPO t:Wjj/Sjjm/ Phd*  WOS~O VODž  SBO jjP%O h0* OEu jj.j]PWj u h) DPjm u h) DPjgKtu h) DPj@$ h) DPjDžjjjUSeNDž u SN VQNtXt`3WV Nt'8u"pNDžt G;~ VNE 3WVM8pDžQM|g0h t6 QD pvM 9t QLG;C QLDž VM( VL3t MuC;|; h0) fBu jPVjDžZ SKƅhPj VLu P t:jj VoLt Pj VPLu拍QVHLPOLPB VK9 h,( PAu PVjDžQ h( APj:E 0j)PWVjz DžtE= tu j*Ph'  ShK=  SJK; h* h@u jQ*PSjDž= t4 h' $@u j * PSj= u Dž<_^[à VJ Ph) jdEUSVjh8- u AE X@t( Pe tCt PM u;uF];}!= t h, }= t h, ^3m Sr@+= t h- .VS}|*M0|jVQ.@33e^[USVMEq ˆEY ˆEq ˆEY ˆEq ˆEI ƈE E EPIEu PI ^[UxPu@xjPuu HxPEPxjPEPu HxPEPxjPEPu {HÐUSVWHu>| +ȃH#3ۅpȅ}3ɃE8 PI  DP/ D DP D DPD;~;-E PC;~܃}S؃ ~3|0DDDDD~Ճ C ~PCjPHPhx FPP jPPQhx F jXjPA; uHu Ppu<#p|4M+;ȋ+‹U; uy3ҋ}3|JEADAADAADAA;~;]AB;~n3ҋ}3|AADAADAADAA;~;]AB;~ hP>E PhP0EhPEP-E jEjP9 uEu Pe_^[USVWu } h, ;h, :Eu, u, M = t h(, zj\Vp;uj/V^;t+@Dž,  F:EPEPPW]C@ÉH@H@XÉ|ȉtxjjjjjjjjjjRRPQPQjjPPxPtQPQjjjj@|PQPQjjQPjjjjjjQPjjjjjjjjh+ hP-;ƅƅD@=r3SP8 P8}UEjPPt8=} MjQPE8A8a9HVUUU+э+܃SPr jShL, M M u 3= t h, rA Ӊы h, h, jjjj QRQRjjQPPQPQjjjjjjjjhT, hPM9ĀˍY"VUUU+Ӎ+܃S QPZ jShL, ҂}u e_^[U}ÐUU09#ʃ߃ ÐUE߃ÐUM ă  ÐUMă ÐUEЃ UEUE߃]UE^USM!Ѓ~#؃0Ѓ9# ă߃"[ÐUM"ÐUEUU09#ʃ߃ ÐUEHw ÐUEHwUM#EgAAܺA vT23AAAÐUS]EEjPu 4CEEjPE P4CEEjPE Pt4C EEjPE PV4E [ÐUSVW ]C8r SЉS;sC TS{ ׍}T+Qh P3 7VSE E M _^[USVWhH5 HP]3S+Pj>PF5ttv S6uɃHPhV>명vHPWVHu PV23Ĭ_^[à S4t Vf2UXP XPu uXuP8ÐUSVW}u EX+Ë+H#ƉEM MPWQ.2EE܍EM܋BB@vGU2PuM EE܍EA?AP]܃ESP1E+@r^t:@vQE]j@WS1 uj@P@@wރE0SWw?v[EXEVWPB1ރ@r0E0j@u6SE\Pu 1EXu }_^[ÐUSVWlUUM M‰Euu>^VF NN;MsMAM;MS]EU}EEUu3]#3xjp $y }ߋ3#3;νދy}Nj3#3|ǀ Ëy}׋3#3:*ƇG Ћy}3#3>F0y}ߋ3#3;Fދy }Nj3#38ؘiËy$}׋3#3:D Ћy(}3#3>[y,}ߋ3#3;\ދy0}Nj3#38"kËy4}׋3#3:q Ћy8}3#3>Cyy<}ߋ3#3;!I@E3#38b%Uċ3#3:@@ u؋3#3>QZ^&]3#3;ǶE3#38]/Uԋ3#3:SD u3#3>]3#3;EЋ3#38!U3#3:7 u3#3> ]̋3#3;ZEE3#38U3#3: uȋ3#3>og]܋3#3;L*E338B9Ű33:q u؋33>"am]33; 8E338D꾤U33:K uȋ33>`K]ԋ33;pE338~(U33:' u33>0]ċ33;EЋ3389U܋33: u33>|]33;eVE 38D")Uȋ 3:*C u 3>#] 3;9E܋ 38Y[eU 3: uԋ 3>}] 3;]E̋ 38O~oU 3:, uċ 3>C] 3;NE 38~S<U؋ 3Í5: u 3׍*]Ћ 33ӆ}uމ]UEE;M]U}M9YQA l_^[U u juUÐUujUSV(Eu j0P(^[ÐUEu ÐUMu E ÐUSVW] }u T΋M3ȉM΋u3։T_^[ÐUUu BM JUÐUSVuu ] t}t^(EF,u^[o'USV0]ȋ Ģ MȉE̡Ȣ  ̢ EЉMԡТ  Ԣ E؉Mܡآ  ܢ EM  EM  EMu tR3EK0HKS HP KSHPKSHPK S$H P$K(S,H(P,0^[&말Uu&;Eu } u`- ÐUSVWEEMdE$hE(l= Eut3ۃ d$FDžtDžT3Džx@u'} vE'DždDžtX- xDžTdt3Ph\- hdhX- lu'htE+ыu ;sCA9u lxP&DžTgDžTDžt3DžxEu'} vE"DždDžt`- xDžT}t }@ E82TX|t39E X #ƉEEEd#EX#ƉEEEuMDžLUTEE}tAML;Uw0QxEPd&utEMTL @PM~$CdtZU ;sE'C;sM\C;sM'Q}t }AT@-L }t rn}vf baEFdutELP;UPT<?iH߃Y$EtU E;sE?C;sM"C;sM"C;sM?LP}t! WpEjEjPPXi!XPEDžp}u T"EL+MMM MEELȉTUREPMQEPPXt!XP}tRvMEELEM [\^`|~@;rǃ E0PX+u Džpu EP+XPuMDžpT;Es3M<t*ME@EL;EsE<u Džp}w}pLUЉ`p |tUUӋEEu Et ;s\BC3P9`;sM CBMP 9MP뼀t:EEÉEMMEM E\U;sE\S;s\0uS;s\0uEp\B0P9Uv0;sCEFEUP\@PnEEt E#E}]M}KrEt`t2M ;sE\CP;Es.TЃ w;sE0C;sM0E0 EuP}tUʃM u}tt;] sE\C;] s MECPL}tP;EttM<gxudu tulE(hE$dEEEÁĬ_^[DžT3DžxA$>$>$>$>$>$>8=1===#=*= =$>$>$>$>$>$>$>$>$>$>$>$>$>$>$>$>$>$><<<<<B<v<<<<BBBBBBBBBBBBBBBB<<<<N=$>BBBBBBBBBBBBBBBBBBBBBBBBBB<oAB<B<BBBBBBBBBBBBBBBBBBBBBBBBBB<<<<=BBBBB===BBB=B=BBBBBBBBBBBB===9:::;:N:N:N:USVuu  v,v(FPv6uuu u0^[ÐUuju uUSVW,]u EEEԅ CE؍KM܃ s,s(QP3E EPujj0EЍp Vs,s(uu3uuVWe0MEԅtMЉǃ,_^[ÐUSVW Pf =Tf vs 6G;=Tf rC0 ;t PXf 5\f Xf ;t Sq5Pf Tf  _^[ÐUSVW,VE]=Pf K9Tf s:Xf tPW=Pf -Pj=Pf Xf  \f OTf +AQjPV5Tf  ߉M̋tEEԋ@E؋EԍPU܃ p,p(Ru؋E0EEPu QV09EwW@EЉ߁0 t V8 ut Ep,p(uu0uE 0uVX0Mƃ,_^[Uh ju uhÐUh uu uKÐUujÐU u ujÐU8Eȃu P EPjuuÐU8Eȃu P EPuuuU u ujÐUuu ujU8  MȉE̡  EЉMԡ   E؉Mܡ   EM  $ EM(  , EMjEPEP!EPu ujÐU E PjuSÐUj:uÐU j:u u)ÐUjuuu uÐU8  MȉE̡  EЉMԡ   E؉Mܡ   EM  $ EM(  , EMuu EPEPuuu ÐUuu uj6Uuuu uj7US]Stuu[FUM u#Et P3M E<Qu0tUS] Ut=s$H u@E U[vUS]S8 SjP[ÐUSM 3ҝtf];rQSsuu[EUS] S SuP?[ÐUu@PuUh- Ph- j5lf YUShSut h- F؃Sh- h8 [ÐUSuu8 S, E t P{8 H8 x< H <  Sj E SEu[ÉE[,US( S|jP| S4 t5ܸ h- h8 EPuu u[ÐUS=, t>]90 u%M4 ;QPE4 0  ( S|jPF| S4 t5ܸ h- h8 Et- - uPQh8 EPuu u [USVWMAEt8Ft N 3MF E}t) hT. M q M 1Ph8  u vF?}t$ hx. OWM 1Ph8 ~;:t?:E @W}t$ h. WM 1Ph8 q~?hyu[BA IM @Q$9Q t;tQV_A E x$8E H ;H$t]<_^[ÐUhf 8 8 df < u Quuuuu uj 8  hf  D    @  `f ÐU jjjjuu uU jjuuuu u^Ujujuuuu uÐU jjuuuu uUjujuuuu uUEt EUSVWh/ h/ QtjW ߋ  8  S!MQP MEu_QEUAQ EUċAQEȉŰAQEЉUԋA E؃a S MQhTP? EVuV Sh` d PEjjjVMd t>|7| u3D}t(HxFHN Vj t }t S  MQhTP  WkČd _^[USVW,EE܋] EE؋ut4uh  V t}E؉Eԅw5\/ Euh  V u_EE3VjSEP t3GuCEHEԅwٿ9E܅tM E8u#3EEVuSu uE؉E] E܉Eǃ,_^[USV uVo ؅t0;t+ Ss?FVSh &Vh4 h [ ^[USuu] ;r&CPE0ugED"@PE0uC3[USVW}wtE "ǁ_^[Í] E 0ρH#Pu EPF }h8"t(u|8uuh/ PY 3oI;sAhP"uP30Uuj u uUSVW,u"E EЅ} >t8u#xMЉjx6EE3ۋEЉE܉uHxGHO WȃsE܋;rKEH#‰]؍;sCSE0MEMԅt!UE܉]؋E ;Mti=O+EuÃ,_^[UWVS[[^_UWVS[[^_;Zx0N<[y1O$tI "(54#A4+7U":57C45 F A:7 B:=( C+#BUK==K 88 Z FZ 8{DIOz969}66DO}96++}6P-I----------et1111111111QP<eeQ%%%s<<<<%%%%%%%%%%<`<V%%%%%%HV6Qa`6aa`kk%%%%%''''''''''aHlk''''''iH;Vt;aH{;{''''')));tx;txxxx{{))))))))))~~a))))))juj~juu`))))),,,,,,,,,,jju,,,,,,zzzzzzzB^Bjju\,,,,,??G4????????????????????????????????????????????????????????????????????????????GGGGGGGGGG30GGGGGGHHdddddGGGGGJJJJJdJ8 8dJJJJJJJJJJdJJJJJJdhhhhhxJJJJJJRRRRRR|h||||||hRRRRRRRRRRhyRRRRRRhxRRRRRRTTTTT:y:TTTTTTTTTTTTTTTTTTTTTTWWWWWW pWWWWWWWWWWWWWWWWfffffWWWWWW[  [[[[pff[[[[ [[[[ff[[[[[[[[]]]]]]]]]]]]]]]]MM"#]]]]]__________"#'______({l_lol/xoooo'_____(l&_l&s&/ossssolloXsok1sysXyyyyyyyjXsyygs1swwwwwbyYyYwwwwwwwwwwIsIswwwwwwaa_I_Iwwwwwwas_VSsel eR    ellqZZqrZr      !*!*!*zzz$$$$$>>>.d....%%%%%ccbAAAc     dd3333344444d bb 55555 b;;;;;`[[`m`[[`mf-----mm'66666YgfgF'gFFFFf--gfg<<<<<-YYY=====]]]]gkg]kkkkiGiGGGGGGGGGDDDDD\GG\\\\D\HHHHHHH\DD\JJJJJJJ77UUUUUutU!qoUU!*"0"0'2I*2IX?'J??EEEEEEEEEEJNOEEEEEEnhXrLLLLLNOEEEEEKKKKKMMMMMhNNNNNfKLKKKKaLOOOOOr_LLKLM[hKNMhMNZRhKNRRMQSOhWQNMhNOOPPPPP^////OSQQQQQORRRRRDVVVVVCWWWWWPPL^LTQP^Q^=VPPQj^RViTQR<^Q%R^9%W%VViWiRiVWiRSSSSSj8^W3`iWijjj71jF7c7n`Scnnnnfj;jSf;F;nSFS|S||S-S,nSnSTTTTTh)ThTTTT'vvvvvTv3&3vvmmvmTTuuuuuuuuuu]]]]uuuuuuvuuuuuwwwwww44ww{{{{{w{{{{eeee{w#####{|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||}}}}}$$$$$@}}}}}}}}}}}}}}}}@}}}}}@@(((((4444455555~oCB@?9720,+)@@66666  @:::::AAA      1H (1H(.....JJKKKKK>>>>>          .(      LLLLLU.>]Uj.]j          > > m  m PPPPPvrqpQQQQQnmig UUUUUEEEEEVVVVVcb^\YSEbbbbbcccccNM@EEdddddjjjjj>30.*&!kkkkklllllppppp|| \\\\\\\yyyyyyyy\vvvvvyyvvv{{{{{{}}}}}{{{{}}}~~~~~xxxxxxxxxxxxxxxx~xxxxx~~*****------5555555BBBBBBCCCCCC            ((((()))))*****             ...../////()*00000       .      ./.MMMMMTTTTT0TTTM                                                                                  1111199999199988888:::::88:iiiii_____8ii8:_i:_;;;;;<<<<<=====>>>>>?????DDDDDEEEEE;<=>?DDEFFFFFDGGGGGHHHHHIIIIIJJJJJNNNNNFOOOOO           G NHIJNNO !!!!!!!!!!!!WWWWWyyyyyWWWyyy!"""""""""""W""#############$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%&&&&&&&&&&&&&&&&&&&&&&&&&&&&&+++++++++++++++++++++++++++222222222222222222222UUUUUUUUUUUUUXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYYYYYYYYYYYYZZZZZZZZZZZZZ[[[[[[[[[[[[[\\\\\\\\\\\\$$$$$\]]]]]]]]]]]$]]^^^^^^^^^^^^^____________!!!!"""!""_``````````````````````!``````"``````aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaddddddddddddddddddddddddddddeeeeeeeeeeeeeeee%%%eeeeee%%%eeeeeellllllllllll)))%+++))++---+...--..lmmmmmmmmmmm)m+22222KKKK-22.K2LLLLLmnnnnnnnnnnnnIIIIIKIIILnoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooppppppppppppMMMMPPPMPPQQQRRRQQRRpqqqqqqqqqqqMqPQRqrrrrrrrrrrrrrssssssssssssstttttttttttttuuuuuuuuuuuuuvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvzzzzzzzzzzzzz|||||||||||||}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~                                                                                                                                                                                                                         #############################&&&&&&&&&&&&&&&&&&&&&&&&&,,,,,,,,,,,,,,,,,,,,,,,,,,,,,/////////////////////////////5555555555555666666666666677777777777778888888888888888888888888888888888888888888888888888888888888888888888888888888889999999999999:::::::::::::;;;;;;;;;;;;;<<<<<<<<<<<<<=============>>>>>>>>>>>>>??????????????????????????????????AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAABBBBBBBBBBBBBCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDEEEEEEEEEEEEEFFFFFFFFFFFFFNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOOOOOOOOOOOOOOOOOOOOOOOOOOOOSSSSSSSSSSSSSSSSSSSSSTTTTTTTTTTTTTTTTTTTTTVVVVVVVVVVVVVWWWWWWWWWWWWWXXXXXXXXXXXXXXXXXXXXXYYYYYYYYYYYYYYYYYYYYYZZZZZZZZZZZZZZZZZZZZZ[[[[[[[[[[[[[[[[[[[[[bbbbbbbbbbbbbbbbbbbbbcccccccccccccccccccccdddddddddddddddddddddeeeeeeeeeeeeeeeeeeeeefffffffffffffffffffffggggggggggggggggggggghhhhhhhhhhhhhhhhhhhhhnnnnnnnnnnnnnnnnnnnnnooooooooooooooooooooopppppppppppppppppppppqqqqqqqqqqqqqqqqqqqqqrrrrrrrrrrrrrrrrrrrrruuuuuuuuuuuuuuuuuuuuuvvvvvvvvvvvvvvvvvvvvvwwwwwwwwwwwwwwwwwwwwwxxxxxxxxxxxxxxxxxxxxxyyyyyyyyyyyyyyyyyyyyy}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~                                                $$*EO$`^ $_Ee$Okaf!^` E,l3e)G%kt)!"----------G%)ut(""/ghZG012222222222"Sg|3345637893:3;33<=>3333?33456789:3;33<=>3333AE3EB'HCiDbjecAdfBCiDb<H=ec$GG----------HJJJJJJJJJJE|JJJJJJ----------#%p$JJJJJ##Q$$Hq rsGGpRRRRRRRRRRqr(RRRRRRE$<%=()%RRRRRTTTTTTTTTTsTTTTTTjGm)nvoTTTTT((VmnWWWWWWWWWWghmiWWWWWWjP]$gicWWWWWJJJJJJJJJJqJJJJJJjq%]JJJJJvv]Uvvvvvvvvvvvvvvvwxxxyz{|xxvvvvxxxxxx}~vvvvvvvvvxxxxx}~vvvvvvvvvvv11ktUJl$kutIIIIE 1)1 sQ$GPP $s$p!"q#rsp%%SSSSq r  %35rI3*t+,E r5'UUtV.W$/012oVWGABC]E)xxxxx]mnvvvovvvvvmGnvvvvvvvv6789:FFFFF]]>?@^v]_h^hvvvvcSTUFFFF&ghe'(f]g eSTUFFFF) kt)ooopol#kut#F`$a]F`$4h4hf6cQ]]]]^]Q6QbcGdbccGFiKLMFNOPjaPQRNiiNQjRiKghgKMMEFFFGHIJFFHLFFFFFFZZZ[Z_HZLFFFFFXXXYX___`_FaaabaPF\]FFFF'\`QcccdceFaBlPf\C^Da'\\U`Qe_De\feeefe^ghk\tlUe\iD\ggghg9jegut \i%!k"&'\eeefe9lXkmmk\8nnooFl8mmkk]nniiijilF^V5]kggghg_]5vvvvvbx]^kyVz{\q0rbs+kkb,l-m\cnd0qorlllmlb|dmcnF..HFFFFIJdn]un)))*)-uuuuuuuuuu-uuuuuuIJuuuuu}}}}}}}}}}xxxx}}}}}}/+,0123(}}}}}xxxxooopo7;]8<9=])FM]]6N7OFWxxxxRST]qZZZ[ZWWWXWXXXYX]]]^]g___`_\aaabaY]aZ[I^mJ\bnom_\cndeo^fbQ\m] \cneghcccdc]\eeefegWWWXW]ggghgeeefe@Aggghg\isb(tkuj]c\d^_`a\ilibmkpknc\omlqnrmskopniiijipm qnrqKrLspcqr\qrs???@?\)qrlllml)h]A*vvvvvvxyzvA*{vpu                Q|/epfghi]          /z      ]]jjz qqqrq]]|xxxxc|   IIIIc\?\]]1}~x<wE;1PP$<w;23E4=>>>}~x)))*)=>%SSSS?xxxx:&:]?]55&&&&&&&&&&&&&&&&'&&&&&&&&&&&&&&&..(&UU$(xxxx ]BCKooopoBC)]xE]]]^]XXXYX]xExxxxyz{|xxxxxxxxxxxxZZZ[Zb___`_^cdxxxxx_baaaba^cG]cccdc\eeefe\ae(Gf]\\\egh\ik]\\jggghglg\ikv\lllmleeefeD(Dggghg]]mxxxxn];;]oxxxxx]mk niiiji4umlxn4k-o     H-]mIzn1H]v_P\q]r]sI]\???@?q]r1 G]j _]_     ]]GHz ]     ]]]]z ]]]]|  WWWXWWWWXW]]]|]Z']][ZX'NqqqrqMLK@.|_'     z      z      z|      |z ||zooopo |   IIIIPP$XXXYXPP%$)))*)^_]]]^]^%bcccdccdUUb$cijaaabai)___`_ZZZ[Zghgeeeefefaeggghgiiijilllmlkeeefelggghgkmnoqrsk%munlqrmknom&n???@?        z :|:WWWXWWWWXWqqqrqvvvvXXXYXZZZ[ZcccdclllmlO`]^tO_ia`^juti    !"    #$$$$$$$$$$    $$$$$$                %$$$$$                   )))*)zeeefe &&&&&&&&&&(&&&&&&k|&&&&&IIIIlkFFFFFFFFFF(FFFFFFaaabaWWWXWFFFFF&&&&&&&&&&(&&&&&&ooopoWWWXWgh&&&&&(((((((((((g((((((]]]^]___`_](((((((((((((((((((((bggghgcde(((((fbiiijiceeeefemnopggghgmnqrkspvvvvvvvvlqrkmnovvvvmnvvvv] QRiiiiijhk]   vvvvvxyz{ STTTTTSSSV |W]]]X Y ]qqqrq]( Z[[\Z\\\ZZ]^\\\\_``````````\\\\``````\\\\\\\\\\\\\\\\a`````\\\\\\\\\\\\\\\\\\\ddddddddddddddddddddd]eeeeeeeeeeeeeeee???@?eeeeegiiiii(gggjm;niiiii_____jh;kklopqiiiqrprrrppstrrrruvvvvvvvvvvrrrrvvvvvvrrrrrrrrrrrrrrrrwvvvvvrrrrrrrrrrrrrrrrrrrxyyyyyxxx{|}]SSS]]]]]]]]]]])))*)     z ]???@?|WWWXWWWWXWqqqrq%]]]]&~    !"    #$$$$$$$$$$    $$$$$$                %$$$$$                   z |(((((((((SSS((((((]((((( Q   z Q   |    SSS       %'SSS(   & 2222231SSS4 STTTTTSSSV WX Y SSS [[[[    Z[[\Z\\\ZZ]^\\\\_``````````\\\\``````\\\\\\\\\\\\\\\\a`````\\\\\\\\\\\\\\\\\\\SSS%giiiiigggjmnSSS%%om&22222314giiiiigggjnIIIII`caopqiiiqrprrrppstrrrruvvvvvvvvvvrrrrvvvvvvrrrrrrrrrrrrrrrrwvvvvvrrrrrrrrrrrrrrrrrrrgiiiiigggjmn)%%ogiiiiigggjmn&&ogiiiiigggjmnogiiiiigggjmnomgiiiiigggjnogqqqqgggjmno Y ~z |(((((((((((((((](((((STTTTTSSSVWXSTTTTTSSSVWX Y  [    [[[[       xyyyyyxxx{|}giqiiigggjmnogqqqqgggjmno   ~z |STTTTTSSSVWXSTTTTTSSSVWX[[[[    gqqqqlglllggjmllllnllllllllllllllllllllolllllllllllllllllllxyyyyyxxx{|}                        ~[[[[                                                                        !"!#####################$$*+,,,,,,,,,,,,,,,,,,,,,-.-/////////////////////02222200036789:222:;9;;;99<=;;;;>??????????;;;;??????;;;;;;;;;;;;;;;;@?????;;;;;;;;;;;;;;;;;;;AAAAAAAAAAAAAAAAAAAAA~BBBBBBBBBBBBBBBBBBBBBCCCCCCCCCCCCCCCCCCCCCDDDDDDDDDDDDDDDDDDDDD[[[[           EEEEEEEEEE    EEEEEE                 EEEEE                   FFFFFFFFFFFFFFFFFFFFF                     LMLNNNNNNNNNNNNNNNNNNNNN!"!OOOOOOOOOOOOOOOOOOOOO$$*+,,,,,,,,,,,,,,,,,,,,,Q))RQ%SSSSSSSSSSSSSSSS&SSSSS-.-TTTTTTTTTTTTTTTTTTTTT022222000367860222220003V789:222:;9;;;99<=;;;;>??????????;;;;??????;;;;;;;;;;;;;;;;@?????;;;;;;;;;;;;;;;;;;;022222000367802222200036780222220003678022222000367860222220003V780:::W:000367XXXXXXXXXXXXXXXX8XXXXXYYYYYYYYYYYYYYYYYYYYY~ZZZZZZZZZZZZZZZZZZZZZ[[[[[[[[[[[[[[[[[[[[[[[[[    gqqqqgggjmnoLMLbbbbbbbbbbbbbbbbbbbbb!"!cccccccccccccccccccccdddddddddddddddddddddeeeeeeeeeeeeeeeeeeeeexyyyyyxxx{6|}02:2220003678fffffffffffffffffffffggggggggggggggggggggghhhhhhhhhhhhhhhhhhhhhnnnnnnnnnnnnnnnnnnnnnooooooooooooooooooooopppppppppppppppppppppqqqqqqqqqqqqqqqqqqqqqrrrrrrrrrrrrrrrrrrrrruuuuuuuuuuuuuuuuuuuuuvvvvvvvvvvvvvvvvvvvvvwwwwwwwwwwwwwwwwwwwwwxxxxxxxxxxxxxxxxxxxxxyyyyyyyyyyyyyyyyyyyyy}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~$$$$$$$$$$$$$$$$$$$$$555555555555555555555########&&&((((((((++FFFFIIIIIIIIPPPPPPPPPSSSSSSSSUUUUUUUUUYYYYYYYYY\\\wwwwwww~~~~~~~~~        ~~~~~~~~~#########(((((((((         wwwwwwUUUUUUUUUbbbbbbbbbggggggggglllllllllzzzzzzzzzSSSSSSSSS         UUUUUUUUUbbbbbbbbb         xxxxxxxxxggggggggglllllllll\\\\\SSSSSSSSSUUUUUUUUU         xxxxxxxxxzzzzzzzzzlllllllllwwwwww\\\\\SSSSSSSSSUUUUUUUUU         xxxxxxxxxzzzzzzzzz         wwwwww$$$$$$$$$)))))))))000000000555555555GGGGGGGGG        $$$$$$$$$)))))))))000000000555555555         lllllllll\\\\\\\\\^^^^^^^^^bbbbbbbbbGGGGGGGGGxxxxxxxxxzzzzzzzzziiiiiiiiitttttttttzzzzzzzzz{{{{{{{{{?_________wwwywJJRTWw____wJJREEEGEEKKKKKKKKETTKEEEuEuuxxxxxxxxxxxxxxxxxxxxxuu+++222++++++++++o               8 ,/ ?ACDNOST?A[NOST?NOST?NS? pCPUhT QpCpCL pCRpC pCpC pCpC} 3gpCQU {Wl f } pCH )G 9@AsNy&lF X F]TpCw\mpCpCZ Y F# ipPpCL z!  Hk  vk  P   W-Sm[  >'(9 HQL< k  h c d ,I j u l p) } D t E < \ [ e9 2 1 dM K K4<$,>\opC{;e@ ? H8 H =\(~(    k z  79   .c / xt  }   i  4aORy U   3UNjun 7 Fc t _ypC  pC I  4  c l+> oT G @H G 3      3 3N " <^ T1  e }  0     M # ( -    2  7 k &   = T Y b Y _ L QpC Y 1 m  /m$aA 0  {  ~ U C h ! \ D / O m ,  2  : N l G [\ '  5 ? TP ! < \ a s  sx q ^( Fx $R< cpCQpC}^ % _BV{=z t V~?+  Ko T}!|}_ Y  ` a +R<5 . 0UZV_dmT rJ#8F\sx[6-O, P' ($#SO3l\ 7B-2Ea ig>C F  Fbglq kw~pCq)b FPg Fq F j>03l/hQMpC  b F > w !:!s!!!"W"""#X##t# $I$ $$$m9 U02%k%%%L.&g&&&'K''''K(n (((&p <9)r)))5*n***+R+++ ,C,, ,C( -TE----3.u. ./G//\/|/b;0"w00$0+1d112D222#3 (Y1_3`x.} m334  *R44m l45?5x556;6t6667]7778888 F "879a99 9:':Q:{::  o::#;M;w;;; pC ;.>7>:>>>G>P>Y>b>k>n>w>>>>>>>>>>>>>>>>???!?*?3?(?@A,BCDEFG,HIJK,,L,MNO PQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ+)) )  )))%) ) )))   %$%########### (   ###!################  #####################!###"################################## ## (  ###########################!!######"##################################### ########################  '  ###################################!!!!######""######################################### #### '  #################################!!######""""#################################### #### &'  ##########################!!#####""############################ #### '''############!!##""####'''''###""'''''''&'&'''''& @  );Ok[WQ /?!"i,9Ka~j e7 CA f!*7H}P^zKd5U_ %/^k=OG[)6FI\( QK55>n)#5Fu[m@?t l d \ H @ 8     ȳ   L      <    ,    | 0 D  D ̴ |   ȴ   |  @x  h  |X P D  8  (   ش   |    D        H  ܳ   |  |  |  D Դ | г `  x  l  `  T  DH  D< $ D  D4  ,        D  D  D ( D  D س      Գ `  x  p  |  \  P p |D ܴ |4  D  |,  D  |        ,     |      D  D  D  | p  d  |T Ĵ @H 4 4  ( < D < D 8 D   x  д | X  @      D ̳     D  t `d  P  H l <  |0    (       ij                D p   Th \ \ d aD ANDISGaEpBI? eta %sBX@= ףp#@ A?A?333333?@@@Gz?(knNMbP??zD?ffffff?X@= ףp#@D:>?456789:;<=  !"#$%&'()*+,-./0123ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/: A$tI(knNfffff#@ffffff?MbP?Mb@?KGS!@#$%P- - x- t- H- l- d- @- Unknown error %dfd >= 0%s (%s)conaddr is: %s Closed fd %d Accepted client at socket %d. binding to address %s using port %i. Local socket fd %d bound. %s: unable to resolve host address %s failed: %s. Created socket %d. connected. connect.csock >= 0Failed setting IPV6_V6ONLY: %sConnecting to %s:%d... Connecting to %s|%s|:%d... %s: unable to resolve bind address %s; disabling bind. ../nothing to do. convert.cfile != NULL/index.html?#%;%d; URL=%sCannot back up %s as %s: %s .origorig%d-%d TO_COMPLETE: to %s at position %d in %s. TO_RELATIVE: %s to %s at position %d in %s. Skipping %s at position %d. Something strange is going on. Please investigate.wbUnable to delete %s: %s Cannot convert links in %s: %s Converting %s... Converted %d files in %s seconds. will convert url %s to complete will convert url %s to local %s Scanning %s (from %s) Apparently %s has been removed. :%d%lfmax-ageexpiressessionDone saving cookies. Error closing %s: %s Error writing to %s: %s FALSE %s %s %s %.0f %s %s # Edit at your own risk. # Generated by Wget on %s. # HTTP cookie file. wSaving cookies to %s. TRUECannot open cookies file %s: %s rpos == result_sizeocnt == countAttempt to fake the path: %s, %s Cookie coming from %s attempted to set domain to %s 8 7.int.mil.gov.org.net.edu.com 6 5 4 3 2cdm: 1Syntax error in Set-Cookie: %s at position %d. pathdomainDiscarded old cookie. cookies.cres != 0noneinsecuresecurepermanent (ANY) Stored cookie %s %d%s %s <%s> <%s> [expiry %s] %s %s Deleted old cookie (to be replaced.) ../%s %s: %s done. Wrote HTML-ized index to %s. Wrote HTML-ized index to %s [%s]. No matches on pattern %s. Error matching %s against %s: %s Rejecting %s. Not descending to %s as it is excluded/not-included. odir = '%s' f->name = '%s' newdir = '%s' Composing new CWD relative to the initial directory. %s/%s%s%sWill not retrieve dirs since depth is %d (max %d). %s: corrupt time-stamp. Unrecognized permissions for %s. %s: unknown/unsupported file type. Skipping directory %s. symlink: %s Creating symlink %s -> %s Already have correct symlink %s -> %s Invalid name of the symlink, skipping. The sizes do not match (local %s) -- retrieving. Remote file is newer than local file %s -- retrieving. Remote file no newer than local file %s -- not retrieving. f != NULLRecursion depth %d exceeded max. depth %d. Removed %s. Using %s as listing tmp file. .listingunlink: %s Removing %s. Removing file due to --delete-after in ftp_loop_internal(): %s URL: %s [%s] -> "%s" [%d] %s (%s) - %s saved [%s] %s (%s) - written to stdout %s[%s] --%s-- %s %s => %s (try:%2d) File %s already there; not retrieving. rData transfer aborted. Control connection closed. %s (%s) - %s (%s) - Data connection: %s; %s: %s, closing control connection. %s has sprung into existence. wbabaccept: %s Lying FTP server found, adjusting. .No such file or directory %s. ==> LIST ... No such file %s. ==> RETR %s ... No such file %s. File %s exists. REST failed, starting from scratch. ==> REST %s ... Invalid PORT. Bind error (%s). socket: %s couldn't connect to %s port %d: %s trying to connect to %s port %d Cannot parse PASV response. Cannot initiate PASV transfer. File has already been retrieved. ==> SIZE %s ... ==> CWD not required. No such directory %s. ==> CWD (%d) %s ... []Using extra "CWD []" step for VMS server. Using two-step CWD for relative path. pwd: '%s' old: '%s' new: '%s' Prepended initial PWD to relative path: changing working directory ==> CWD not needed. Unknown type `%c', closing control connection. ==> TYPE %c ... done. /==> PWD ... done. Server error, can't determine system type. ==> SYST ... Logged in! Login incorrect. The server refuses login. Write failed, closing control connection. Error in server greeting. Error in server response, closing control connection. Logging in as %s ... @-wget@anonymous(cmd & (DO_LIST | DO_CWD | DO_RETR | DO_LOGIN)) != 0!((cmd & DO_LIST) && (cmd & DO_RETR))con->target != NULLftp.ccon != NULL (unauthoritative) , %s remaining, %s (%s) remaining (%s)Length: %s==> LPRT ... ==> EPRT ... ==> PORT ... ==> LPSV ... ==> EPSV ... ==> PASV ... byte%s bad buffer in yy_scan_bytes()out of dynamic memory in yy_scan_bytes()out of dynamic memory in yy_scan_buffer()out of dynamic memory in yyensure_buffer_stack()out of dynamic memory in yy_create_buffer()out of dynamic memory in yy_get_next_buffer()input in flex scanner failedfatal error - scanner input buffer overflowfatal flex scanner internal error--end of buffer missedfatal flex scanner internal error--no action foundURIEXSEMSCDCCDO%s: %s INVALIDGREATERLoaded %s (size %s). Found URI: [%s] at %d [%s] Found @import: [%s] at %d [%s] url(FUNCTIONNUMBERPERCENTAGEDIMENSIONFREQTIMEANGLELENGTHIMPORTANT_SYMCHARSET_SYMMEDIA_SYMPAGE_SYMIMPORT_SYMHASHIDENTSTRINGCOMMAPLUSLBRACEDASHMATCHINCLUDESSCSSEOFPWDVMSCWD%s LIST -aaf == 6--> %s respline is %s buflen >= 6 * 4type=SIZE"OS/400MACOSWINDOWS2000WINDOWS_NTUNIXSYSTLISTRETRRESTTYPErespline != NULL21EPSVip != NULL*port is: %d tmpprt[1] is: %d tmpprt[0] is: %d lpsv addr is: %s s != NULLLPSVPASVport != NULLaddr != NULLEPRT|%d|%s|%d|buflen >= 4 + INET6_ADDRSTRLEN + 1 + 5LPRTaddr.family == AF_INET || addr.family == AF_INET6%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d%d,%d,%d,%d,%d,%d,%d,%d,%dbuflen >= 21 * 4PORTaddr.family == AF_INET%d,%d,%d,%d,%d,%dftp-basic.caddr->family == AF_INET331 opiekey 331 s/key USER --> %s --> PASS Turtle Power! PASS Detected newlines in %s "%s"; changing to %s "%s" %s DecNovOctSepAugJulJunMayAprMarFebJan Owner. %s: %s Directory (nv) Timestamp: %ld (nil)-> %s (%s bytes) ">%s%s @wbUnsupported listing type, trying Unix listing parser. Time differential = %d. WGET_TIMEZONE_DIFFERENTIAL%d-%b-%Y %H:%M:%SIgnored (size?). Prot. perms = %0o. Date time: >%s< Time. Date. Token: >%s<: Null token. Leaving listing parser. Non-blank in column 1. Must be a new file name? Blank line. Leaving listing parser. EOF. Leaving listing parser. Getting additional line. File Directory (v) .DIR;1.DIRfile name-^: '%s' file name: '%s' Total of rFile, size %s bytes Directory YYYY/MM/DD HH:MM - %d/%02d/%02d %02d:%02d M:-Name: '%s' Skipping. trailing `*' on exec. trailing `@' on link. trailing `/' on dir. Ignoring `.' and `..'; ...link to: %s -> time: %02d:%02d:%02d (no yr); year: %d (no tm); day: %d; month: %s; size: %s; perms %0o; implicit perms %0o; UNKNOWN; SYMLINK; DIRECTORY; PLAINFILE; totalrb %s%s (%s)u->host != NULLal->refcount == 1, ..., failed: No IPv4/IPv6 addresses for host. failed: %s. Resolving %s... Caching %s =>Found %s in host_name_addresses_map (%p) Deleting unused 0x%0*lx. Releasing 0x%0*lx (new refcount %d). ip - al->addresses == cntindex == al->faultyhost.cpos >= al->faulty && pos < al->countch == '-'ch == quote_charch == '\'' || ch == 0x22html-parse.cto - (pool->contents + pool->tail) <= end - begrelsrcimgfig%s: %s , refreshcontentoverlaybgsound%s: Invalid URL %s: %s no-follow in %s: %d Loaded %s (size %s). nofollow nonerobotscontent-typetext/htmlshortcut iconstylesheethtml-url.cfirst != -1appending %s to urlpos. %s: merged link "%s" doesn't parse. %s: merge(%s, %s) -> %s %s: link "%s" doesn't parse. %s: Cannot resolve incomplete link %s. %s: no base, merge will use "%s". 1styleactionnamehttp-equivtypedatalowsrcbackgroundcodehrefthtdtablescriptobjectmetalinklayerinputiframeframeformembedbodybaseareaappleta%d */*GET%s: %s ignoredchunked%2d %s CONNECT[%s]:%dReferer%a, %d-%b-%Y %T%A, %d-%b-%y %T%a, %d %b %Y %T--%s-- %s %s Location: %s%s Reusing fd %d. .%d%sDigest", opaque="Digest username="%s", realm="%s", nonce="%s", uri="%s", response="%s":nonceopaquerealm0123456789abcdefBasic %s:%sC%a %b %d %T %Y%s (%s) - Read error at byte %s/%s (%s). %s (%s) - Read error at byte %s (%s).%s (%s) - Connection closed at byte %s. %s URL:%s [%s] -> "%s" [%d] %s (%s) - %s saved [%s] %s (%s) - written to stdout %s[%s] %s URL:%s [%s/%s] -> "%s" [%d] %s (%s) - %s saved [%s/%s] %s (%s) - written to stdout %s[%s/%s] %s URL: %s %2d %s Remote file exists. Remote file exists and could contain further links, but recursion is disabled -- not retrieving. Remote file exists but does not contain any link -- not retrieving. Remote file exists and could contain links to other resources -- retrieving. Remote file is newer, retrieving. The sizes do not match (local %s) -- retrieving. Server file no newer than local file %s -- not retrieving. Last-modified header invalid -- time-stamp ignored. Last-modified header missing -- time-stamps turned off. Remote file does not exist -- broken link!!! %s: ERROR: Redirection (%d) without location. Cannot unlink %s (%s). Unable to establish SSL connection. Cannot write to %s (%s). --%s-- %s (try:%2d)Spider mode enabled. Check if remote file exists. Warning: wildcards not supported in HTTP. local_file == NULL || *local_file == NULLSTDOUTSaving to: %s %s has sprung into existence. wbab [%s] , %s remaining, %s (%s) remaining (%s)Length: The file is already fully retrieved; nothing to do. .css.htmltext/cssapplication/xhtml+xmltext/html [following]unspecifiedContent-RangeLast-ModifiedLocation(no description).origParsed filename from Content-Disposition: %s Content-DispositionAuthorization failed. NTLMBasicUnknown authentication scheme. WWW-AuthenticateSet-Cookiewget_cookie_jar != NULLTransfer-Encoding Ignoring response ---response begin--- %s---response end--- Read error (%s) in headers. No data received. Proxy%s request sent, awaiting response... [POST data: %s] ?Proxy tunneling failed: %sMalformed status line%s ERROR %d: %s. proxy responded with: [%s] Failed reading proxy response: %s %s: unable to resolve host address %s Reusing existing connection to %s:%d. Proxy-AuthorizationCookieContent-LengthPOST data file %s missing: %s application/x-www-form-urlencodedContent-TypeProxy-ConnectionKeep-AliveCloseConnectionHost%s:%d[%s]%sAcceptsolaris2.10Wget/%s (%s)User-Agentbytes=%s-Rangeno-cachePragmano-cache, must-revalidateCache-ControlPOSTHEADDisabling SSL due to encountered errors. File %s already there; not retrieving. Registered socket %d for persistent reuse. Disabling further reuse of socket %d. filename] done. %.*sEOF received] aborting (%s). Skipping %s bytes of body: [contlen != -1 || contlenbytes%s%s No headers, assuming HTTP/0.9HTTPdone] written == promised_sizerb[writing POST file %s ... Inserted %s into basic_authed_hosts AuthorizationHost %s has not issued a general basic challenge. Found %s in basic_authed_hosts. Auth-without-challenge set, sending Basic credentials. Failed writing HTTP request: %s. ---request begin--- %s---request end--- http.cp - request_string == sizeHTTP/1.1 derpeminfiriwindowsverbosetimeoutreferernoproxylogfilehtmlifyftpuseregdfiledomainscutdirscookiesbackupscertificatetypebackupconvertedauthnochallengeadjustextensiontlsv1sslv3sslv2auto%s: %s: Invalid restriction %s, use [unix|windows],[lowercase|uppercase],[nocontrol],[ascii]. asciinocontroluppercaselowercaseunix%s: %s: Invalid progress type %s. noneIPv6IPv4%s: %s: Invalid header %s. %s: %s: Invalid value %s. asn1%s: %s: Invalid time period %s %s: %s: Invalid byte value %s %s: %s: Invalid number %s. %s: %s: Invalid boolean %s; use `on' or `off'. %s: Invalid --execute command %s val != NULL/Setting %s (%s) to %s init.c0 <= comind && ((size_t) comind) < countof (commands)%s: Warning: Both system and user wgetrc point to %s. Parsing system wgetrc file failed, please check '%s'. Or specify a different file using --config /usr/local/etc/wgetrcSYSTEM_WGETRC%s: Unknown command %s in %s at line %d. %s: Syntax error in %s at line %d. %s: Error in %s at line %d. %s: Cannot read %s (%s). r%s/.wgetrc%s: WGETRC points to %s, which doesn't exist. WGETRCHOMEno_proxywaitretrywaituseservertimestampsuseragentuseruseproxyunlinktrustservernamestriestimestampingstrictcommentsspiderspanhostsshowalldnsentriesserverresponsesecureprotocolsaveheaderssavecookiesrobotsretryconnrefusedretrsymlinksrestrictfilenamesremovelistingremoteencodingrelativeonlyrejectrecursivereclevelreadtimeoutrandomwaitrandomfilequotaquietproxyuserproxypasswordproxypasswdprotocoldirectoriesprogressprivatekeytypeprivatekeypreservepermissionspreferfamilypostfilepostdatapasswordpasswdpassiveftppagerequisitesoutputdocumentnumtriesnoparentnoclobbernetrcmirrormaxredirectloginlocalencodingloadcookieslimitratekeepsessioncookiesinputinet6onlyinet4onlyincludedirectoriesignoretagsignorelengthignorecasehttpuserhttpsproxyhttpproxyhttppasswordhttppasswdhttpkeepalivehtmlextensionheaderglobftpproxyftppasswordftppasswdforcehtmlfollowtagsfollowftpexcludedomainsexcludedirectoriesdotstyledotspacingdotsinlinedotbytesdnstimeoutdnscachedirstructdirprefixdeleteafterdefaultpagedebugconvertlinkscontinuecontentdispositionconnecttimeoutchooseconfigcheckcertificatecertificatecadirectorycachecacertificatebindaddressbasebackgroundaskpasswordalwaysrestaddhostdiraccept%s: %s; disabling logging. %s received. %s received, redirecting output to %s. wget-loglog.cbase == 8 || base == 160123456789ABCDEF%s: %s: %s wa%s %s %ssiriSIGUSR1%dm %dsversionverbosetimeoutrefererlogfilehtmlifyftpuserexecuteegdfiledomainscutdirscookiesclobberbackups%dd %dh %dm %dsstrict-commentsserver-responsesecure-protocolremote-encodingpage-requisitesoutput-documenthttp-keep-aliveexclude-domainsconnect-timeoutcertificatetypebackupconvertedauthnochallengeadjustextensionWTF?!SIGHUPDownload quota of %s EXCEEDED! FINISHED --%s-- Total wall clock time: %s Downloaded: %d files, %s in %s (%s) No URLs found in %s. unlink: %s Removing %s. Removing file due to --delete-after in main(): %s: %s. -k can be used together with -O only if outputting to a regular file. wbabDEBUG output created by Wget %s on %s. This version does not have support for IRIs %s: missing URL Cannot specify both --ask-password and --password. File `%s' already there; not retrieving. WARNING: timestamping does nothing in combination with -O. See the manual for details. WARNING: combining -O with -r or -p will mean that all downloaded content will be placed in the single file you specified. Cannot specify both -k and -O if multiple URLs are given, or in combination with -p or -r. See the manual for details. Cannot specify both --inet4-only and --inet6-only. Can't timestamp and not clobber old files at the same time. Can't be verbose and quiet at the same time. Both --no-clobber and --convert-links were specified,only --convert-links will be used. %s: illegal option -- `-n%c' 10Try `%s --help' for more options. Exiting due to error in %s Please send bug reports and questions to . Originally written by Hrvoje Niksic . License GPLv3+: GNU GPL version 3 or later . This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. Copyright (C) 2009 Free Software Foundation, Inc. /usr/local/etc/wgetrc %s (system) %s (user) %s (env) solaris2.10GNU Wget %s built on %s. Link: Compile: Locale: Wgetrc: %*c %sline != NULLprefix != NULLPassword: Password for user %s: %dh %dm %dsGNU Wget %s, a non-interactive network retriever. Mail bug reports and suggestions to . -np, --no-parent don't ascend to the parent directory. -X, --exclude-directories=LIST list of excluded directories. --trust-server-names use the name specified by the redirection url last component. -I, --include-directories=LIST list of allowed directories. -L, --relative follow relative links only. -H, --span-hosts go to foreign hosts when recursive. --ignore-tags=LIST comma-separated list of ignored HTML tags. --follow-tags=LIST comma-separated list of followed HTML tags. --follow-ftp follow FTP links from HTML documents. --exclude-domains=LIST comma-separated list of rejected domains. -D, --domains=LIST comma-separated list of accepted domains. -R, --reject=LIST comma-separated list of rejected extensions. -A, --accept=LIST comma-separated list of accepted extensions. Recursive accept/reject: --strict-comments turn on strict (SGML) handling of HTML comments. -p, --page-requisites get all images, etc. needed to display HTML page. -m, --mirror shortcut for -N -r -l inf --no-remove-listing. -K, --backup-converted before converting file X, back up as X.orig. -k, --convert-links make links in downloaded HTML or CSS point to local files. --delete-after delete files locally after downloading them. -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite). -r, --recursive specify recursive download. Recursive download: --retr-symlinks when recursing, get linked-to files (not dir). --no-passive-ftp disable the "passive" transfer mode. --no-glob turn off FTP file name globbing. --no-remove-listing don't remove `.listing' files. --ftp-password=PASS set ftp password to PASS. --ftp-user=USER set ftp user to USER. FTP options: --egd-file=FILE file naming the EGD socket with random data. --random-file=FILE file with random data for seeding the SSL PRNG. --ca-directory=DIR directory where hash list of CA's is stored. --ca-certificate=FILE file with the bundle of CA's. --private-key-type=TYPE private key type, PEM or DER. --private-key=FILE private key file. --certificate-type=TYPE client certificate type, PEM or DER. --certificate=FILE client certificate file. --no-check-certificate don't validate the server's certificate. --secure-protocol=PR choose secure protocol, one of auto, SSLv2, SSLv3, and TLSv1. HTTPS (SSL/TLS) options: --auth-no-challenge send Basic HTTP authentication information without first waiting for the server's challenge. --content-disposition honor the Content-Disposition header when choosing local file names (EXPERIMENTAL). --post-file=FILE use the POST method; send contents of FILE. --post-data=STRING use the POST method; send STRING as the data. --keep-session-cookies load and save session (non-permanent) cookies. --save-cookies=FILE save cookies to FILE after session. --load-cookies=FILE load cookies from FILE before session. --no-cookies don't use cookies. --no-http-keep-alive disable HTTP keep-alive (persistent connections). -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION. --save-headers save the HTTP headers to file. --referer=URL include `Referer: URL' header in HTTP request. --proxy-password=PASS set PASS as proxy password. --proxy-user=USER set USER as proxy username. --max-redirect maximum redirections allowed per page. --header=STRING insert STRING among the headers. --ignore-length ignore `Content-Length' header field. -E, --adjust-extension save HTML/CSS documents with proper extensions. --default-page=NAME Change the default page name (normally this is `index.html'.). --no-cache disallow server-cached data. --http-password=PASS set http password to PASS. --http-user=USER set http user to USER. HTTP options: --cut-dirs=NUMBER ignore NUMBER remote directory components. -P, --directory-prefix=PREFIX save files to PREFIX/... --protocol-directories use protocol name in directories. -nH, --no-host-directories don't create host directories. -x, --force-directories force creation of directories. -nd, --no-directories don't create directories. Directories: --unlink remove file before clobber. --remote-encoding=ENC use ENC as the default remote encoding. --local-encoding=ENC use ENC as the local encoding for IRIs. --no-iri turn off IRI support. --ask-password prompt for passwords. --password=PASS set both ftp and http password to PASS. --user=USER set both ftp and http user to USER. --prefer-family=FAMILY connect first to addresses of specified family, one of IPv6, IPv4, or none. -6, --inet6-only connect only to IPv6 addresses. -4, --inet4-only connect only to IPv4 addresses. --ignore-case ignore case when matching files/directories. --restrict-file-names=OS restrict chars in file names to ones OS allows. --no-dns-cache disable caching DNS lookups. --limit-rate=RATE limit download rate to RATE. --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host. -Q, --quota=NUMBER set retrieval quota to NUMBER. --no-proxy explicitly turn off proxy. --random-wait wait from 0.5*WAIT...1.5*WAIT secs between retrievals. --waitretry=SECONDS wait 1..SECONDS between retries of a retrieval. -w, --wait=SECONDS wait SECONDS between retrievals. --read-timeout=SECS set the read timeout to SECS. --connect-timeout=SECS set the connect timeout to SECS. --dns-timeout=SECS set the DNS lookup timeout to SECS. -T, --timeout=SECONDS set all timeout values to SECONDS. --spider don't download anything. -S, --server-response print server response. --no-use-server-timestamps don't set the local file's timestamp by the one on the server. -N, --timestamping don't re-retrieve files unless newer than local. --progress=TYPE select progress gauge type. -c, --continue resume getting a partially-downloaded file. -nc, --no-clobber skip downloads that would download to existing files (overwriting them). -O, --output-document=FILE write documents to FILE. --retry-connrefused retry even if connection is refused. -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). Download: --config=FILE Specify config file to use. -B, --base=URL resolves HTML input-file links (-i -F) relative to URL. -F, --force-html treat input file as HTML. -i, --input-file=FILE download URLs found in local or external FILE. -nv, --no-verbose turn off verboseness, without being quiet. -v, --verbose be verbose (this is the default). -q, --quiet quiet (no output). -d, --debug print lots of debugging information. -a, --append-output=FILE append messages to FILE. -o, --output-file=FILE log messages to FILE. Logging and input file: -e, --execute=COMMAND execute a `.wgetrc'-style command. -b, --background go to background after startup. -h, --help print this help. -V, --version display the version of Wget and exit. Startup: Mandatory arguments to long options are mandatory for short options too. Usage: %s [OPTION]... [URL]... o <= countof (long_options)main.copt->argtype != -1waitretrywaituseragentuser-agentuseruseservertimestampsuse-server-timestampstrustservernamestrust-server-namesunlinktriestimestampingstrictcommentsspiderspanhostsspan-hostsserverresponsesecureprotocolsaveheaderssave-headerssavecookiessave-cookiesretryconnrefusedretry-connrefusedretrsymlinksretr-symlinksrestrictfilenamesrestrict-file-namesremovelistingremove-listingremoteencodingrelativeonlyrelativerejectrecursivereadtimeoutread-timeoutrandomwaitrandom-waitrandomfilerandom-filequotaquietproxyuserproxy-userproxy-passwordproxypasswordproxy-passwdproxy__compatuseproxyproxyprotocoldirectoriesprotocol-directoriesprogressprivatekeytypeprivate-key-typeprivatekeyprivate-keypreservepermissionspreserve-permissionspreferfamilyprefer-familypostfilepost-filepostdatapost-datapasswordpassiveftppassive-ftpparentpagerequisitesoutput-fileoutputdocumentnoparentno-parentnoclobberno-clobbernomirrormaxredirectmax-redirectlocalencodinglocal-encodingloadcookiesload-cookieslimitratelimit-ratereclevellevelkeepsessioncookieskeep-session-cookiesinputinput-fileinet6onlyinet6-onlyinet4onlyinet4-onlyincludedirectoriesinclude-directoriesignoretagsignore-tagsignorelengthignore-lengthignorecaseignore-casehttpuserhttp-userhttp-passwordhttppasswordhttp-passwdhttpkeepalivehtml-extensionaddhostdirhost-directorieshelpheaderglobftp-userftppasswordftp-passwordforcehtmlforce-htmlforce-directoriesfollowtagsfollow-tagsfollowftpfollow-ftpexcludedomainsexcludedirectoriesexclude-directoriesegd-filedotstyledot-styledont-remove-listingdnstimeoutdns-timeoutdnscachedns-cachedirprefixdirectory-prefixdirstructdirectoriesdeleteafterdelete-afterdefaultpagedefault-pagedebugcut-dirscontentdispositioncontent-dispositionconvertlinksconvert-linkscontinueconnecttimeoutchooseconfigconfigcheckcertificatecheck-certificatecertificate-typecertificatecachecadirectoryca-directorycacertificateca-certificatebindaddressbind-addressbasebackup-convertedbackgroundauth-no-challengeaskpasswordask-passwordappend-outputadjust-extensionaccept/usr/local/share/localewgetmachinedefaultaccount%s: %s:%d: unknown token "%s" %s: %s:%d: warning: %s token appears before any machine name macdefpasswordlogin%s: Cannot read %s (%s). r%s/%s.netrc%dd%ds%ssG/sM/sK/sB/s=%s %sbardotdefault%dd%s%dh%dh%s%dm%dm%s%dsemacsforceTERM in --.-K/s %4.*f%sinsz <= dlszdlsz <= progress_size 100%%2d%% percentage <= 100bytes != 0 Invalid dot style specification %s; leaving unchanged. gigamegabinary .=%ss %4.*f%c%3d%%progress.cdp->dots < opt.dots_in_line, %6sK %*s[ skipping %sK ]Cannot get REALTIME clock frequency: %s recur.cRedirection "%s" failed the test. new_parsed != NULLorig_parsed != NULLDecided NOT to load it. Decided to load it. Not following %s because robots.txt forbids it. This is not the same hostname as the parent's (%s and %s). %s (%s) does not match acc/rej rules. %s (%s) is excluded/not-included. Going to "%s" would escape "%s" with no_parent on. The domain was not accepted. It doesn't really look like a relative link. Not following non-HTTP schemes. Already on the black list. download_child_p: parent->url is: %s Deciding whether to enqueue "%s". unlink: %s Removing %s since it should be rejected. Removing %s. recursive rejection criteria--spider--delete-afterRemoving file due to %s in recursive_retrieve(): url_parsed != NULLNot descending further; at depth %d, max. %d. Already downloaded "%s", reusing it from "%s". Dequeuing %s at depth %d None[IRI Enqueuing %s with %s Queue count %d, maxcount %d. Enqueuing %s at depth %d %s: %s. Loading robots.txt; please ignore errors. /robots.txtRejectingAllowing%s path %s because of rule %s. Cannot open %s: %sIgnoring unknown field at line %d disallowallowuser-agentIgnoring malformed line %d !EOL (p)res.cj == cntwgetB/s%.*f %sftp_proxyhttps_proxyhttp_proxy%s.%dsleep_between_retrievals: avg=%f,sleep=%f Retrying. Giving up. unlink: %s Removing %s. Removing file due to --delete-after in retrieve_from_file(): [Couldn't fallback to non-utf8 for %s [IRI fallbacking to non-utf8 for %s %d redirections exceeded. %s: %s. mynewloc != NULLError in proxy URL %s: Must be HTTP. Error parsing proxy URL %s: %s. bytes >= 0secs >= 0GB/sMB/sKB/sremain >= 0retr.c!maxsize || maxsize >= bufsize sleeping %.2f ms for %s bytes, adjust %.2f ms deferring a %.2f ms sleep (%s/%.2f). %s Found %d broken links. Found %d broken link. spider.cnum_elems > 0Found no broken links. ftp*p == 0http://Bad port numberu1 && u2cstr && *strp - result == size*password*scheme_str != NULL..index.htmlq - TAIL (dest) == outlen%2E%2E%s: %sRemoving %s because of directory danger! HTTPS support not compiled inurl_has_scheme (url)error_code >= 0 && ((size_t) error_code) < countof (parse_errors)Invalid IPv6 numeric addressIPv6 addresses not supportedUnterminated IPv6 numeric addressInvalid user nameInvalid host nameScheme missingUnsupported scheme %sNo errorhttp://%sftp://%s0123456789:/@/?#;url.cp2 - newstr == newlen0123456789ABCDEFftp://https://httpshttphtmutils.c0%.3f%.1g%.1f%.0fsig == SIGALRM%.*f%c%d.,1htmlwbrbFailed to unlink symlink %s: %s Unlinking %s (symlink). utime(%s): %s wr/dev/nullOutput will be written to %s. Continuing in background, pid %d. forkwget-log%Y-%m-%d %H:%M:%S%H:%M:%S%s: aprintf: text buffer is too big (%ld bytes), aborting. %s: %s: Failed to allocate %ld bytes; memory exhausted. %s: %s: Failed to allocate enough memory; memory exhausted. +digest+ssl/openssl+opie+ntlm+nls+large-file-iri+ipv6+httpscc -O -L/usr/local/lib/lib /usr/local/lib/libiconv.so -R/usr/local/lib /usr/local/lib/libintl.so -L/usr/local/lib /usr/local/lib/libiconv.so -lc -R/usr/local/lib /usr/local/lib/libssl.so /usr/local/lib/libcrypto.so /usr/local/lib/libz.so -R/usr/local/lib -ldl -lz -lsocket -lnsl -lrt -lrt ftp-opie.o openssl.o http-ntlm.o ../lib/libgnu.acc -DHAVE_CONFIG_H -DSYSTEM_WGETRC="/usr/local/etc/wgetrc" -DLOCALEDIR="/usr/local/share/locale" -I. -I../lib -I../lib -D_REENTRANT -I/usr/local/include -I/usr/local/lib/include -O1.13.4wrote %s to STORE WARNINGssl_ctx != NULLTo connect to %s insecurely, use `--no-check-certificate'. X509 certificate successfully verified and matches host %s %s: certificate common name is invalid (contains a NUL character). This may be an indication that the host is not who it claims to be (that is, it is not the real %s). %s: certificate common name %s doesn't match requested host name %s. %s: no certificate subject alternative name matches requested host name %s. %s Issued certificate has expired. Issued certificate not yet valid. Self-signed certificate encountered. Unable to locally verify the issuer's authority. %s: cannot verify %s's certificate, issued by %s: certificate: subject: %s issuer: %s %s: No certificate presented by %s. conn != NULLERRORSSL handshake failed. Handshake successful; connected socket %d to SSL handle 0x%0*lx openssl.cInitiating SSL handshake. Closed %d/SSL 0x%0*lx Could not seed PRNG; consider using --random-file. OpenSSL: %s NTLMSSP%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%cCreating a type-3 NTLM message. NTLM NTLMSSP%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%s%sCreating a type-1 NTLM message. Empty NTLM message, starting transaction. Unexpected empty NTLM message. Received a type-2 NTLM message. NTLMclocalec-maybeliteral'`"localeescapecshell-alwaysshellmemory exhausted%s%s:%s:%d: %s: : %sUnknown system error '--%s'POSIXLY_CORRECT%s: option '-W %s' requires an argument %s: option '-W %s' doesn't allow an argument %s: option '-W %s' is ambiguous %s: option requires an argument -- '%c' %s: invalid option -- '%c' %s: unrecognized option '%c%s' %s: unrecognized option '--%s' %s: option '--%s' requires an argument %s: option '%c%s' doesn't allow an argument %s: option '--%s' doesn't allow an argument %s: option '%s' is ambiguous; possibilities:--w+/dev/ttyUnknown error %d3 _______``&`6`F`V`f`v`````````aa&a6aFaVafavaaaaaaaaabb&b6bFbVbfbvbbbbbbbbbcc&c6cFcVcfcvcccccccccdd&d6dFdVdfdvdddddddddee&e6eFeVefeveeeeeeeeeff&f6fFfVfffvfffffffffgg&g6gFgVgfgvggggggggghh&h6hFhVhfhvhhhhhhhhhii&i6iFiVifiviiiiiiiiijj&j6jFjVjfjvjjjjjjjjjkk&k6kFkVkfkvkkkkkkkkkll&lYgt0E d d9  o{oXoP0YYpo`o/  l    ܨ Ԩ ̨   P L    x d p h \ ` X L @ 4 (  H D       ط @ ̷ h X                         | l ` X  P H             |    t       s s s ,u s s s s u s s s s s v v s s s s s s x t h    X D Pg < Lg 4 Hg ؔ  H <    L  0    L   p 8    | ,        X    H   p    <   h      l 4   d $     L   x  h 0   4   X    H   h 4   X   ( l  P   H    L   X  H    P     d   T   l     X   l    D  x 4     A x E h aX L 8  , b,  K < <  B             | h 4 ` P  @ 4 c4 $ k   , ,  $  d       t Ph \ P D 8  D $       X    e     x x Fl \ P D  < < 4 4 , hL    E              p d X D I0 $ 4   6  i      l    x h X H < 4 m4 0 n$      O  o  p         x h X @ ,             Y  t d t X L D qD < Q< 0 $       r    R  L     | h X H 4      t  d S  H   T   T  N  t x x d P 8 $    U  v    V  w    KMG     \*0 2P3 4x56DH t l d :/" t" d" P"  <" " ! ! #  P # #  | "  KMGTPEPPPPPPPPPPPPPPPP``````  % l% d% \% P% H% @% 8% (% t% & ' AABEACEACTADADAADDAGOAIDAIMAIRALLALPAMAMYANANAANDANNANTANYAPEAPSAPTARCAREARKARMARTASASHASKATATEAUGAUKAVEAWEAWKAWLAWNAXAYEBADBAGBAHBAMBANBARBATBAYBEBEDBEEBEGBENBETBEYBIBBIDBIGBINBITBOBBOGBONBOOBOPBOWBOYBUBBUDBUGBUMBUNBUSBUTBUYBYBYECABCALCAMCANCAPCARCATCAWCODCOGCOLCONCOOCOPCOTCOWCOYCRYCUBCUECUPCURCUTDABDADDAMDANDARDAYDEEDELDENDESDEWDIDDIEDIGDINDIPDODOEDOGDONDOTDOWDRYDUBDUDDUEDUGDUNEAREATEDEELEGGEGOELIELKELMELYEMENDESTETCEVAEVEEWEEYEFADFANFARFATFAYFEDFEEFEWFIBFIGFINFIRFITFLOFLYFOEFOGFORFRYFUMFUNFURGABGADGAGGALGAMGAPGASGAYGEEGELGEMGETGIGGILGINGOGOTGUMGUNGUSGUTGUYGYMGYPHAHADHALHAMHANHAPHASHATHAWHAYHEHEMHENHERHEWHEYHIHIDHIMHIPHISHITHOHOBHOCHOEHOGHOPHOTHOWHUBHUEHUGHUHHUMHUTIICYIDAIFIKEILLINKINNIOIONIQIRAIREIRKISITITSIVYJABJAGJAMJANJARJAWJAYJETJIGJIMJOJOBJOEJOGJOTJOYJUGJUTKAYKEGKENKEYKIDKIMKINKITLALABLACLADLAGLAMLAPLAWLAYLEALEDLEELEGLENLEOLETLEWLIDLIELINLIPLITLOLOBLOGLOPLOSLOTLOULOWLOYLUGLYEMAMACMADMAEMANMAOMAPMATMAWMAYMEMEGMELMENMETMEWMIDMINMITMOBMODMOEMOOMOPMOSMOTMOWMUDMUGMUMMYNABNAGNANNAPNATNAYNENEDNEENETNEWNIBNILNIPNITNONOBNODNONNORNOTNOVNOWNUNUNNUTOOAFOAKOAROATODDODEOFOFFOFTOHOILOKOLDONONEORORBOREORROSOTTOUROUTOVAOWOWEOWLOWNOXPAPADPALPAMPANPAPPARPATPAWPAYPEAPEGPENPEPPERPETPEWPHIPIPIEPINPITPLYPOPODPOEPOPPOTPOWPROPRYPUBPUGPUNPUPPUTQUORAGRAMRANRAPRATRAWRAYREBREDREPRETRIBRIDRIGRIMRIORIPROBRODROERONROTROWROYRUBRUERUGRUMRUNRYESACSADSAGSALSAMSANSAPSATSAWSAYSEASECSEESENSETSEWSHESHYSINSIPSIRSISSITSKISKYSLYSOSOBSODSONSOPSOWSOYSPASPYSUBSUDSUESUMSUNSUPTABTADTAGTANTAPTARTEATEDTEETENTHETHYTICTIETIMTINTIPTOTOETOGTOMTONTOOTOPTOWTOYTRYTUBTUGTUMTUNTWOUNUPUSUSEVANVATVETVIEWADWAGWARWASWAYWEWEBWEDWEEWETWHOWHYWINWITWOKWONWOOWOWWRYWUYAMYAPYAWYEYEAYESYETYOUABEDABELABETABLEABUTACHEACIDACMEACREACTAACTSADAMADDSADENAFARAFROAGEEAHEMAHOYAIDAAIDEAIDSAIRYAJARAKINALANALECALGAALIAALLYALMAALOEALSOALTOALUMALVAAMENAMESAMIDAMMOAMOKAMOSAMRAANDYANEWANNAANNEANTEANTIAQUAARABARCHAREAARGOARIDARMYARTSARTYASIAASKSATOMAUNTAURAAUTOAVERAVIDAVISAVONAVOWAWAYAWRYBABEBABYBACHBACKBADEBAILBAITBAKEBALDBALEBALIBALKBALLBALMBANDBANEBANGBANKBARBBARDBAREBARKBARNBARRBASEBASHBASKBASSBATEBATHBAWDBAWLBEADBEAKBEAMBEANBEARBEATBEAUBECKBEEFBEENBEERBEETBELABELLBELTBENDBENTBERGBERNBERTBESSBESTBETABETHBHOYBIASBIDEBIENBILEBILKBILLBINDBINGBIRDBITEBITSBLABBLATBLEDBLEWBLOBBLOCBLOTBLOWBLUEBLUMBLURBOARBOATBOCABOCKBODEBODYBOGYBOHRBOILBOLDBOLOBOLTBOMBBONABONDBONEBONGBONNBONYBOOKBOOMBOONBOOTBOREBORGBORNBOSEBOSSBOTHBOUTBOWLBOYDBRADBRAEBRAGBRANBRAYBREDBREWBRIGBRIMBROWBUCKBUDDBUFFBULBBULKBULLBUNKBUNTBUOYBURGBURLBURNBURRBURTBURYBUSHBUSSBUSTBUSYBYTECADYCAFECAGECAINCAKECALFCALLCALMCAMECANECANTCARDCARECARLCARRCARTCASECASHCASKCASTCAVECEILCELLCENTCERNCHADCHARCHATCHAWCHEFCHENCHEWCHICCHINCHOUCHOWCHUBCHUGCHUMCITECITYCLADCLAMCLANCLAWCLAYCLODCLOGCLOTCLUBCLUECOALCOATCOCACOCKCOCOCODACODECODYCOEDCOILCOINCOKECOLACOLDCOLTCOMACOMBCOMECOOKCOOLCOONCOOTCORDCORECORKCORNCOSTCOVECOWLCRABCRAGCRAMCRAYCREWCRIBCROWCRUDCUBACUBECUFFCULLCULTCUNYCURBCURDCURECURLCURTCUTSDADEDALEDAMEDANADANEDANGDANKDAREDARKDARNDARTDASHDATADATEDAVEDAVYDAWNDAYSDEADDEAFDEALDEANDEARDEBTDECKDEEDDEEMDEERDEFTDEFYDELLDENTDENYDESKDIALDICEDIEDDIETDIMEDINEDINGDINTDIREDIRTDISCDISHDISKDIVEDOCKDOESDOLEDOLLDOLTDOMEDONEDOOMDOORDORADOSEDOTEDOUGDOURDOVEDOWNDRABDRAGDRAMDRAWDREWDRUBDRUGDRUMDUALDUCKDUCTDUELDUETDUKEDULLDUMBDUNEDUNKDUSKDUSTDUTYEACHEARLEARNEASEEASTEASYEBENECHOEDDYEDENEDGEEDGYEDITEDNAEGANELANELBAELLAELSEEMILEMITEMMAENDSERICEROSEVENEVEREVILEYEDFACEFACTFADEFAILFAINFAIRFAKEFALLFAMEFANGFARMFASTFATEFAWNFEARFEATFEEDFEELFEETFELLFELTFENDFERNFESTFEUDFIEFFIGSFILEFILLFILMFINDFINEFINKFIREFIRMFISHFISKFISTFITSFIVEFLAGFLAKFLAMFLATFLAWFLEAFLEDFLEWFLITFLOCFLOGFLOWFLUBFLUEFOALFOAMFOGYFOILFOLDFOLKFONDFONTFOODFOOLFOOTFORDFOREFORKFORMFORTFOSSFOULFOURFOWLFRAUFRAYFREDFREEFRETFREYFROGFROMFUELFULLFUMEFUNDFUNKFURYFUSEFUSSGAFFGAGEGAILGAINGAITGALAGALEGALLGALTGAMEGANGGARBGARYGASHGATEGAULGAURGAVEGAWKGEARGELDGENEGENTGERMGETSGIBEGIFTGILDGILLGILTGINAGIRDGIRLGISTGIVEGLADGLEEGLENGLIBGLOBGLOMGLOWGLUEGLUMGLUTGOADGOALGOATGOERGOESGOLDGOLFGONEGONGGOODGOOFGOREGORYGOSHGOUTGOWNGRABGRADGRAYGREGGREWGREYGRIDGRIMGRINGRITGROWGRUBGULFGULLGUNKGURUGUSHGUSTGWENGWYNHAAGHAASHACKHAILHAIRHALEHALFHALLHALOHALTHANDHANGHANKHANSHARDHARKHARMHARTHASHHASTHATEHATHHAULHAVEHAWKHAYSHEADHEALHEARHEATHEBEHECKHEEDHEELHEFTHELDHELLHELMHERBHERDHEREHEROHERSHESSHEWNHICKHIDEHIGHHIKEHILLHILTHINDHINTHIREHISSHIVEHOBOHOCKHOFFHOLDHOLEHOLMHOLTHOMEHONEHONKHOODHOOFHOOKHOOTHORNHOSEHOSTHOURHOVEHOWEHOWLHOYTHUCKHUEDHUFFHUGEHUGHHUGOHULKHULLHUNKHUNTHURDHURLHURTHUSHHYDEHYMNIBISICONIDEAIDLEIFFYINCAINCHINTOIONSIOTAIOWAIRISIRMAIRONISLEITCHITEMIVANJACKJADEJAILJAKEJANEJAVAJEANJEFFJERKJESSJESTJIBEJILLJILTJIVEJOANJOBSJOCKJOELJOEYJOHNJOINJOKEJOLTJOVEJUDDJUDEJUDOJUDYJUJUJUKEJULYJUNEJUNKJUNOJURYJUSTJUTEKAHNKALEKANEKANTKARLKATEKEELKEENKENOKENTKERNKERRKEYSKICKKILLKINDKINGKIRKKISSKITEKLANKNEEKNEWKNITKNOBKNOTKNOWKOCHKONGKUDOKURDKURTKYLELACELACKLACYLADYLAIDLAINLAIRLAKELAMBLAMELANDLANELANGLARDLARKLASSLASTLATELAUDLAVALAWNLAWSLAYSLEADLEAFLEAKLEANLEARLEEKLEERLEFTLENDLENSLENTLEONLESKLESSLESTLETSLIARLICELICKLIEDLIENLIESLIEULIFELIFTLIKELILALILTLILYLIMALIMBLIMELINDLINELINKLINTLIONLISALISTLIVELOADLOAFLOAMLOANLOCKLOFTLOGELOISLOLALONELONGLOOKLOONLOOTLORDLORELOSELOSSLOSTLOUDLOVELOWELUCKLUCYLUGELUKELULULUNDLUNGLURALURELURKLUSHLUSTLYLELYNNLYONLYRAMACEMADEMAGIMAIDMAILMAINMAKEMALEMALIMALLMALTMANAMANNMANYMARCMAREMARKMARSMARTMARYMASHMASKMASSMASTMATEMATHMAULMAYOMEADMEALMEANMEATMEEKMEETMELDMELTMEMOMENDMENUMERTMESHMESSMICEMIKEMILDMILEMILKMILLMILTMIMIMINDMINEMINIMINKMINTMIREMISSMISTMITEMITTMOANMOATMOCKMODEMOLDMOLEMOLLMOLTMONAMONKMONTMOODMOONMOORMOOTMOREMORNMORTMOSSMOSTMOTHMOVEMUCHMUCKMUDDMUFFMULEMULLMURKMUSHMUSTMUTEMUTTMYRAMYTHNAGYNAILNAIRNAMENARYNASHNAVENAVYNEALNEARNEATNECKNEEDNEILNELLNEONNERONESSNESTNEWSNEWTNIBSNICENICKNILENINANINENOAHNODENOELNOLLNONENOOKNOONNORMNOSENOTENOUNNOVANUDENULLNUMBOATHOBEYOBOEODINOHIOOILYOINTOKAYOLAFOLDYOLGAOLINOMANOMENOMITONCEONESONLYONTOONUSORALORGYOSLOOTISOTTOOUCHOUSTOUTSOVALOVENOVEROWLYOWNSQUADQUITQUODRACERACKRACYRAFTRAGERAIDRAILRAINRAKERANKRANTRARERASHRATERAVERAYSREADREALREAMREARRECKREEDREEFREEKREELREIDREINRENARENDRENTRESTRICERICHRICKRIDERIFTRILLRIMERINGRINKRISERISKRITEROADROAMROARROBEROCKRODEROILROLLROMEROODROOFROOKROOMROOTROSAROSEROSSROSYROTHROUTROVEROWEROWSRUBERUBYRUDERUDYRUINRULERUNGRUNSRUNTRUSERUSHRUSKRUSSRUSTRUTHSACKSAFESAGESAIDSAILSALESALKSALTSAMESANDSANESANGSANKSARASAULSAVESAYSSCANSCARSCATSCOTSEALSEAMSEARSEATSEEDSEEKSEEMSEENSEESSELFSELLSENDSENTSETSSEWNSHAGSHAMSHAWSHAYSHEDSHIMSHINSHODSHOESHOTSHOWSHUNSHUTSICKSIDESIFTSIGHSIGNSILKSILLSILOSILTSINESINGSINKSIRESITESITSSITUSKATSKEWSKIDSKIMSKINSKITSLABSLAMSLATSLAYSLEDSLEWSLIDSLIMSLITSLOBSLOGSLOTSLOWSLUGSLUMSLURSMOGSMUGSNAGSNOBSNOWSNUBSNUGSOAKSOARSOCKSODASOFASOFTSOILSOLDSOMESONGSOONSOOTSORESORTSOULSOURSOWNSTABSTAGSTANSTARSTAYSTEMSTEWSTIRSTOWSTUBSTUNSUCHSUDSSUITSULKSUMSSUNGSUNKSURESURFSWABSWAGSWAMSWANSWATSWAYSWIMSWUMTACKTACTTAILTAKETALETALKTALLTANKTASKTATETAUTTEALTEAMTEARTECHTEEMTEENTEETTELLTENDTENTTERMTERNTESSTESTTHANTHATTHEETHEMTHENTHEYTHINTHISTHUDTHUGTICKTIDETIDYTIEDTIERTILETILLTILTTIMETINATINETINTTINYTIRETOADTOGOTOILTOLDTOLLTONETONGTONYTOOKTOOLTOOTTORETORNTOTETOURTOUTTOWNTRAGTRAMTRAYTREETREKTRIGTRIMTRIOTRODTROTTROYTRUETUBATUBETUCKTUFTTUNATUNETUNGTURFTURNTUSKTWIGTWINTWITULANUNITURGEUSEDUSERUSESUTAHVAILVAINVALEVARYVASEVASTVEALVEDAVEILVEINVENDVENTVERBVERYVETOVICEVIEWVINEVISEVOIDVOLTVOTEWACKWADEWAGEWAILWAITWAKEWALEWALKWALLWALTWANDWANEWANGWANTWARDWARMWARNWARTWASHWASTWATSWATTWAVEWAVYWAYSWEAKWEALWEANWEARWEEDWEEKWEIRWELDWELLWELTWENTWEREWERTWESTWHAMWHATWHEEWHENWHETWHOAWHOMWICKWIFEWILDWILLWINDWINEWINGWINKWINOWIREWISEWISHWITHWOLFWONTWOODWOOLWORDWOREWORKWORMWORNWOVEWRITWYNNYALEYANGYANKYARDYARNYAWLYAWNYEAHYEARYELLYOGAYOKE8DXf 0 ? 9XYY0Y _ 0l d d eH / 3 84 pf f g m 'X4 D\4 W]d4  ht84 f et84 f e`n o o+ o  p# qo "z@ ,z@ 7{  A0{? Kp{3 V<| df rf t4 f 8eh P F  ,] t X U !܌ 4dH U or 9 f f f t4 f e8 T tb ؔ \h (Ė @ QTM c v$ 4 Ԡ'  ء lE  p l f t4 f @e .| :T F$ S< Zlv j | l p @0 ^ 0I t4 f e4 4 4 4  00F E4 P V  `~ 6 hHeoPt 6 v H~   ( H` 4 1 f f &f =f Hf t4 f Hedt4 f enzA     4 i t`5 f    \!^ !<  -O H2 2  th5 f e,3AC >J JBo TD dH, pH {8IR I t84 f  lK hL! L! L"  L U@^ ca q:  o 2 c u  D ` *(^ CD T gT7 t(8  H x~@ H 08 8R   ! 48 <  |3  +  @,8 Q  [ i y     t,8  e 3 T\ ` X:  < L  ) r = ] S  a!L xؘ X  `t88 ؔ ̞ #X " h# t84  e8D 0\*  l,< I 0a  2D *P3R 94 D9l QH? _x50 j(7u |6} DH      t D  О J   t84  ( ,4L BL SL  _M k`\ ~W t84 f e(]] ] ^ TcS c ̩ t84 ̩ eli i Pk ,s! #, ,@# ;Щ thD Щ P FO t84  ehd q ~  $I D @)  0P G  P #D $0T A8 Qn f9 uȕ ؘ| TZ >   xO   tD f  DI  8' ` *o <7 S ]\% jD0 }  tD    ( E tE f etF f et(F f e _ `  4F  t4F ذ e} : X' 28Y ?Y MQ ZDz g vh 8f @  t8f  el! " " t84 f x t84 f e @t84 f  t84 f e8 X9# +|9  DPf LTf SXf \G~ o 00 tPf   t84 f et84 f eMS M t84 0 eO Qy 8 (t`f 8 et84 f e ^ t84 ` et84 h et84  4 )6a\ t84 f e@tlf f eKt84 f eUt84 f e`ua{+ ( P `4 \ / ,. Ж0 je ckpj5 >PkHfOxC c r(F ~tF giJ D   dI KD j0 j>X9 L | a84 j sT |h4  5 xX 4J5 $+ PaqeK D e '` 0be#< +_2kE@fN]c b\c ncu@N k& ȌZ ( \e }2 _E 0 A XA _#_)< 8Q Ht Vpq dal <| @gtNw J hK% c4^  s3 hHb ܔ? _'0 9P! F*) P^ [l{ a uj,F 8   Pgflphbs T   J < %e,iApgLps~ Vf_hz kPdr H7 u  a0F K& XX {|  E ظ D I  pa I ) (8 ; iQ D  Z xr k |L  w   $  )V @c ` L  `c @e P  @ f !`fE!l U!p`a!H< u! !8 !<8 !8 !I !a!D@ !4 ! */ !ؐ5 !a!D} "Ȣ' "f"+ )"k7" V"H  g"; t"4VA " "Pf"x "4  " "{ "pb"0g"/ "D "g"k"X@ # # #k# -#d4# B#  O#^ U# g#xf #) # #d#a#Pi# k#xO l# $d  1 $[ $Ы> )$N  7$jH$ z Y$x^  n$+ x$- $pc$, $e$`$I+ $; $ $Ȅ b$ $Pj %/ % 6% H%0eQ%h8 c% p% y%T^# %E %`j%`% Y`%kB %s %h%@k% ( %2 &M &,u "&4+ 0&k9&l L&df W&dm ^&hj&br&TC" &7N &p & &xV &e& i&j&d &Ph 'ȍ '8 +'b2'kT >' c" !F'H! _'lgI q'0kz',,) 'hf 'I@ '<* ' ') ' 'B" 'd'3 '~5 ( ( l".(hJ(TK  e(* o(bLK w(h(* (4 ,&d(pLC ($u (U D* (@d(pd(Pb(G $LJ (b(@ )g),_ ")^# 6)< @)pf G)t- ])`et)' )? )d )K )g)i)f)7 )MR a)4 x)<4 )8 b * *d& '*h 3*b:*iL*hm* v*@b~*v * g*a*. *_ *0i*F (* %`Tw + +i+0j#+N[ 9+0c@+I, U+f c+H8; w+  !~+h+f+J +H + c+G. +  +h `+d+ H ,c ,Pe, ,L" %,`i.,`hB, V,4 \,| d,j,V },b,  b84 !,} ,LV ,t , ,l ,Lx ,@`, d ,g,0 -a-= -0 #-pt .-d8-Ps E-\ Q-e d-| z-P&s - -pi-i-`-g- -T4 -$M# -@(x -`-, .4 .k .lJ 6.] D.( M.cV.jj.8- y.. .x+ .4$ .i.+& .He .X .0 /F /@j  / (/= 7/peJ/hI Y/`ga/Lf v/i/a/p / h/.> / / b/q /J /ľ /d/g!HM d `ac0@i 0 d0pa{ 0$FM 00e90F .d`  K0 _0H7 p0  0܀ 0+N 0t @ 0e0\ 0  0U 0`f 0c0H; !@a1P`1c1T2 &1`S -1``81TR[  I%bK1aR1 $e1} m1dz7 {1, 1 1\ 1 149b 1WO 17 1# 1^ 1 2 2T 20d%`7 2L /20a62 * I2 `X24 m2 x2 2g2T 2j2+ 2c28J 2`b2`d3dv+  3K `3(  $30K :3I (PcC3  Q3p  ]3TX h3ep3N ~3|| 3i3Ī 3j3 =z 3hH 3L 3`3LI 3|  48F 4d  4`v 040 A4  L40`U4 c4D m4X, w4Q 4J 4tcP 4 40f40h4pk4 f4|X 4Lw9 5p@ 5hM/ (5P+ 25 95`K  R5lf _5gh5t w5LQ 5g5 5@hW 5`k50 5j5 5J 6| 6h$ +6K #b;6fJ6`Z6L  l6d_q6e~6pq 6Q 6t75 6pfL. e6HH8))9*X*anotateP LHIH@D \*DD 0HD  2LD P3XD 4\D x5`D 6dD DHanotatelJTJK;KK%Lx|L L  KanotatelLTLLL MN W`\ Lanotate anotate(]B (]]]^,_bsTcSc\ee f lgIh8hz canotate anotateli[liiPklq,s!Psps~s3$u<|X@QM< ,'@#d&;q Wanotate as,sanotate4ȄK$ȄH0anotate |%$Ipqp)|0PGȌZ$+PT8ܔ?n9ȕЖ000ؘ|TZ>"txOȢ't- Ī EDݓ+ڗϥanotate anotate`=Ы>DIE^h $D@\"p@XA d `\L8'`S8}lPH<@ľTX=TXXUoxO||H7@NH]8F7\%8D0t @  ·& yanotate zanotate8 h *  (   *******1118***1#1 anotate                                     $  (  ,  0  4  8  <  @  D  H  L  P  T  X  \  `  d  h  l  p  t  x  |                                  anotate4 $ _` | anotate anotate}:X'8YYQDzh&@D  5anotate8 408f 8/0 -anotate(H7*H7`7anotatelt7\t75777N(8H8;8X9#$FMtFFvvv$ExCF$ 9CanotateP LH9Fr<C=ECAC$>C$>C$>C$>C$>C$>C8=C1=C=C=C#=C*=C =C$>C$>C$>C$>C$>C$>C$>C$>C$>C$>C$>C$>C$>C$>C$>D$>D$>D$> D<D<D<D<D< DB$D<(Dv<,D<0D<4D<8DBDBDBDBDBDBDBDBDBDBDBDBDBDBDBDBDBDBDBDBDBDBDBDBDBDBDBD<DoAEBE<EB E<EBEBEBEB EB$EB(EB,EB0EB4EB8EB8 /var/tmp/wget-1.13.4/srcftp-basic.c;5 /var/tmp/wget-1.13.4/srcftp-ls.c93 /var/tmp/wget-1.13.4/srchash.c93 /var/tmp/wget-1.13.4/srchost.c?9 /var/tmp/wget-1.13.4/srchtml-parse.c=7 /var/tmp/wget-1.13.4/srchtml-url.c93 /var/tmp/wget-1.13.4/srchttp.c93 /var/tmp/wget-1.13.4/srcinit.c82 /var/tmp/wget-1.13.4/srclog.c93 /var/tmp/wget-1.13.4/srcmain.c:4 /var/tmp/wget-1.13.4/srcnetrc.c=7 /var/tmp/wget-1.13.4/srcprogress.c;5 /var/tmp/wget-1.13.4/srcptimer.c:4 /var/tmp/wget-1.13.4/srcrecur.c82 /var/tmp/wget-1.13.4/srcres.c93 /var/tmp/wget-1.13.4/srcretr.c;5 /var/tmp/wget-1.13.4/srcspider.c82 /var/tmp/wget-1.13.4/srcurl.c:4 /var/tmp/wget-1.13.4/srcutils.c:4 /var/tmp/wget-1.13.4/srcexits.c?9 /var/tmp/wget-1.13.4/srcbuild_info.c<6 /var/tmp/wget-1.13.4/srcversion.c=7 /var/tmp/wget-1.13.4/srcftp-opie.c<6 /var/tmp/wget-1.13.4/srcopenssl.c>8 /var/tmp/wget-1.13.4/srchttp-ntlm.c<6 /var/tmp/wget-1.13.4/libc-ctype.c82 /var/tmp/wget-1.13.4/libmd5.c:4 /var/tmp/wget-1.13.4/libquote.c=7 /var/tmp/wget-1.13.4/libquotearg.c<6 /var/tmp/wget-1.13.4/libxmalloc.c?9 /var/tmp/wget-1.13.4/libxalloc-die.c:4 /var/tmp/wget-1.13.4/liberror.c;5 /var/tmp/wget-1.13.4/libgetopt.c<6 /var/tmp/wget-1.13.4/libgetopt1.c<6 /var/tmp/wget-1.13.4/libgetpass.c<6 /var/tmp/wget-1.13.4/libmbrtowc.c=7 /var/tmp/wget-1.13.4/libstrerror.c?9 /var/tmp/wget-1.13.4/libstrerror_r.c=7 /var/tmp/wget-1.13.4/libexitfail.c<6 /var/tmp/wget-1.13.4/libgetline.c=7 /var/tmp/wget-1.13.4/libgetdelim.c DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD%.interp.SUNW_cap.hash.dynsym.dynstr.SUNW_version.rel.data.rel.bss.rel.plt.text.init.fini.rodata.rodata1.got.dynamic.bssf.symtab.strtab.annotate.comment.debug_info.debug_line.debug_abbrev.shstrtab o %!"99)oXX7 BYYA BYYJ B0Y0YP N__ S0l0lYdd_ddeeeE>mH Hv/ /4{3 3;84 8482pf pfEf f@U pfKb 06o I2ɬ= ;  )   6-0707010005a675000041ed0000000000000000000000054fa8aa6600000000000000b500010002ffffffffffffffff0000001500000000root/usr/local/share0707010005a676000041ed0000000000000000000000024fa8aa6600000000000000b500010002ffffffffffffffff0000001a00000000root/usr/local/share/info0707010005a677000081a40000000000000000000000014fa8a70b000020bf000000b500010002ffffffffffffffff0000001e00000000root/usr/local/share/info/dirThis is the file .../info/dir, which contains the topmost node of the Info hierarchy, called (dir)Top. The first time you invoke Info you start off looking at this node.  File: dir, Node: Top This is the top of the INFO tree This (the Directory node) gives a menu of major topics. Typing "q" exits, "?" lists all Info commands, "d" returns here, "h" gives a primer for first-timers, "mEmacs" visits the Emacs manual, etc. In Emacs, you can click mouse button 2 on a menu item or cross reference to select it. * Menu: C++ libraries * autosprintf: (autosprintf). Support for printf format strings in C++. Development * libffi: (libffi). Portable foreign-function interface library. Emacs * IDN Library: (libidn)Emacs API. Emacs API for IDN functions. GNU Gettext Utilities * autopoint: (gettext)autopoint Invocation. Copy gettext infrastructure. * envsubst: (gettext)envsubst Invocation. Expand environment variables. * gettextize: (gettext)gettextize Invocation. Prepare a package for gettext. * gettext: (gettext). GNU gettext utilities. * ISO3166: (gettext)Country Codes. ISO 3166 country codes. * ISO639: (gettext)Language Codes. ISO 639 language codes. * msgattrib: (gettext)msgattrib Invocation. Select part of a PO file. * msgcat: (gettext)msgcat Invocation. Combine several PO files. * msgcmp: (gettext)msgcmp Invocation. Compare a PO file and template. * msgcomm: (gettext)msgcomm Invocation. Match two PO files. * msgconv: (gettext)msgconv Invocation. Convert PO file to encoding. * msgen: (gettext)msgen Invocation. Create an English PO file. * msgexec: (gettext)msgexec Invocation. Process a PO file. * msgfilter: (gettext)msgfilter Invocation. Pipe a PO file through a filter. * msgfmt: (gettext)msgfmt Invocation. Make MO files out of PO files. * msggrep: (gettext)msggrep Invocation. Select part of a PO file. * msginit: (gettext)msginit Invocation. Create a fresh PO file. * msgmerge: (gettext)msgmerge Invocation. Update a PO file from template. * msgunfmt: (gettext)msgunfmt Invocation. Uncompile MO file into PO file. * msguniq: (gettext)msguniq Invocation. Unify duplicates for PO file. * ngettext: (gettext)ngettext Invocation. Translate a message with plural. * xgettext: (gettext)xgettext Invocation. Extract strings into a PO file. GNU organization * Standards: (standards). GNU coding standards. GNU Packages * CVS: (cvs). Concurrent Versions System GNU Plotting Utilities * Appendices: (plotutils)Appendices. More info on the plotting utilities. * Plotting utilities: (plotutils). GNU plotting utilities. * graph: (plotutils)graph Invocation. Plot datasets, possibly in real time. * libplot: (plotutils)libplot. A library for 2-D vector graphics. * ode: (plotutils)ode Invocation. Integrate differential equations. * pic2plot: (plotutils)pic2plot Invocation. Convert files in the pic language * plot: (plotutils)plot Invocation. Convert and display plot files. * plotfont: (plotutils)plotfont Invocation. Plot character maps of fonts. * tek2plot: (plotutils)tek2plot Invocation. Translate legacy Tektronix data. * spline: (plotutils)spline Invocation. Interpolate between points in datasets. GNU Utilities * gpg: (gpg). OpenPGP encryption and signing tool (v1). Individual utilities * aclocal-invocation: (automake)aclocal Invocation. Generating aclocal.m4. * autoconf-invocation: (autoconf)autoconf Invocation. How to create configuration scripts * autoheader: (autoconf)autoheader Invocation. How to create configuration templates * autom4te: (autoconf)autom4te Invocation. The Autoconf executables backbone * automake-invocation: (automake)automake Invocation. Generating Makefile.in. * autoreconf: (autoconf)autoreconf Invocation. Remaking multiple `configure' scripts * autoscan: (autoconf)autoscan Invocation. Semi-automatic `configure.ac' writing * autoupdate: (autoconf)autoupdate Invocation. Automatic update of `configure.ac' * config.status: (autoconf)config.status Invocation. Recreating configurations. * configure: (autoconf)configure Invocation. Configuring a package. * ifnames: (autoconf)ifnames Invocation. Listing conditionals in source. * cvs: (cvs)CVS commands. Concurrent Versions System * testsuite: (autoconf)testsuite Invocation. Running an Autotest test suite. Localization * idn: (libidn)Invoking idn. Internationalized Domain Name (IDN) string conversion. Math * GNUPLOT: (gnuplot). An Interactive Plotting Program Miscellaneous * jwhois: (jwhois). Whois client. Network Applications * Wget: (wget). The non-interactive network downloader. Programming * cvsclient: (cvsclient). The CVS client/server protocol. Software development * Autoconf: (autoconf). Create source code configuration scripts. * Automake: (automake). Making GNU standards-compliant Makefiles. Software libraries * GnuTLS: (gnutls). GNU Transport Layer Security Library. * libidn: (libidn). Internationalized string processing library. * libtasn1: (libtasn1). Library for Abstract Syntax Notation One (ASN.1). System Administration * certtool: (gnutls)Invoking certtool. Manipulate certificates and keys. * gnutls-cli: (gnutls)Invoking gnutls-cli. GnuTLS test client. * gnutls-cli-debug: (gnutls)Invoking gnutls-cli-debug. GnuTLS debug client. * gnutls-serv: (gnutls)Invoking gnutls-serv. GnuTLS test server. * psktool: (gnutls)Invoking psktool. Simple TLS-Pre-Shared-Keys manager. * srptool: (gnutls)Invoking srptool. Simple SRP password tool. Texinfo documentation system * Info: (info). How to use the documentation browsing system. * info standalone: (info-stnd). Read Info documents without Emacs. * infokey: (info-stnd)Invoking infokey. Compile Info customizations. * install-info: (texinfo)Invoking install-info. Update info/dir entries. * makeinfo: (texinfo)Invoking makeinfo. Translate Texinfo source. * pdftexi2dvi: (texinfo)PDF Output. PDF output for Texinfo. * texi2dvi: (texinfo)Format with texi2dvi. Print Texinfo documents. * texi2pdf: (texinfo)PDF Output. PDF output for Texinfo. * texindex: (texinfo)Format with tex/texindex. Sort Texinfo index files. * Texinfo: (texinfo). The GNU documentation format. Typesetting * Groff: (groff). The GNU troff document formatting system. 0707010005a679000081a40000000000000000000000014fa8a70b00030f61000000b500010002ffffffffffffffff0000002400000000root/usr/local/share/info/wget.infoThis is wget.info, produced by makeinfo version 4.13 from /home/gscrivano/workspace/wget/doc/wget.texi. INFO-DIR-SECTION Network Applications START-INFO-DIR-ENTRY * Wget: (wget). The non-interactive network downloader. END-INFO-DIR-ENTRY This file documents the GNU Wget utility for downloading network data. Copyright (C) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011 Free Software Foundation, Inc. Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.2 or any later version published by the Free Software Foundation; with no Invariant Sections, no Front-Cover Texts, and no Back-Cover Texts. A copy of the license is included in the section entitled "GNU Free Documentation License".  File: wget.info, Node: Top, Next: Overview, Prev: (dir), Up: (dir) Wget 1.13.4 *********** This file documents the GNU Wget utility for downloading network data. Copyright (C) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011 Free Software Foundation, Inc. Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.2 or any later version published by the Free Software Foundation; with no Invariant Sections, no Front-Cover Texts, and no Back-Cover Texts. A copy of the license is included in the section entitled "GNU Free Documentation License". * Menu: * Overview:: Features of Wget. * Invoking:: Wget command-line arguments. * Recursive Download:: Downloading interlinked pages. * Following Links:: The available methods of chasing links. * Time-Stamping:: Mirroring according to time-stamps. * Startup File:: Wget's initialization file. * Examples:: Examples of usage. * Various:: The stuff that doesn't fit anywhere else. * Appendices:: Some useful references. * Copying this manual:: You may give out copies of this manual. * Concept Index:: Topics covered by this manual.  File: wget.info, Node: Overview, Next: Invoking, Prev: Top, Up: Top 1 Overview ********** GNU Wget is a free utility for non-interactive download of files from the Web. It supports HTTP, HTTPS, and FTP protocols, as well as retrieval through HTTP proxies. This chapter is a partial overview of Wget's features. * Wget is non-interactive, meaning that it can work in the background, while the user is not logged on. This allows you to start a retrieval and disconnect from the system, letting Wget finish the work. By contrast, most of the Web browsers require constant user's presence, which can be a great hindrance when transferring a lot of data. * Wget can follow links in HTML, XHTML, and CSS pages, to create local versions of remote web sites, fully recreating the directory structure of the original site. This is sometimes referred to as "recursive downloading." While doing that, Wget respects the Robot Exclusion Standard (`/robots.txt'). Wget can be instructed to convert the links in downloaded files to point at the local files, for offline viewing. * File name wildcard matching and recursive mirroring of directories are available when retrieving via FTP. Wget can read the time-stamp information given by both HTTP and FTP servers, and store it locally. Thus Wget can see if the remote file has changed since last retrieval, and automatically retrieve the new version if it has. This makes Wget suitable for mirroring of FTP sites, as well as home pages. * Wget has been designed for robustness over slow or unstable network connections; if a download fails due to a network problem, it will keep retrying until the whole file has been retrieved. If the server supports regetting, it will instruct the server to continue the download from where it left off. * Wget supports proxy servers, which can lighten the network load, speed up retrieval and provide access behind firewalls. Wget uses the passive FTP downloading by default, active FTP being an option. * Wget supports IP version 6, the next generation of IP. IPv6 is autodetected at compile-time, and can be disabled at either build or run time. Binaries built with IPv6 support work well in both IPv4-only and dual family environments. * Built-in features offer mechanisms to tune which links you wish to follow (*note Following Links::). * The progress of individual downloads is traced using a progress gauge. Interactive downloads are tracked using a "thermometer"-style gauge, whereas non-interactive ones are traced with dots, each dot representing a fixed amount of data received (1KB by default). Either gauge can be customized to your preferences. * Most of the features are fully configurable, either through command line options, or via the initialization file `.wgetrc' (*note Startup File::). Wget allows you to define "global" startup files (`/usr/local/etc/wgetrc' by default) for site settings. You can also specify the location of a startup file with the -config option. * Finally, GNU Wget is free software. This means that everyone may use it, redistribute it and/or modify it under the terms of the GNU General Public License, as published by the Free Software Foundation (see the file `COPYING' that came with GNU Wget, for details).  File: wget.info, Node: Invoking, Next: Recursive Download, Prev: Overview, Up: Top 2 Invoking ********** By default, Wget is very simple to invoke. The basic syntax is: wget [OPTION]... [URL]... Wget will simply download all the URLs specified on the command line. URL is a "Uniform Resource Locator", as defined below. However, you may wish to change some of the default parameters of Wget. You can do it two ways: permanently, adding the appropriate command to `.wgetrc' (*note Startup File::), or specifying it on the command line. * Menu: * URL Format:: * Option Syntax:: * Basic Startup Options:: * Logging and Input File Options:: * Download Options:: * Directory Options:: * HTTP Options:: * HTTPS (SSL/TLS) Options:: * FTP Options:: * Recursive Retrieval Options:: * Recursive Accept/Reject Options:: * Exit Status::  File: wget.info, Node: URL Format, Next: Option Syntax, Prev: Invoking, Up: Invoking 2.1 URL Format ============== "URL" is an acronym for Uniform Resource Locator. A uniform resource locator is a compact string representation for a resource available via the Internet. Wget recognizes the URL syntax as per RFC1738. This is the most widely used form (square brackets denote optional parts): http://host[:port]/directory/file ftp://host[:port]/directory/file You can also encode your username and password within a URL: ftp://user:password@host/path http://user:password@host/path Either USER or PASSWORD, or both, may be left out. If you leave out either the HTTP username or password, no authentication will be sent. If you leave out the FTP username, `anonymous' will be used. If you leave out the FTP password, your email address will be supplied as a default password.(1) *Important Note*: if you specify a password-containing URL on the command line, the username and password will be plainly visible to all users on the system, by way of `ps'. On multi-user systems, this is a big security risk. To work around it, use `wget -i -' and feed the URLs to Wget's standard input, each on a separate line, terminated by `C-d'. You can encode unsafe characters in a URL as `%xy', `xy' being the hexadecimal representation of the character's ASCII value. Some common unsafe characters include `%' (quoted as `%25'), `:' (quoted as `%3A'), and `@' (quoted as `%40'). Refer to RFC1738 for a comprehensive list of unsafe characters. Wget also supports the `type' feature for FTP URLs. By default, FTP documents are retrieved in the binary mode (type `i'), which means that they are downloaded unchanged. Another useful mode is the `a' ("ASCII") mode, which converts the line delimiters between the different operating systems, and is thus useful for text files. Here is an example: ftp://host/directory/file;type=a Two alternative variants of URL specification are also supported, because of historical (hysterical?) reasons and their widespreaded use. FTP-only syntax (supported by `NcFTP'): host:/dir/file HTTP-only syntax (introduced by `Netscape'): host[:port]/dir/file These two alternative forms are deprecated, and may cease being supported in the future. If you do not understand the difference between these notations, or do not know which one to use, just use the plain ordinary format you use with your favorite browser, like `Lynx' or `Netscape'. ---------- Footnotes ---------- (1) If you have a `.netrc' file in your home directory, password will also be searched for there.  File: wget.info, Node: Option Syntax, Next: Basic Startup Options, Prev: URL Format, Up: Invoking 2.2 Option Syntax ================= Since Wget uses GNU getopt to process command-line arguments, every option has a long form along with the short one. Long options are more convenient to remember, but take time to type. You may freely mix different option styles, or specify options after the command-line arguments. Thus you may write: wget -r --tries=10 http://fly.srk.fer.hr/ -o log The space between the option accepting an argument and the argument may be omitted. Instead of `-o log' you can write `-olog'. You may put several options that do not require arguments together, like: wget -drc URL This is completely equivalent to: wget -d -r -c URL Since the options can be specified after the arguments, you may terminate them with `--'. So the following will try to download URL `-x', reporting failure to `log': wget -o log -- -x The options that accept comma-separated lists all respect the convention that specifying an empty list clears its value. This can be useful to clear the `.wgetrc' settings. For instance, if your `.wgetrc' sets `exclude_directories' to `/cgi-bin', the following example will first reset it, and then set it to exclude `/~nobody' and `/~somebody'. You can also clear the lists in `.wgetrc' (*note Wgetrc Syntax::). wget -X '' -X /~nobody,/~somebody Most options that do not accept arguments are "boolean" options, so named because their state can be captured with a yes-or-no ("boolean") variable. For example, `--follow-ftp' tells Wget to follow FTP links from HTML files and, on the other hand, `--no-glob' tells it not to perform file globbing on FTP URLs. A boolean option is either "affirmative" or "negative" (beginning with `--no'). All such options share several properties. Unless stated otherwise, it is assumed that the default behavior is the opposite of what the option accomplishes. For example, the documented existence of `--follow-ftp' assumes that the default is to _not_ follow FTP links from HTML pages. Affirmative options can be negated by prepending the `--no-' to the option name; negative options can be negated by omitting the `--no-' prefix. This might seem superfluous--if the default for an affirmative option is to not do something, then why provide a way to explicitly turn it off? But the startup file may in fact change the default. For instance, using `follow_ftp = on' in `.wgetrc' makes Wget _follow_ FTP links by default, and using `--no-follow-ftp' is the only way to restore the factory default from the command line.  File: wget.info, Node: Basic Startup Options, Next: Logging and Input File Options, Prev: Option Syntax, Up: Invoking 2.3 Basic Startup Options ========================= `-V' `--version' Display the version of Wget. `-h' `--help' Print a help message describing all of Wget's command-line options. `-b' `--background' Go to background immediately after startup. If no output file is specified via the `-o', output is redirected to `wget-log'. `-e COMMAND' `--execute COMMAND' Execute COMMAND as if it were a part of `.wgetrc' (*note Startup File::). A command thus invoked will be executed _after_ the commands in `.wgetrc', thus taking precedence over them. If you need to specify more than one wgetrc command, use multiple instances of `-e'.  File: wget.info, Node: Logging and Input File Options, Next: Download Options, Prev: Basic Startup Options, Up: Invoking 2.4 Logging and Input File Options ================================== `-o LOGFILE' `--output-file=LOGFILE' Log all messages to LOGFILE. The messages are normally reported to standard error. `-a LOGFILE' `--append-output=LOGFILE' Append to LOGFILE. This is the same as `-o', only it appends to LOGFILE instead of overwriting the old log file. If LOGFILE does not exist, a new file is created. `-d' `--debug' Turn on debug output, meaning various information important to the developers of Wget if it does not work properly. Your system administrator may have chosen to compile Wget without debug support, in which case `-d' will not work. Please note that compiling with debug support is always safe--Wget compiled with the debug support will _not_ print any debug info unless requested with `-d'. *Note Reporting Bugs::, for more information on how to use `-d' for sending bug reports. `-q' `--quiet' Turn off Wget's output. `-v' `--verbose' Turn on verbose output, with all the available data. The default output is verbose. `-nv' `--no-verbose' Turn off verbose without being completely quiet (use `-q' for that), which means that error messages and basic information still get printed. `-i FILE' `--input-file=FILE' Read URLs from a local or external FILE. If `-' is specified as FILE, URLs are read from the standard input. (Use `./-' to read from a file literally named `-'.) If this function is used, no URLs need be present on the command line. If there are URLs both on the command line and in an input file, those on the command lines will be the first ones to be retrieved. If `--force-html' is not specified, then FILE should consist of a series of URLs, one per line. However, if you specify `--force-html', the document will be regarded as `html'. In that case you may have problems with relative links, which you can solve either by adding `' to the documents or by specifying `--base=URL' on the command line. If the FILE is an external one, the document will be automatically treated as `html' if the Content-Type matches `text/html'. Furthermore, the FILE's location will be implicitly used as base href if none was specified. `-F' `--force-html' When input is read from a file, force it to be treated as an HTML file. This enables you to retrieve relative links from existing HTML files on your local disk, by adding `' to HTML, or using the `--base' command-line option. `-B URL' `--base=URL' Resolves relative links using URL as the point of reference, when reading links from an HTML file specified via the `-i'/`--input-file' option (together with `--force-html', or when the input file was fetched remotely from a server describing it as HTML). This is equivalent to the presence of a `BASE' tag in the HTML input file, with URL as the value for the `href' attribute. For instance, if you specify `http://foo/bar/a.html' for URL, and Wget reads `../baz/b.html' from the input file, it would be resolved to `http://foo/baz/b.html'. `--config=FILE' Specify the location of a startup file you wish to use.  File: wget.info, Node: Download Options, Next: Directory Options, Prev: Logging and Input File Options, Up: Invoking 2.5 Download Options ==================== `--bind-address=ADDRESS' When making client TCP/IP connections, bind to ADDRESS on the local machine. ADDRESS may be specified as a hostname or IP address. This option can be useful if your machine is bound to multiple IPs. `-t NUMBER' `--tries=NUMBER' Set number of retries to NUMBER. Specify 0 or `inf' for infinite retrying. The default is to retry 20 times, with the exception of fatal errors like "connection refused" or "not found" (404), which are not retried. `-O FILE' `--output-document=FILE' The documents will not be written to the appropriate files, but all will be concatenated together and written to FILE. If `-' is used as FILE, documents will be printed to standard output, disabling link conversion. (Use `./-' to print to a file literally named `-'.) Use of `-O' is _not_ intended to mean simply "use the name FILE instead of the one in the URL;" rather, it is analogous to shell redirection: `wget -O file http://foo' is intended to work like `wget -O - http://foo > file'; `file' will be truncated immediately, and _all_ downloaded content will be written there. For this reason, `-N' (for timestamp-checking) is not supported in combination with `-O': since FILE is always newly created, it will always have a very new timestamp. A warning will be issued if this combination is used. Similarly, using `-r' or `-p' with `-O' may not work as you expect: Wget won't just download the first file to FILE and then download the rest to their normal names: _all_ downloaded content will be placed in FILE. This was disabled in version 1.11, but has been reinstated (with a warning) in 1.11.2, as there are some cases where this behavior can actually have some use. Note that a combination with `-k' is only permitted when downloading a single document, as in that case it will just convert all relative URIs to external ones; `-k' makes no sense for multiple URIs when they're all being downloaded to a single file; `-k' can be used only when the output is a regular file. `-nc' `--no-clobber' If a file is downloaded more than once in the same directory, Wget's behavior depends on a few options, including `-nc'. In certain cases, the local file will be "clobbered", or overwritten, upon repeated download. In other cases it will be preserved. When running Wget without `-N', `-nc', `-r', or `-p', downloading the same file in the same directory will result in the original copy of FILE being preserved and the second copy being named `FILE.1'. If that file is downloaded yet again, the third copy will be named `FILE.2', and so on. (This is also the behavior with `-nd', even if `-r' or `-p' are in effect.) When `-nc' is specified, this behavior is suppressed, and Wget will refuse to download newer copies of `FILE'. Therefore, "`no-clobber'" is actually a misnomer in this mode--it's not clobbering that's prevented (as the numeric suffixes were already preventing clobbering), but rather the multiple version saving that's prevented. When running Wget with `-r' or `-p', but without `-N', `-nd', or `-nc', re-downloading a file will result in the new copy simply overwriting the old. Adding `-nc' will prevent this behavior, instead causing the original version to be preserved and any newer copies on the server to be ignored. When running Wget with `-N', with or without `-r' or `-p', the decision as to whether or not to download a newer copy of a file depends on the local and remote timestamp and size of the file (*note Time-Stamping::). `-nc' may not be specified at the same time as `-N'. Note that when `-nc' is specified, files with the suffixes `.html' or `.htm' will be loaded from the local disk and parsed as if they had been retrieved from the Web. `-c' `--continue' Continue getting a partially-downloaded file. This is useful when you want to finish up a download started by a previous instance of Wget, or by another program. For instance: wget -c ftp://sunsite.doc.ic.ac.uk/ls-lR.Z If there is a file named `ls-lR.Z' in the current directory, Wget will assume that it is the first portion of the remote file, and will ask the server to continue the retrieval from an offset equal to the length of the local file. Note that you don't need to specify this option if you just want the current invocation of Wget to retry downloading a file should the connection be lost midway through. This is the default behavior. `-c' only affects resumption of downloads started _prior_ to this invocation of Wget, and whose local files are still sitting around. Without `-c', the previous example would just download the remote file to `ls-lR.Z.1', leaving the truncated `ls-lR.Z' file alone. Beginning with Wget 1.7, if you use `-c' on a non-empty file, and it turns out that the server does not support continued downloading, Wget will refuse to start the download from scratch, which would effectively ruin existing contents. If you really want the download to start from scratch, remove the file. Also beginning with Wget 1.7, if you use `-c' on a file which is of equal size as the one on the server, Wget will refuse to download the file and print an explanatory message. The same happens when the file is smaller on the server than locally (presumably because it was changed on the server since your last download attempt)--because "continuing" is not meaningful, no download occurs. On the other side of the coin, while using `-c', any file that's bigger on the server than locally will be considered an incomplete download and only `(length(remote) - length(local))' bytes will be downloaded and tacked onto the end of the local file. This behavior can be desirable in certain cases--for instance, you can use `wget -c' to download just the new portion that's been appended to a data collection or log file. However, if the file is bigger on the server because it's been _changed_, as opposed to just _appended_ to, you'll end up with a garbled file. Wget has no way of verifying that the local file is really a valid prefix of the remote file. You need to be especially careful of this when using `-c' in conjunction with `-r', since every file will be considered as an "incomplete download" candidate. Another instance where you'll get a garbled file if you try to use `-c' is if you have a lame HTTP proxy that inserts a "transfer interrupted" string into the local file. In the future a "rollback" option may be added to deal with this case. Note that `-c' only works with FTP servers and with HTTP servers that support the `Range' header. `--progress=TYPE' Select the type of the progress indicator you wish to use. Legal indicators are "dot" and "bar". The "bar" indicator is used by default. It draws an ASCII progress bar graphics (a.k.a "thermometer" display) indicating the status of retrieval. If the output is not a TTY, the "dot" bar will be used by default. Use `--progress=dot' to switch to the "dot" display. It traces the retrieval by printing dots on the screen, each dot representing a fixed amount of downloaded data. When using the dotted retrieval, you may also set the "style" by specifying the type as `dot:STYLE'. Different styles assign different meaning to one dot. With the `default' style each dot represents 1K, there are ten dots in a cluster and 50 dots in a line. The `binary' style has a more "computer"-like orientation--8K dots, 16-dots clusters and 48 dots per line (which makes for 384K lines). The `mega' style is suitable for downloading very large files--each dot represents 64K retrieved, there are eight dots in a cluster, and 48 dots on each line (so each line contains 3M). Note that you can set the default style using the `progress' command in `.wgetrc'. That setting may be overridden from the command line. The exception is that, when the output is not a TTY, the "dot" progress will be favored over "bar". To force the bar output, use `--progress=bar:force'. `-N' `--timestamping' Turn on time-stamping. *Note Time-Stamping::, for details. `--no-use-server-timestamps' Don't set the local file's timestamp by the one on the server. By default, when a file is downloaded, it's timestamps are set to match those from the remote file. This allows the use of `--timestamping' on subsequent invocations of wget. However, it is sometimes useful to base the local file's timestamp on when it was actually downloaded; for that purpose, the `--no-use-server-timestamps' option has been provided. `-S' `--server-response' Print the headers sent by HTTP servers and responses sent by FTP servers. `--spider' When invoked with this option, Wget will behave as a Web "spider", which means that it will not download the pages, just check that they are there. For example, you can use Wget to check your bookmarks: wget --spider --force-html -i bookmarks.html This feature needs much more work for Wget to get close to the functionality of real web spiders. `-T seconds' `--timeout=SECONDS' Set the network timeout to SECONDS seconds. This is equivalent to specifying `--dns-timeout', `--connect-timeout', and `--read-timeout', all at the same time. When interacting with the network, Wget can check for timeout and abort the operation if it takes too long. This prevents anomalies like hanging reads and infinite connects. The only timeout enabled by default is a 900-second read timeout. Setting a timeout to 0 disables it altogether. Unless you know what you are doing, it is best not to change the default timeout settings. All timeout-related options accept decimal values, as well as subsecond values. For example, `0.1' seconds is a legal (though unwise) choice of timeout. Subsecond timeouts are useful for checking server response times or for testing network latency. `--dns-timeout=SECONDS' Set the DNS lookup timeout to SECONDS seconds. DNS lookups that don't complete within the specified time will fail. By default, there is no timeout on DNS lookups, other than that implemented by system libraries. `--connect-timeout=SECONDS' Set the connect timeout to SECONDS seconds. TCP connections that take longer to establish will be aborted. By default, there is no connect timeout, other than that implemented by system libraries. `--read-timeout=SECONDS' Set the read (and write) timeout to SECONDS seconds. The "time" of this timeout refers to "idle time": if, at any point in the download, no data is received for more than the specified number of seconds, reading fails and the download is restarted. This option does not directly affect the duration of the entire download. Of course, the remote server may choose to terminate the connection sooner than this option requires. The default read timeout is 900 seconds. `--limit-rate=AMOUNT' Limit the download speed to AMOUNT bytes per second. Amount may be expressed in bytes, kilobytes with the `k' suffix, or megabytes with the `m' suffix. For example, `--limit-rate=20k' will limit the retrieval rate to 20KB/s. This is useful when, for whatever reason, you don't want Wget to consume the entire available bandwidth. This option allows the use of decimal numbers, usually in conjunction with power suffixes; for example, `--limit-rate=2.5k' is a legal value. Note that Wget implements the limiting by sleeping the appropriate amount of time after a network read that took less time than specified by the rate. Eventually this strategy causes the TCP transfer to slow down to approximately the specified rate. However, it may take some time for this balance to be achieved, so don't be surprised if limiting the rate doesn't work well with very small files. `-w SECONDS' `--wait=SECONDS' Wait the specified number of seconds between the retrievals. Use of this option is recommended, as it lightens the server load by making the requests less frequent. Instead of in seconds, the time can be specified in minutes using the `m' suffix, in hours using `h' suffix, or in days using `d' suffix. Specifying a large value for this option is useful if the network or the destination host is down, so that Wget can wait long enough to reasonably expect the network error to be fixed before the retry. The waiting interval specified by this function is influenced by `--random-wait', which see. `--waitretry=SECONDS' If you don't want Wget to wait between _every_ retrieval, but only between retries of failed downloads, you can use this option. Wget will use "linear backoff", waiting 1 second after the first failure on a given file, then waiting 2 seconds after the second failure on that file, up to the maximum number of SECONDS you specify. By default, Wget will assume a value of 10 seconds. `--random-wait' Some web sites may perform log analysis to identify retrieval programs such as Wget by looking for statistically significant similarities in the time between requests. This option causes the time between requests to vary between 0.5 and 1.5 * WAIT seconds, where WAIT was specified using the `--wait' option, in order to mask Wget's presence from such analysis. A 2001 article in a publication devoted to development on a popular consumer platform provided code to perform this analysis on the fly. Its author suggested blocking at the class C address level to ensure automated retrieval programs were blocked despite changing DHCP-supplied addresses. The `--random-wait' option was inspired by this ill-advised recommendation to block many unrelated users from a web site due to the actions of one. `--no-proxy' Don't use proxies, even if the appropriate `*_proxy' environment variable is defined. For more information about the use of proxies with Wget, *Note Proxies::. `-Q QUOTA' `--quota=QUOTA' Specify download quota for automatic retrievals. The value can be specified in bytes (default), kilobytes (with `k' suffix), or megabytes (with `m' suffix). Note that quota will never affect downloading a single file. So if you specify `wget -Q10k ftp://wuarchive.wustl.edu/ls-lR.gz', all of the `ls-lR.gz' will be downloaded. The same goes even when several URLs are specified on the command-line. However, quota is respected when retrieving either recursively, or from an input file. Thus you may safely type `wget -Q2m -i sites'--download will be aborted when the quota is exceeded. Setting quota to 0 or to `inf' unlimits the download quota. `--no-dns-cache' Turn off caching of DNS lookups. Normally, Wget remembers the IP addresses it looked up from DNS so it doesn't have to repeatedly contact the DNS server for the same (typically small) set of hosts it retrieves from. This cache exists in memory only; a new Wget run will contact DNS again. However, it has been reported that in some situations it is not desirable to cache host names, even for the duration of a short-running application like Wget. With this option Wget issues a new DNS lookup (more precisely, a new call to `gethostbyname' or `getaddrinfo') each time it makes a new connection. Please note that this option will _not_ affect caching that might be performed by the resolving library or by an external caching layer, such as NSCD. If you don't understand exactly what this option does, you probably won't need it. `--restrict-file-names=MODES' Change which characters found in remote URLs must be escaped during generation of local filenames. Characters that are "restricted" by this option are escaped, i.e. replaced with `%HH', where `HH' is the hexadecimal number that corresponds to the restricted character. This option may also be used to force all alphabetical cases to be either lower- or uppercase. By default, Wget escapes the characters that are not valid or safe as part of file names on your operating system, as well as control characters that are typically unprintable. This option is useful for changing these defaults, perhaps because you are downloading to a non-native partition, or because you want to disable escaping of the control characters, or you want to further restrict characters to only those in the ASCII range of values. The MODES are a comma-separated set of text values. The acceptable values are `unix', `windows', `nocontrol', `ascii', `lowercase', and `uppercase'. The values `unix' and `windows' are mutually exclusive (one will override the other), as are `lowercase' and `uppercase'. Those last are special cases, as they do not change the set of characters that would be escaped, but rather force local file paths to be converted either to lower- or uppercase. When "unix" is specified, Wget escapes the character `/' and the control characters in the ranges 0-31 and 128-159. This is the default on Unix-like operating systems. When "windows" is given, Wget escapes the characters `\', `|', `/', `:', `?', `"', `*', `<', `>', and the control characters in the ranges 0-31 and 128-159. In addition to this, Wget in Windows mode uses `+' instead of `:' to separate host and port in local file names, and uses `@' instead of `?' to separate the query portion of the file name from the rest. Therefore, a URL that would be saved as `www.xemacs.org:4300/search.pl?input=blah' in Unix mode would be saved as `www.xemacs.org+4300/search.pl@input=blah' in Windows mode. This mode is the default on Windows. If you specify `nocontrol', then the escaping of the control characters is also switched off. This option may make sense when you are downloading URLs whose names contain UTF-8 characters, on a system which can save and display filenames in UTF-8 (some possible byte values used in UTF-8 byte sequences fall in the range of values designated by Wget as "controls"). The `ascii' mode is used to specify that any bytes whose values are outside the range of ASCII characters (that is, greater than 127) shall be escaped. This can be useful when saving filenames whose encoding does not match the one used locally. `-4' `--inet4-only' `-6' `--inet6-only' Force connecting to IPv4 or IPv6 addresses. With `--inet4-only' or `-4', Wget will only connect to IPv4 hosts, ignoring AAAA records in DNS, and refusing to connect to IPv6 addresses specified in URLs. Conversely, with `--inet6-only' or `-6', Wget will only connect to IPv6 hosts and ignore A records and IPv4 addresses. Neither options should be needed normally. By default, an IPv6-aware Wget will use the address family specified by the host's DNS record. If the DNS responds with both IPv4 and IPv6 addresses, Wget will try them in sequence until it finds one it can connect to. (Also see `--prefer-family' option described below.) These options can be used to deliberately force the use of IPv4 or IPv6 address families on dual family systems, usually to aid debugging or to deal with broken network configuration. Only one of `--inet6-only' and `--inet4-only' may be specified at the same time. Neither option is available in Wget compiled without IPv6 support. `--prefer-family=none/IPv4/IPv6' When given a choice of several addresses, connect to the addresses with specified address family first. The address order returned by DNS is used without change by default. This avoids spurious errors and connect attempts when accessing hosts that resolve to both IPv6 and IPv4 addresses from IPv4 networks. For example, `www.kame.net' resolves to `2001:200:0:8002:203:47ff:fea5:3085' and to `203.178.141.194'. When the preferred family is `IPv4', the IPv4 address is used first; when the preferred family is `IPv6', the IPv6 address is used first; if the specified value is `none', the address order returned by DNS is used without change. Unlike `-4' and `-6', this option doesn't inhibit access to any address family, it only changes the _order_ in which the addresses are accessed. Also note that the reordering performed by this option is "stable"--it doesn't affect order of addresses of the same family. That is, the relative order of all IPv4 addresses and of all IPv6 addresses remains intact in all cases. `--retry-connrefused' Consider "connection refused" a transient error and try again. Normally Wget gives up on a URL when it is unable to connect to the site because failure to connect is taken as a sign that the server is not running at all and that retries would not help. This option is for mirroring unreliable sites whose servers tend to disappear for short periods of time. `--user=USER' `--password=PASSWORD' Specify the username USER and password PASSWORD for both FTP and HTTP file retrieval. These parameters can be overridden using the `--ftp-user' and `--ftp-password' options for FTP connections and the `--http-user' and `--http-password' options for HTTP connections. `--ask-password' Prompt for a password for each connection established. Cannot be specified when `--password' is being used, because they are mutually exclusive. `--no-iri' Turn off internationalized URI (IRI) support. Use `--iri' to turn it on. IRI support is activated by default. You can set the default state of IRI support using the `iri' command in `.wgetrc'. That setting may be overridden from the command line. `--local-encoding=ENCODING' Force Wget to use ENCODING as the default system encoding. That affects how Wget converts URLs specified as arguments from locale to UTF-8 for IRI support. Wget use the function `nl_langinfo()' and then the `CHARSET' environment variable to get the locale. If it fails, ASCII is used. You can set the default local encoding using the `local_encoding' command in `.wgetrc'. That setting may be overridden from the command line. `--remote-encoding=ENCODING' Force Wget to use ENCODING as the default remote server encoding. That affects how Wget converts URIs found in files from remote encoding to UTF-8 during a recursive fetch. This options is only useful for IRI support, for the interpretation of non-ASCII characters. For HTTP, remote encoding can be found in HTTP `Content-Type' header and in HTML `Content-Type http-equiv' meta tag. You can set the default encoding using the `remoteencoding' command in `.wgetrc'. That setting may be overridden from the command line. `--unlink' Force Wget to unlink file instead of clobbering existing file. This option is useful for downloading to the directory with hardlinks.  File: wget.info, Node: Directory Options, Next: HTTP Options, Prev: Download Options, Up: Invoking 2.6 Directory Options ===================== `-nd' `--no-directories' Do not create a hierarchy of directories when retrieving recursively. With this option turned on, all files will get saved to the current directory, without clobbering (if a name shows up more than once, the filenames will get extensions `.n'). `-x' `--force-directories' The opposite of `-nd'--create a hierarchy of directories, even if one would not have been created otherwise. E.g. `wget -x http://fly.srk.fer.hr/robots.txt' will save the downloaded file to `fly.srk.fer.hr/robots.txt'. `-nH' `--no-host-directories' Disable generation of host-prefixed directories. By default, invoking Wget with `-r http://fly.srk.fer.hr/' will create a structure of directories beginning with `fly.srk.fer.hr/'. This option disables such behavior. `--protocol-directories' Use the protocol name as a directory component of local file names. For example, with this option, `wget -r http://HOST' will save to `http/HOST/...' rather than just to `HOST/...'. `--cut-dirs=NUMBER' Ignore NUMBER directory components. This is useful for getting a fine-grained control over the directory where recursive retrieval will be saved. Take, for example, the directory at `ftp://ftp.xemacs.org/pub/xemacs/'. If you retrieve it with `-r', it will be saved locally under `ftp.xemacs.org/pub/xemacs/'. While the `-nH' option can remove the `ftp.xemacs.org/' part, you are still stuck with `pub/xemacs'. This is where `--cut-dirs' comes in handy; it makes Wget not "see" NUMBER remote directory components. Here are several examples of how `--cut-dirs' option works. No options -> ftp.xemacs.org/pub/xemacs/ -nH -> pub/xemacs/ -nH --cut-dirs=1 -> xemacs/ -nH --cut-dirs=2 -> . --cut-dirs=1 -> ftp.xemacs.org/xemacs/ ... If you just want to get rid of the directory structure, this option is similar to a combination of `-nd' and `-P'. However, unlike `-nd', `--cut-dirs' does not lose with subdirectories--for instance, with `-nH --cut-dirs=1', a `beta/' subdirectory will be placed to `xemacs/beta', as one would expect. `-P PREFIX' `--directory-prefix=PREFIX' Set directory prefix to PREFIX. The "directory prefix" is the directory where all other files and subdirectories will be saved to, i.e. the top of the retrieval tree. The default is `.' (the current directory).  File: wget.info, Node: HTTP Options, Next: HTTPS (SSL/TLS) Options, Prev: Directory Options, Up: Invoking 2.7 HTTP Options ================ `--default-page=NAME' Use NAME as the default file name when it isn't known (i.e., for URLs that end in a slash), instead of `index.html'. `-E' `--adjust-extension' If a file of type `application/xhtml+xml' or `text/html' is downloaded and the URL does not end with the regexp `\.[Hh][Tt][Mm][Ll]?', this option will cause the suffix `.html' to be appended to the local filename. This is useful, for instance, when you're mirroring a remote site that uses `.asp' pages, but you want the mirrored pages to be viewable on your stock Apache server. Another good use for this is when you're downloading CGI-generated materials. A URL like `http://site.com/article.cgi?25' will be saved as `article.cgi?25.html'. Note that filenames changed in this way will be re-downloaded every time you re-mirror a site, because Wget can't tell that the local `X.html' file corresponds to remote URL `X' (since it doesn't yet know that the URL produces output of type `text/html' or `application/xhtml+xml'. As of version 1.12, Wget will also ensure that any downloaded files of type `text/css' end in the suffix `.css', and the option was renamed from `--html-extension', to better reflect its new behavior. The old option name is still acceptable, but should now be considered deprecated. At some point in the future, this option may well be expanded to include suffixes for other types of content, including content types that are not parsed by Wget. `--http-user=USER' `--http-password=PASSWORD' Specify the username USER and password PASSWORD on an HTTP server. According to the type of the challenge, Wget will encode them using either the `basic' (insecure), the `digest', or the Windows `NTLM' authentication scheme. Another way to specify username and password is in the URL itself (*note URL Format::). Either method reveals your password to anyone who bothers to run `ps'. To prevent the passwords from being seen, store them in `.wgetrc' or `.netrc', and make sure to protect those files from other users with `chmod'. If the passwords are really important, do not leave them lying in those files either--edit the files and delete them after Wget has started the download. `--no-http-keep-alive' Turn off the "keep-alive" feature for HTTP downloads. Normally, Wget asks the server to keep the connection open so that, when you download more than one document from the same server, they get transferred over the same TCP connection. This saves time and at the same time reduces the load on the server. This option is useful when, for some reason, persistent (keep-alive) connections don't work for you, for example due to a server bug or due to the inability of server-side scripts to cope with the connections. `--no-cache' Disable server-side cache. In this case, Wget will send the remote server an appropriate directive (`Pragma: no-cache') to get the file from the remote service, rather than returning the cached version. This is especially useful for retrieving and flushing out-of-date documents on proxy servers. Caching is allowed by default. `--no-cookies' Disable the use of cookies. Cookies are a mechanism for maintaining server-side state. The server sends the client a cookie using the `Set-Cookie' header, and the client responds with the same cookie upon further requests. Since cookies allow the server owners to keep track of visitors and for sites to exchange this information, some consider them a breach of privacy. The default is to use cookies; however, _storing_ cookies is not on by default. `--load-cookies FILE' Load cookies from FILE before the first HTTP retrieval. FILE is a textual file in the format originally used by Netscape's `cookies.txt' file. You will typically use this option when mirroring sites that require that you be logged in to access some or all of their content. The login process typically works by the web server issuing an HTTP cookie upon receiving and verifying your credentials. The cookie is then resent by the browser when accessing that part of the site, and so proves your identity. Mirroring such a site requires Wget to send the same cookies your browser sends when communicating with the site. This is achieved by `--load-cookies'--simply point Wget to the location of the `cookies.txt' file, and it will send the same cookies your browser would send in the same situation. Different browsers keep textual cookie files in different locations: Netscape 4.x. The cookies are in `~/.netscape/cookies.txt'. Mozilla and Netscape 6.x. Mozilla's cookie file is also named `cookies.txt', located somewhere under `~/.mozilla', in the directory of your profile. The full path usually ends up looking somewhat like `~/.mozilla/default/SOME-WEIRD-STRING/cookies.txt'. Internet Explorer. You can produce a cookie file Wget can use by using the File menu, Import and Export, Export Cookies. This has been tested with Internet Explorer 5; it is not guaranteed to work with earlier versions. Other browsers. If you are using a different browser to create your cookies, `--load-cookies' will only work if you can locate or produce a cookie file in the Netscape format that Wget expects. If you cannot use `--load-cookies', there might still be an alternative. If your browser supports a "cookie manager", you can use it to view the cookies used when accessing the site you're mirroring. Write down the name and value of the cookie, and manually instruct Wget to send those cookies, bypassing the "official" cookie support: wget --no-cookies --header "Cookie: NAME=VALUE" `--save-cookies FILE' Save cookies to FILE before exiting. This will not save cookies that have expired or that have no expiry time (so-called "session cookies"), but also see `--keep-session-cookies'. `--keep-session-cookies' When specified, causes `--save-cookies' to also save session cookies. Session cookies are normally not saved because they are meant to be kept in memory and forgotten when you exit the browser. Saving them is useful on sites that require you to log in or to visit the home page before you can access some pages. With this option, multiple Wget runs are considered a single browser session as far as the site is concerned. Since the cookie file format does not normally carry session cookies, Wget marks them with an expiry timestamp of 0. Wget's `--load-cookies' recognizes those as session cookies, but it might confuse other browsers. Also note that cookies so loaded will be treated as other session cookies, which means that if you want `--save-cookies' to preserve them again, you must use `--keep-session-cookies' again. `--ignore-length' Unfortunately, some HTTP servers (CGI programs, to be more precise) send out bogus `Content-Length' headers, which makes Wget go wild, as it thinks not all the document was retrieved. You can spot this syndrome if Wget retries getting the same document again and again, each time claiming that the (otherwise normal) connection has closed on the very same byte. With this option, Wget will ignore the `Content-Length' header--as if it never existed. `--header=HEADER-LINE' Send HEADER-LINE along with the rest of the headers in each HTTP request. The supplied header is sent as-is, which means it must contain name and value separated by colon, and must not contain newlines. You may define more than one additional header by specifying `--header' more than once. wget --header='Accept-Charset: iso-8859-2' \ --header='Accept-Language: hr' \ http://fly.srk.fer.hr/ Specification of an empty string as the header value will clear all previous user-defined headers. As of Wget 1.10, this option can be used to override headers otherwise generated automatically. This example instructs Wget to connect to localhost, but to specify `foo.bar' in the `Host' header: wget --header="Host: foo.bar" http://localhost/ In versions of Wget prior to 1.10 such use of `--header' caused sending of duplicate headers. `--max-redirect=NUMBER' Specifies the maximum number of redirections to follow for a resource. The default is 20, which is usually far more than necessary. However, on those occasions where you want to allow more (or fewer), this is the option to use. `--proxy-user=USER' `--proxy-password=PASSWORD' Specify the username USER and password PASSWORD for authentication on a proxy server. Wget will encode them using the `basic' authentication scheme. Security considerations similar to those with `--http-password' pertain here as well. `--referer=URL' Include `Referer: URL' header in HTTP request. Useful for retrieving documents with server-side processing that assume they are always being retrieved by interactive web browsers and only come out properly when Referer is set to one of the pages that point to them. `--save-headers' Save the headers sent by the HTTP server to the file, preceding the actual contents, with an empty line as the separator. `-U AGENT-STRING' `--user-agent=AGENT-STRING' Identify as AGENT-STRING to the HTTP server. The HTTP protocol allows the clients to identify themselves using a `User-Agent' header field. This enables distinguishing the WWW software, usually for statistical purposes or for tracing of protocol violations. Wget normally identifies as `Wget/VERSION', VERSION being the current version number of Wget. However, some sites have been known to impose the policy of tailoring the output according to the `User-Agent'-supplied information. While this is not such a bad idea in theory, it has been abused by servers denying information to clients other than (historically) Netscape or, more frequently, Microsoft Internet Explorer. This option allows you to change the `User-Agent' line issued by Wget. Use of this option is discouraged, unless you really know what you are doing. Specifying empty user agent with `--user-agent=""' instructs Wget not to send the `User-Agent' header in HTTP requests. `--post-data=STRING' `--post-file=FILE' Use POST as the method for all HTTP requests and send the specified data in the request body. `--post-data' sends STRING as data, whereas `--post-file' sends the contents of FILE. Other than that, they work in exactly the same way. In particular, they _both_ expect content of the form `key1=value1&key2=value2', with percent-encoding for special characters; the only difference is that one expects its content as a command-line parameter and the other accepts its content from a file. In particular, `--post-file' is _not_ for transmitting files as form attachments: those must appear as `key=value' data (with appropriate percent-coding) just like everything else. Wget does not currently support `multipart/form-data' for transmitting POST data; only `application/x-www-form-urlencoded'. Only one of `--post-data' and `--post-file' should be specified. Please be aware that Wget needs to know the size of the POST data in advance. Therefore the argument to `--post-file' must be a regular file; specifying a FIFO or something like `/dev/stdin' won't work. It's not quite clear how to work around this limitation inherent in HTTP/1.0. Although HTTP/1.1 introduces "chunked" transfer that doesn't require knowing the request length in advance, a client can't use chunked unless it knows it's talking to an HTTP/1.1 server. And it can't know that until it receives a response, which in turn requires the request to have been completed - a chicken-and-egg problem. Note: if Wget is redirected after the POST request is completed, it will not send the POST data to the redirected URL. This is because URLs that process POST often respond with a redirection to a regular page, which does not desire or accept POST. It is not completely clear that this behavior is optimal; if it doesn't work out, it might be changed in the future. This example shows how to log to a server using POST and then proceed to download the desired pages, presumably only accessible to authorized users: # Log in to the server. This can be done only once. wget --save-cookies cookies.txt \ --post-data 'user=foo&password=bar' \ http://server.com/auth.php # Now grab the page or pages we care about. wget --load-cookies cookies.txt \ -p http://server.com/interesting/article.php If the server is using session cookies to track user authentication, the above will not work because `--save-cookies' will not save them (and neither will browsers) and the `cookies.txt' file will be empty. In that case use `--keep-session-cookies' along with `--save-cookies' to force saving of session cookies. `--content-disposition' If this is set to on, experimental (not fully-functional) support for `Content-Disposition' headers is enabled. This can currently result in extra round-trips to the server for a `HEAD' request, and is known to suffer from a few bugs, which is why it is not currently enabled by default. This option is useful for some file-downloading CGI programs that use `Content-Disposition' headers to describe what the name of a downloaded file should be. `--trust-server-names' If this is set to on, on a redirect the last component of the redirection URL will be used as the local file name. By default it is used the last component in the original URL. `--auth-no-challenge' If this option is given, Wget will send Basic HTTP authentication information (plaintext username and password) for all requests, just like Wget 1.10.2 and prior did by default. Use of this option is not recommended, and is intended only to support some few obscure servers, which never send HTTP authentication challenges, but accept unsolicited auth info, say, in addition to form-based authentication.  File: wget.info, Node: HTTPS (SSL/TLS) Options, Next: FTP Options, Prev: HTTP Options, Up: Invoking 2.8 HTTPS (SSL/TLS) Options =========================== To support encrypted HTTP (HTTPS) downloads, Wget must be compiled with an external SSL library, currently OpenSSL. If Wget is compiled without SSL support, none of these options are available. `--secure-protocol=PROTOCOL' Choose the secure protocol to be used. Legal values are `auto', `SSLv2', `SSLv3', and `TLSv1'. If `auto' is used, the SSL library is given the liberty of choosing the appropriate protocol automatically, which is achieved by sending an SSLv2 greeting and announcing support for SSLv3 and TLSv1. This is the default. Specifying `SSLv2', `SSLv3', or `TLSv1' forces the use of the corresponding protocol. This is useful when talking to old and buggy SSL server implementations that make it hard for OpenSSL to choose the correct protocol version. Fortunately, such servers are quite rare. `--no-check-certificate' Don't check the server certificate against the available certificate authorities. Also don't require the URL host name to match the common name presented by the certificate. As of Wget 1.10, the default is to verify the server's certificate against the recognized certificate authorities, breaking the SSL handshake and aborting the download if the verification fails. Although this provides more secure downloads, it does break interoperability with some sites that worked with previous Wget versions, particularly those using self-signed, expired, or otherwise invalid certificates. This option forces an "insecure" mode of operation that turns the certificate verification errors into warnings and allows you to proceed. If you encounter "certificate verification" errors or ones saying that "common name doesn't match requested host name", you can use this option to bypass the verification and proceed with the download. _Only use this option if you are otherwise convinced of the site's authenticity, or if you really don't care about the validity of its certificate._ It is almost always a bad idea not to check the certificates when transmitting confidential or important data. `--certificate=FILE' Use the client certificate stored in FILE. This is needed for servers that are configured to require certificates from the clients that connect to them. Normally a certificate is not required and this switch is optional. `--certificate-type=TYPE' Specify the type of the client certificate. Legal values are `PEM' (assumed by default) and `DER', also known as `ASN1'. `--private-key=FILE' Read the private key from FILE. This allows you to provide the private key in a file separate from the certificate. `--private-key-type=TYPE' Specify the type of the private key. Accepted values are `PEM' (the default) and `DER'. `--ca-certificate=FILE' Use FILE as the file with the bundle of certificate authorities ("CA") to verify the peers. The certificates must be in PEM format. Without this option Wget looks for CA certificates at the system-specified locations, chosen at OpenSSL installation time. `--ca-directory=DIRECTORY' Specifies directory containing CA certificates in PEM format. Each file contains one CA certificate, and the file name is based on a hash value derived from the certificate. This is achieved by processing a certificate directory with the `c_rehash' utility supplied with OpenSSL. Using `--ca-directory' is more efficient than `--ca-certificate' when many certificates are installed because it allows Wget to fetch certificates on demand. Without this option Wget looks for CA certificates at the system-specified locations, chosen at OpenSSL installation time. `--random-file=FILE' Use FILE as the source of random data for seeding the pseudo-random number generator on systems without `/dev/random'. On such systems the SSL library needs an external source of randomness to initialize. Randomness may be provided by EGD (see `--egd-file' below) or read from an external source specified by the user. If this option is not specified, Wget looks for random data in `$RANDFILE' or, if that is unset, in `$HOME/.rnd'. If none of those are available, it is likely that SSL encryption will not be usable. If you're getting the "Could not seed OpenSSL PRNG; disabling SSL." error, you should provide random data using some of the methods described above. `--egd-file=FILE' Use FILE as the EGD socket. EGD stands for "Entropy Gathering Daemon", a user-space program that collects data from various unpredictable system sources and makes it available to other programs that might need it. Encryption software, such as the SSL library, needs sources of non-repeating randomness to seed the random number generator used to produce cryptographically strong keys. OpenSSL allows the user to specify his own source of entropy using the `RAND_FILE' environment variable. If this variable is unset, or if the specified file does not produce enough randomness, OpenSSL will read random data from EGD socket specified using this option. If this option is not specified (and the equivalent startup command is not used), EGD is never contacted. EGD is not needed on modern Unix systems that support `/dev/random'.  File: wget.info, Node: FTP Options, Next: Recursive Retrieval Options, Prev: HTTPS (SSL/TLS) Options, Up: Invoking 2.9 FTP Options =============== `--ftp-user=USER' `--ftp-password=PASSWORD' Specify the username USER and password PASSWORD on an FTP server. Without this, or the corresponding startup option, the password defaults to `-wget@', normally used for anonymous FTP. Another way to specify username and password is in the URL itself (*note URL Format::). Either method reveals your password to anyone who bothers to run `ps'. To prevent the passwords from being seen, store them in `.wgetrc' or `.netrc', and make sure to protect those files from other users with `chmod'. If the passwords are really important, do not leave them lying in those files either--edit the files and delete them after Wget has started the download. `--no-remove-listing' Don't remove the temporary `.listing' files generated by FTP retrievals. Normally, these files contain the raw directory listings received from FTP servers. Not removing them can be useful for debugging purposes, or when you want to be able to easily check on the contents of remote server directories (e.g. to verify that a mirror you're running is complete). Note that even though Wget writes to a known filename for this file, this is not a security hole in the scenario of a user making `.listing' a symbolic link to `/etc/passwd' or something and asking `root' to run Wget in his or her directory. Depending on the options used, either Wget will refuse to write to `.listing', making the globbing/recursion/time-stamping operation fail, or the symbolic link will be deleted and replaced with the actual `.listing' file, or the listing will be written to a `.listing.NUMBER' file. Even though this situation isn't a problem, though, `root' should never run Wget in a non-trusted user's directory. A user could do something as simple as linking `index.html' to `/etc/passwd' and asking `root' to run Wget with `-N' or `-r' so the file will be overwritten. `--no-glob' Turn off FTP globbing. Globbing refers to the use of shell-like special characters ("wildcards"), like `*', `?', `[' and `]' to retrieve more than one file from the same directory at once, like: wget ftp://gnjilux.srk.fer.hr/*.msg By default, globbing will be turned on if the URL contains a globbing character. This option may be used to turn globbing on or off permanently. You may have to quote the URL to protect it from being expanded by your shell. Globbing makes Wget look for a directory listing, which is system-specific. This is why it currently works only with Unix FTP servers (and the ones emulating Unix `ls' output). `--no-passive-ftp' Disable the use of the "passive" FTP transfer mode. Passive FTP mandates that the client connect to the server to establish the data connection rather than the other way around. If the machine is connected to the Internet directly, both passive and active FTP should work equally well. Behind most firewall and NAT configurations passive FTP has a better chance of working. However, in some rare firewall configurations, active FTP actually works when passive FTP doesn't. If you suspect this to be the case, use this option, or set `passive_ftp=off' in your init file. `--retr-symlinks' Usually, when retrieving FTP directories recursively and a symbolic link is encountered, the linked-to file is not downloaded. Instead, a matching symbolic link is created on the local filesystem. The pointed-to file will not be downloaded unless this recursive retrieval would have encountered it separately and downloaded it anyway. When `--retr-symlinks' is specified, however, symbolic links are traversed and the pointed-to files are retrieved. At this time, this option does not cause Wget to traverse symlinks to directories and recurse through them, but in the future it should be enhanced to do this. Note that when retrieving a file (not a directory) because it was specified on the command-line, rather than because it was recursed to, this option has no effect. Symbolic links are always traversed in this case.  File: wget.info, Node: Recursive Retrieval Options, Next: Recursive Accept/Reject Options, Prev: FTP Options, Up: Invoking 2.10 Recursive Retrieval Options ================================ `-r' `--recursive' Turn on recursive retrieving. *Note Recursive Download::, for more details. The default maximum depth is 5. `-l DEPTH' `--level=DEPTH' Specify recursion maximum depth level DEPTH (*note Recursive Download::). `--delete-after' This option tells Wget to delete every single file it downloads, _after_ having done so. It is useful for pre-fetching popular pages through a proxy, e.g.: wget -r -nd --delete-after http://whatever.com/~popular/page/ The `-r' option is to retrieve recursively, and `-nd' to not create directories. Note that `--delete-after' deletes files on the local machine. It does not issue the `DELE' command to remote FTP sites, for instance. Also note that when `--delete-after' is specified, `--convert-links' is ignored, so `.orig' files are simply not created in the first place. `-k' `--convert-links' After the download is complete, convert the links in the document to make them suitable for local viewing. This affects not only the visible hyperlinks, but any part of the document that links to external content, such as embedded images, links to style sheets, hyperlinks to non-HTML content, etc. Each link will be changed in one of the two ways: * The links to files that have been downloaded by Wget will be changed to refer to the file they point to as a relative link. Example: if the downloaded file `/foo/doc.html' links to `/bar/img.gif', also downloaded, then the link in `doc.html' will be modified to point to `../bar/img.gif'. This kind of transformation works reliably for arbitrary combinations of directories. * The links to files that have not been downloaded by Wget will be changed to include host name and absolute path of the location they point to. Example: if the downloaded file `/foo/doc.html' links to `/bar/img.gif' (or to `../bar/img.gif'), then the link in `doc.html' will be modified to point to `http://HOSTNAME/bar/img.gif'. Because of this, local browsing works reliably: if a linked file was downloaded, the link will refer to its local name; if it was not downloaded, the link will refer to its full Internet address rather than presenting a broken link. The fact that the former links are converted to relative links ensures that you can move the downloaded hierarchy to another directory. Note that only at the end of the download can Wget know which links have been downloaded. Because of that, the work done by `-k' will be performed at the end of all the downloads. `-K' `--backup-converted' When converting a file, back up the original version with a `.orig' suffix. Affects the behavior of `-N' (*note HTTP Time-Stamping Internals::). `-m' `--mirror' Turn on options suitable for mirroring. This option turns on recursion and time-stamping, sets infinite recursion depth and keeps FTP directory listings. It is currently equivalent to `-r -N -l inf --no-remove-listing'. `-p' `--page-requisites' This option causes Wget to download all the files that are necessary to properly display a given HTML page. This includes such things as inlined images, sounds, and referenced stylesheets. Ordinarily, when downloading a single HTML page, any requisite documents that may be needed to display it properly are not downloaded. Using `-r' together with `-l' can help, but since Wget does not ordinarily distinguish between external and inlined documents, one is generally left with "leaf documents" that are missing their requisites. For instance, say document `1.html' contains an `' tag referencing `1.gif' and an `' tag pointing to external document `2.html'. Say that `2.html' is similar but that its image is `2.gif' and it links to `3.html'. Say this continues up to some arbitrarily high number. If one executes the command: wget -r -l 2 http://SITE/1.html then `1.html', `1.gif', `2.html', `2.gif', and `3.html' will be downloaded. As you can see, `3.html' is without its requisite `3.gif' because Wget is simply counting the number of hops (up to 2) away from `1.html' in order to determine where to stop the recursion. However, with this command: wget -r -l 2 -p http://SITE/1.html all the above files _and_ `3.html''s requisite `3.gif' will be downloaded. Similarly, wget -r -l 1 -p http://SITE/1.html will cause `1.html', `1.gif', `2.html', and `2.gif' to be downloaded. One might think that: wget -r -l 0 -p http://SITE/1.html would download just `1.html' and `1.gif', but unfortunately this is not the case, because `-l 0' is equivalent to `-l inf'--that is, infinite recursion. To download a single HTML page (or a handful of them, all specified on the command-line or in a `-i' URL input file) and its (or their) requisites, simply leave off `-r' and `-l': wget -p http://SITE/1.html Note that Wget will behave as if `-r' had been specified, but only that single page and its requisites will be downloaded. Links from that page to external documents will not be followed. Actually, to download a single page and all its requisites (even if they exist on separate websites), and make sure the lot displays properly locally, this author likes to use a few options in addition to `-p': wget -E -H -k -K -p http://SITE/DOCUMENT To finish off this topic, it's worth knowing that Wget's idea of an external document link is any URL specified in an `' tag, an `' tag, or a `' tag other than `'. `--strict-comments' Turn on strict parsing of HTML comments. The default is to terminate comments at the first occurrence of `-->'. According to specifications, HTML comments are expressed as SGML "declarations". Declaration is special markup that begins with `', such as `', that may contain comments between a pair of `--' delimiters. HTML comments are "empty declarations", SGML declarations without any non-comment text. Therefore, `' is a valid comment, and so is `', but `' is not. On the other hand, most HTML writers don't perceive comments as anything other than text delimited with `', which is not quite the same. For example, something like `' works as a valid comment as long as the number of dashes is a multiple of four (!). If not, the comment technically lasts until the next `--', which may be at the other end of the document. Because of this, many popular browsers completely ignore the specification and implement what users have come to expect: comments delimited with `'. Until version 1.9, Wget interpreted comments strictly, which resulted in missing links in many web pages that displayed fine in browsers, but had the misfortune of containing non-compliant comments. Beginning with version 1.9, Wget has joined the ranks of clients that implements "naive" comments, terminating each comment at the first occurrence of `-->'. If, for whatever reason, you want strict comment parsing, use this option to turn it on.  File: wget.info, Node: Recursive Accept/Reject Options, Next: Exit Status, Prev: Recursive Retrieval Options, Up: Invoking 2.11 Recursive Accept/Reject Options ==================================== `-A ACCLIST --accept ACCLIST' `-R REJLIST --reject REJLIST' Specify comma-separated lists of file name suffixes or patterns to accept or reject (*note Types of Files::). Note that if any of the wildcard characters, `*', `?', `[' or `]', appear in an element of ACCLIST or REJLIST, it will be treated as a pattern, rather than a suffix. `-D DOMAIN-LIST' `--domains=DOMAIN-LIST' Set domains to be followed. DOMAIN-LIST is a comma-separated list of domains. Note that it does _not_ turn on `-H'. `--exclude-domains DOMAIN-LIST' Specify the domains that are _not_ to be followed (*note Spanning Hosts::). `--follow-ftp' Follow FTP links from HTML documents. Without this option, Wget will ignore all the FTP links. `--follow-tags=LIST' Wget has an internal table of HTML tag / attribute pairs that it considers when looking for linked documents during a recursive retrieval. If a user wants only a subset of those tags to be considered, however, he or she should be specify such tags in a comma-separated LIST with this option. `--ignore-tags=LIST' This is the opposite of the `--follow-tags' option. To skip certain HTML tags when recursively looking for documents to download, specify them in a comma-separated LIST. In the past, this option was the best bet for downloading a single page and its requisites, using a command-line like: wget --ignore-tags=a,area -H -k -K -r http://SITE/DOCUMENT However, the author of this option came across a page with tags like `' and came to the realization that specifying tags to ignore was not enough. One can't just tell Wget to ignore `', because then stylesheets will not be downloaded. Now the best bet for downloading a single page and its requisites is the dedicated `--page-requisites' option. `--ignore-case' Ignore case when matching files and directories. This influences the behavior of -R, -A, -I, and -X options, as well as globbing implemented when downloading from FTP sites. For example, with this option, `-A *.txt' will match `file1.txt', but also `file2.TXT', `file3.TxT', and so on. `-H' `--span-hosts' Enable spanning across hosts when doing recursive retrieving (*note Spanning Hosts::). `-L' `--relative' Follow relative links only. Useful for retrieving a specific home page without any distractions, not even those from the same hosts (*note Relative Links::). `-I LIST' `--include-directories=LIST' Specify a comma-separated list of directories you wish to follow when downloading (*note Directory-Based Limits::). Elements of LIST may contain wildcards. `-X LIST' `--exclude-directories=LIST' Specify a comma-separated list of directories you wish to exclude from download (*note Directory-Based Limits::). Elements of LIST may contain wildcards. `-np' `--no-parent' Do not ever ascend to the parent directory when retrieving recursively. This is a useful option, since it guarantees that only the files _below_ a certain hierarchy will be downloaded. *Note Directory-Based Limits::, for more details.  File: wget.info, Node: Exit Status, Prev: Recursive Accept/Reject Options, Up: Invoking 2.12 Exit Status ================ Wget may return one of several error codes if it encounters problems. 0 No problems occurred. 1 Generic error code. 2 Parse error--for instance, when parsing command-line options, the `.wgetrc' or `.netrc'... 3 File I/O error. 4 Network failure. 5 SSL verification failure. 6 Username/password authentication failure. 7 Protocol errors. 8 Server issued an error response. With the exceptions of 0 and 1, the lower-numbered exit codes take precedence over higher-numbered ones, when multiple types of errors are encountered. In versions of Wget prior to 1.12, Wget's exit status tended to be unhelpful and inconsistent. Recursive downloads would virtually always return 0 (success), regardless of any issues encountered, and non-recursive fetches only returned the status corresponding to the most recently-attempted download.  File: wget.info, Node: Recursive Download, Next: Following Links, Prev: Invoking, Up: Top 3 Recursive Download ******************** GNU Wget is capable of traversing parts of the Web (or a single HTTP or FTP server), following links and directory structure. We refer to this as to "recursive retrieval", or "recursion". With HTTP URLs, Wget retrieves and parses the HTML or CSS from the given URL, retrieving the files the document refers to, through markup like `href' or `src', or CSS URI values specified using the `url()' functional notation. If the freshly downloaded file is also of type `text/html', `application/xhtml+xml', or `text/css', it will be parsed and followed further. Recursive retrieval of HTTP and HTML/CSS content is "breadth-first". This means that Wget first downloads the requested document, then the documents linked from that document, then the documents linked by them, and so on. In other words, Wget first downloads the documents at depth 1, then those at depth 2, and so on until the specified maximum depth. The maximum "depth" to which the retrieval may descend is specified with the `-l' option. The default maximum depth is five layers. When retrieving an FTP URL recursively, Wget will retrieve all the data from the given directory tree (including the subdirectories up to the specified depth) on the remote server, creating its mirror image locally. FTP retrieval is also limited by the `depth' parameter. Unlike HTTP recursion, FTP recursion is performed depth-first. By default, Wget will create a local directory tree, corresponding to the one found on the remote server. Recursive retrieving can find a number of applications, the most important of which is mirroring. It is also useful for WWW presentations, and any other opportunities where slow network connections should be bypassed by storing the files locally. You should be warned that recursive downloads can overload the remote servers. Because of that, many administrators frown upon them and may ban access from your site if they detect very fast downloads of big amounts of content. When downloading from Internet servers, consider using the `-w' option to introduce a delay between accesses to the server. The download will take a while longer, but the server administrator will not be alarmed by your rudeness. Of course, recursive download may cause problems on your machine. If left to run unchecked, it can easily fill up the disk. If downloading from local network, it can also take bandwidth on the system, as well as consume memory and CPU. Try to specify the criteria that match the kind of download you are trying to achieve. If you want to download only one page, use `--page-requisites' without any additional recursion. If you want to download things under one directory, use `-np' to avoid downloading things from other directories. If you want to download all the files from one directory, use `-l 1' to make sure the recursion depth never exceeds one. *Note Following Links::, for more information about this. Recursive retrieval should be used with care. Don't say you were not warned.  File: wget.info, Node: Following Links, Next: Time-Stamping, Prev: Recursive Download, Up: Top 4 Following Links ***************** When retrieving recursively, one does not wish to retrieve loads of unnecessary data. Most of the time the users bear in mind exactly what they want to download, and want Wget to follow only specific links. For example, if you wish to download the music archive from `fly.srk.fer.hr', you will not want to download all the home pages that happen to be referenced by an obscure part of the archive. Wget possesses several mechanisms that allows you to fine-tune which links it will follow. * Menu: * Spanning Hosts:: (Un)limiting retrieval based on host name. * Types of Files:: Getting only certain files. * Directory-Based Limits:: Getting only certain directories. * Relative Links:: Follow relative links only. * FTP Links:: Following FTP links.  File: wget.info, Node: Spanning Hosts, Next: Types of Files, Prev: Following Links, Up: Following Links 4.1 Spanning Hosts ================== Wget's recursive retrieval normally refuses to visit hosts different than the one you specified on the command line. This is a reasonable default; without it, every retrieval would have the potential to turn your Wget into a small version of google. However, visiting different hosts, or "host spanning," is sometimes a useful option. Maybe the images are served from a different server. Maybe you're mirroring a site that consists of pages interlinked between three servers. Maybe the server has two equivalent names, and the HTML pages refer to both interchangeably. Span to any host--`-H' The `-H' option turns on host spanning, thus allowing Wget's recursive run to visit any host referenced by a link. Unless sufficient recursion-limiting criteria are applied depth, these foreign hosts will typically link to yet more hosts, and so on until Wget ends up sucking up much more data than you have intended. Limit spanning to certain domains--`-D' The `-D' option allows you to specify the domains that will be followed, thus limiting the recursion only to the hosts that belong to these domains. Obviously, this makes sense only in conjunction with `-H'. A typical example would be downloading the contents of `www.server.com', but allowing downloads from `images.server.com', etc.: wget -rH -Dserver.com http://www.server.com/ You can specify more than one address by separating them with a comma, e.g. `-Ddomain1.com,domain2.com'. Keep download off certain domains--`--exclude-domains' If there are domains you want to exclude specifically, you can do it with `--exclude-domains', which accepts the same type of arguments of `-D', but will _exclude_ all the listed domains. For example, if you want to download all the hosts from `foo.edu' domain, with the exception of `sunsite.foo.edu', you can do it like this: wget -rH -Dfoo.edu --exclude-domains sunsite.foo.edu \ http://www.foo.edu/  File: wget.info, Node: Types of Files, Next: Directory-Based Limits, Prev: Spanning Hosts, Up: Following Links 4.2 Types of Files ================== When downloading material from the web, you will often want to restrict the retrieval to only certain file types. For example, if you are interested in downloading GIFs, you will not be overjoyed to get loads of PostScript documents, and vice versa. Wget offers two options to deal with this problem. Each option description lists a short name, a long name, and the equivalent command in `.wgetrc'. `-A ACCLIST' `--accept ACCLIST' `accept = ACCLIST' The argument to `--accept' option is a list of file suffixes or patterns that Wget will download during recursive retrieval. A suffix is the ending part of a file, and consists of "normal" letters, e.g. `gif' or `.jpg'. A matching pattern contains shell-like wildcards, e.g. `books*' or `zelazny*196[0-9]*'. So, specifying `wget -A gif,jpg' will make Wget download only the files ending with `gif' or `jpg', i.e. GIFs and JPEGs. On the other hand, `wget -A "zelazny*196[0-9]*"' will download only files beginning with `zelazny' and containing numbers from 1960 to 1969 anywhere within. Look up the manual of your shell for a description of how pattern matching works. Of course, any number of suffixes and patterns can be combined into a comma-separated list, and given as an argument to `-A'. `-R REJLIST' `--reject REJLIST' `reject = REJLIST' The `--reject' option works the same way as `--accept', only its logic is the reverse; Wget will download all files _except_ the ones matching the suffixes (or patterns) in the list. So, if you want to download a whole page except for the cumbersome MPEGs and .AU files, you can use `wget -R mpg,mpeg,au'. Analogously, to download all files except the ones beginning with `bjork', use `wget -R "bjork*"'. The quotes are to prevent expansion by the shell. The `-A' and `-R' options may be combined to achieve even better fine-tuning of which files to retrieve. E.g. `wget -A "*zelazny*" -R .ps' will download all the files having `zelazny' as a part of their name, but _not_ the PostScript files. Note that these two options do not affect the downloading of HTML files (as determined by a `.htm' or `.html' filename prefix). This behavior may not be desirable for all users, and may be changed for future versions of Wget. Note, too, that query strings (strings at the end of a URL beginning with a question mark (`?') are not included as part of the filename for accept/reject rules, even though these will actually contribute to the name chosen for the local file. It is expected that a future version of Wget will provide an option to allow matching against query strings. Finally, it's worth noting that the accept/reject lists are matched _twice_ against downloaded files: once against the URL's filename portion, to determine if the file should be downloaded in the first place; then, after it has been accepted and successfully downloaded, the local file's name is also checked against the accept/reject lists to see if it should be removed. The rationale was that, since `.htm' and `.html' files are always downloaded regardless of accept/reject rules, they should be removed _after_ being downloaded and scanned for links, if they did match the accept/reject lists. However, this can lead to unexpected results, since the local filenames can differ from the original URL filenames in the following ways, all of which can change whether an accept/reject rule matches: * If the local file already exists and `--no-directories' was specified, a numeric suffix will be appended to the original name. * If `--adjust-extension' was specified, the local filename might have `.html' appended to it. If Wget is invoked with `-E -A.php', a filename such as `index.php' will match be accepted, but upon download will be named `index.php.html', which no longer matches, and so the file will be deleted. * Query strings do not contribute to URL matching, but are included in local filenames, and so _do_ contribute to filename matching. This behavior, too, is considered less-than-desirable, and may change in a future version of Wget.  File: wget.info, Node: Directory-Based Limits, Next: Relative Links, Prev: Types of Files, Up: Following Links 4.3 Directory-Based Limits ========================== Regardless of other link-following facilities, it is often useful to place the restriction of what files to retrieve based on the directories those files are placed in. There can be many reasons for this--the home pages may be organized in a reasonable directory structure; or some directories may contain useless information, e.g. `/cgi-bin' or `/dev' directories. Wget offers three different options to deal with this requirement. Each option description lists a short name, a long name, and the equivalent command in `.wgetrc'. `-I LIST' `--include LIST' `include_directories = LIST' `-I' option accepts a comma-separated list of directories included in the retrieval. Any other directories will simply be ignored. The directories are absolute paths. So, if you wish to download from `http://host/people/bozo/' following only links to bozo's colleagues in the `/people' directory and the bogus scripts in `/cgi-bin', you can specify: wget -I /people,/cgi-bin http://host/people/bozo/ `-X LIST' `--exclude LIST' `exclude_directories = LIST' `-X' option is exactly the reverse of `-I'--this is a list of directories _excluded_ from the download. E.g. if you do not want Wget to download things from `/cgi-bin' directory, specify `-X /cgi-bin' on the command line. The same as with `-A'/`-R', these two options can be combined to get a better fine-tuning of downloading subdirectories. E.g. if you want to load all the files from `/pub' hierarchy except for `/pub/worthless', specify `-I/pub -X/pub/worthless'. `-np' `--no-parent' `no_parent = on' The simplest, and often very useful way of limiting directories is disallowing retrieval of the links that refer to the hierarchy "above" than the beginning directory, i.e. disallowing ascent to the parent directory/directories. The `--no-parent' option (short `-np') is useful in this case. Using it guarantees that you will never leave the existing hierarchy. Supposing you issue Wget with: wget -r --no-parent http://somehost/~luzer/my-archive/ You may rest assured that none of the references to `/~his-girls-homepage/' or `/~luzer/all-my-mpegs/' will be followed. Only the archive you are interested in will be downloaded. Essentially, `--no-parent' is similar to `-I/~luzer/my-archive', only it handles redirections in a more intelligent fashion. *Note* that, for HTTP (and HTTPS), the trailing slash is very important to `--no-parent'. HTTP has no concept of a "directory"--Wget relies on you to indicate what's a directory and what isn't. In `http://foo/bar/', Wget will consider `bar' to be a directory, while in `http://foo/bar' (no trailing slash), `bar' will be considered a filename (so `--no-parent' would be meaningless, as its parent is `/').  File: wget.info, Node: Relative Links, Next: FTP Links, Prev: Directory-Based Limits, Up: Following Links 4.4 Relative Links ================== When `-L' is turned on, only the relative links are ever followed. Relative links are here defined those that do not refer to the web server root. For example, these links are relative: These links are not relative: Using this option guarantees that recursive retrieval will not span hosts, even without `-H'. In simple cases it also allows downloads to "just work" without having to convert links. This option is probably not very useful and might be removed in a future release.  File: wget.info, Node: FTP Links, Prev: Relative Links, Up: Following Links 4.5 Following FTP Links ======================= The rules for FTP are somewhat specific, as it is necessary for them to be. FTP links in HTML documents are often included for purposes of reference, and it is often inconvenient to download them by default. To have FTP links followed from HTML documents, you need to specify the `--follow-ftp' option. Having done that, FTP links will span hosts regardless of `-H' setting. This is logical, as FTP links rarely point to the same host where the HTTP server resides. For similar reasons, the `-L' options has no effect on such downloads. On the other hand, domain acceptance (`-D') and suffix rules (`-A' and `-R') apply normally. Also note that followed links to FTP directories will not be retrieved recursively further.  File: wget.info, Node: Time-Stamping, Next: Startup File, Prev: Following Links, Up: Top 5 Time-Stamping *************** One of the most important aspects of mirroring information from the Internet is updating your archives. Downloading the whole archive again and again, just to replace a few changed files is expensive, both in terms of wasted bandwidth and money, and the time to do the update. This is why all the mirroring tools offer the option of incremental updating. Such an updating mechanism means that the remote server is scanned in search of "new" files. Only those new files will be downloaded in the place of the old ones. A file is considered new if one of these two conditions are met: 1. A file of that name does not already exist locally. 2. A file of that name does exist, but the remote file was modified more recently than the local file. To implement this, the program needs to be aware of the time of last modification of both local and remote files. We call this information the "time-stamp" of a file. The time-stamping in GNU Wget is turned on using `--timestamping' (`-N') option, or through `timestamping = on' directive in `.wgetrc'. With this option, for each file it intends to download, Wget will check whether a local file of the same name exists. If it does, and the remote file is not newer, Wget will not download it. If the local file does not exist, or the sizes of the files do not match, Wget will download the remote file no matter what the time-stamps say. * Menu: * Time-Stamping Usage:: * HTTP Time-Stamping Internals:: * FTP Time-Stamping Internals::  File: wget.info, Node: Time-Stamping Usage, Next: HTTP Time-Stamping Internals, Prev: Time-Stamping, Up: Time-Stamping 5.1 Time-Stamping Usage ======================= The usage of time-stamping is simple. Say you would like to download a file so that it keeps its date of modification. wget -S http://www.gnu.ai.mit.edu/ A simple `ls -l' shows that the time stamp on the local file equals the state of the `Last-Modified' header, as returned by the server. As you can see, the time-stamping info is preserved locally, even without `-N' (at least for HTTP). Several days later, you would like Wget to check if the remote file has changed, and download it if it has. wget -N http://www.gnu.ai.mit.edu/ Wget will ask the server for the last-modified date. If the local file has the same timestamp as the server, or a newer one, the remote file will not be re-fetched. However, if the remote file is more recent, Wget will proceed to fetch it. The same goes for FTP. For example: wget "ftp://ftp.ifi.uio.no/pub/emacs/gnus/*" (The quotes around that URL are to prevent the shell from trying to interpret the `*'.) After download, a local directory listing will show that the timestamps match those on the remote server. Reissuing the command with `-N' will make Wget re-fetch _only_ the files that have been modified since the last download. If you wished to mirror the GNU archive every week, you would use a command like the following, weekly: wget --timestamping -r ftp://ftp.gnu.org/pub/gnu/ Note that time-stamping will only work for files for which the server gives a timestamp. For HTTP, this depends on getting a `Last-Modified' header. For FTP, this depends on getting a directory listing with dates in a format that Wget can parse (*note FTP Time-Stamping Internals::).  File: wget.info, Node: HTTP Time-Stamping Internals, Next: FTP Time-Stamping Internals, Prev: Time-Stamping Usage, Up: Time-Stamping 5.2 HTTP Time-Stamping Internals ================================ Time-stamping in HTTP is implemented by checking of the `Last-Modified' header. If you wish to retrieve the file `foo.html' through HTTP, Wget will check whether `foo.html' exists locally. If it doesn't, `foo.html' will be retrieved unconditionally. If the file does exist locally, Wget will first check its local time-stamp (similar to the way `ls -l' checks it), and then send a `HEAD' request to the remote server, demanding the information on the remote file. The `Last-Modified' header is examined to find which file was modified more recently (which makes it "newer"). If the remote file is newer, it will be downloaded; if it is older, Wget will give up.(1) When `--backup-converted' (`-K') is specified in conjunction with `-N', server file `X' is compared to local file `X.orig', if extant, rather than being compared to local file `X', which will always differ if it's been converted by `--convert-links' (`-k'). Arguably, HTTP time-stamping should be implemented using the `If-Modified-Since' request. ---------- Footnotes ---------- (1) As an additional check, Wget will look at the `Content-Length' header, and compare the sizes; if they are not the same, the remote file will be downloaded no matter what the time-stamp says.  File: wget.info, Node: FTP Time-Stamping Internals, Prev: HTTP Time-Stamping Internals, Up: Time-Stamping 5.3 FTP Time-Stamping Internals =============================== In theory, FTP time-stamping works much the same as HTTP, only FTP has no headers--time-stamps must be ferreted out of directory listings. If an FTP download is recursive or uses globbing, Wget will use the FTP `LIST' command to get a file listing for the directory containing the desired file(s). It will try to analyze the listing, treating it like Unix `ls -l' output, extracting the time-stamps. The rest is exactly the same as for HTTP. Note that when retrieving individual files from an FTP server without using globbing or recursion, listing files will not be downloaded (and thus files will not be time-stamped) unless `-N' is specified. Assumption that every directory listing is a Unix-style listing may sound extremely constraining, but in practice it is not, as many non-Unix FTP servers use the Unixoid listing format because most (all?) of the clients understand it. Bear in mind that RFC959 defines no standard way to get a file list, let alone the time-stamps. We can only hope that a future standard will define this. Another non-standard solution includes the use of `MDTM' command that is supported by some FTP servers (including the popular `wu-ftpd'), which returns the exact time of the specified file. Wget may support this command in the future.  File: wget.info, Node: Startup File, Next: Examples, Prev: Time-Stamping, Up: Top 6 Startup File ************** Once you know how to change default settings of Wget through command line arguments, you may wish to make some of those settings permanent. You can do that in a convenient way by creating the Wget startup file--`.wgetrc'. Besides `.wgetrc' is the "main" initialization file, it is convenient to have a special facility for storing passwords. Thus Wget reads and interprets the contents of `$HOME/.netrc', if it finds it. You can find `.netrc' format in your system manuals. Wget reads `.wgetrc' upon startup, recognizing a limited set of commands. * Menu: * Wgetrc Location:: Location of various wgetrc files. * Wgetrc Syntax:: Syntax of wgetrc. * Wgetrc Commands:: List of available commands. * Sample Wgetrc:: A wgetrc example.  File: wget.info, Node: Wgetrc Location, Next: Wgetrc Syntax, Prev: Startup File, Up: Startup File 6.1 Wgetrc Location =================== When initializing, Wget will look for a "global" startup file, `/usr/local/etc/wgetrc' by default (or some prefix other than `/usr/local', if Wget was not installed there) and read commands from there, if it exists. Then it will look for the user's file. If the environmental variable `WGETRC' is set, Wget will try to load that file. Failing that, no further attempts will be made. If `WGETRC' is not set, Wget will try to load `$HOME/.wgetrc'. The fact that user's settings are loaded after the system-wide ones means that in case of collision user's wgetrc _overrides_ the system-wide wgetrc (in `/usr/local/etc/wgetrc' by default). Fascist admins, away!  File: wget.info, Node: Wgetrc Syntax, Next: Wgetrc Commands, Prev: Wgetrc Location, Up: Startup File 6.2 Wgetrc Syntax ================= The syntax of a wgetrc command is simple: variable = value The "variable" will also be called "command". Valid "values" are different for different commands. The commands are case-insensitive and underscore-insensitive. Thus `DIr__PrefiX' is the same as `dirprefix'. Empty lines, lines beginning with `#' and lines containing white-space only are discarded. Commands that expect a comma-separated list will clear the list on an empty command. So, if you wish to reset the rejection list specified in global `wgetrc', you can do it with: reject =  File: wget.info, Node: Wgetrc Commands, Next: Sample Wgetrc, Prev: Wgetrc Syntax, Up: Startup File 6.3 Wgetrc Commands =================== The complete set of commands is listed below. Legal values are listed after the `='. Simple Boolean values can be set or unset using `on' and `off' or `1' and `0'. Some commands take pseudo-arbitrary values. ADDRESS values can be hostnames or dotted-quad IP addresses. N can be any positive integer, or `inf' for infinity, where appropriate. STRING values can be any non-empty string. Most of these commands have direct command-line equivalents. Also, any wgetrc command can be specified on the command line using the `--execute' switch (*note Basic Startup Options::.) accept/reject = STRING Same as `-A'/`-R' (*note Types of Files::). add_hostdir = on/off Enable/disable host-prefixed file names. `-nH' disables it. ask_password = on/off Prompt for a password for each connection established. Cannot be specified when `--password' is being used, because they are mutually exclusive. Equivalent to `--ask-password'. auth_no_challenge = on/off If this option is given, Wget will send Basic HTTP authentication information (plaintext username and password) for all requests. See `--auth-no-challenge'. background = on/off Enable/disable going to background--the same as `-b' (which enables it). backup_converted = on/off Enable/disable saving pre-converted files with the suffix `.orig'--the same as `-K' (which enables it). base = STRING Consider relative URLs in input files (specified via the `input' command or the `--input-file'/`-i' option, together with `force_html' or `--force-html') as being relative to STRING--the same as `--base=STRING'. bind_address = ADDRESS Bind to ADDRESS, like the `--bind-address=ADDRESS'. ca_certificate = FILE Set the certificate authority bundle file to FILE. The same as `--ca-certificate=FILE'. ca_directory = DIRECTORY Set the directory used for certificate authorities. The same as `--ca-directory=DIRECTORY'. cache = on/off When set to off, disallow server-caching. See the `--no-cache' option. certificate = FILE Set the client certificate file name to FILE. The same as `--certificate=FILE'. certificate_type = STRING Specify the type of the client certificate, legal values being `PEM' (the default) and `DER' (aka ASN1). The same as `--certificate-type=STRING'. check_certificate = on/off If this is set to off, the server certificate is not checked against the specified client authorities. The default is "on". The same as `--check-certificate'. connect_timeout = N Set the connect timeout--the same as `--connect-timeout'. content_disposition = on/off Turn on recognition of the (non-standard) `Content-Disposition' HTTP header--if set to `on', the same as `--content-disposition'. trust_server_names = on/off If set to on, use the last component of a redirection URL for the local file name. continue = on/off If set to on, force continuation of preexistent partially retrieved files. See `-c' before setting it. convert_links = on/off Convert non-relative links locally. The same as `-k'. cookies = on/off When set to off, disallow cookies. See the `--cookies' option. cut_dirs = N Ignore N remote directory components. Equivalent to `--cut-dirs=N'. debug = on/off Debug mode, same as `-d'. default_page = STRING Default page name--the same as `--default-page=STRING'. delete_after = on/off Delete after download--the same as `--delete-after'. dir_prefix = STRING Top of directory tree--the same as `-P STRING'. dirstruct = on/off Turning dirstruct on or off--the same as `-x' or `-nd', respectively. dns_cache = on/off Turn DNS caching on/off. Since DNS caching is on by default, this option is normally used to turn it off and is equivalent to `--no-dns-cache'. dns_timeout = N Set the DNS timeout--the same as `--dns-timeout'. domains = STRING Same as `-D' (*note Spanning Hosts::). dot_bytes = N Specify the number of bytes "contained" in a dot, as seen throughout the retrieval (1024 by default). You can postfix the value with `k' or `m', representing kilobytes and megabytes, respectively. With dot settings you can tailor the dot retrieval to suit your needs, or you can use the predefined "styles" (*note Download Options::). dot_spacing = N Specify the number of dots in a single cluster (10 by default). dots_in_line = N Specify the number of dots that will be printed in each line throughout the retrieval (50 by default). egd_file = FILE Use STRING as the EGD socket file name. The same as `--egd-file=FILE'. exclude_directories = STRING Specify a comma-separated list of directories you wish to exclude from download--the same as `-X STRING' (*note Directory-Based Limits::). exclude_domains = STRING Same as `--exclude-domains=STRING' (*note Spanning Hosts::). follow_ftp = on/off Follow FTP links from HTML documents--the same as `--follow-ftp'. follow_tags = STRING Only follow certain HTML tags when doing a recursive retrieval, just like `--follow-tags=STRING'. force_html = on/off If set to on, force the input filename to be regarded as an HTML document--the same as `-F'. ftp_password = STRING Set your FTP password to STRING. Without this setting, the password defaults to `-wget@', which is a useful default for anonymous FTP access. This command used to be named `passwd' prior to Wget 1.10. ftp_proxy = STRING Use STRING as FTP proxy, instead of the one specified in environment. ftp_user = STRING Set FTP user to STRING. This command used to be named `login' prior to Wget 1.10. glob = on/off Turn globbing on/off--the same as `--glob' and `--no-glob'. header = STRING Define a header for HTTP downloads, like using `--header=STRING'. adjust_extension = on/off Add a `.html' extension to `text/html' or `application/xhtml+xml' files that lack one, or a `.css' extension to `text/css' files that lack one, like `-E'. Previously named `html_extension' (still acceptable, but deprecated). http_keep_alive = on/off Turn the keep-alive feature on or off (defaults to on). Turning it off is equivalent to `--no-http-keep-alive'. http_password = STRING Set HTTP password, equivalent to `--http-password=STRING'. http_proxy = STRING Use STRING as HTTP proxy, instead of the one specified in environment. http_user = STRING Set HTTP user to STRING, equivalent to `--http-user=STRING'. https_proxy = STRING Use STRING as HTTPS proxy, instead of the one specified in environment. ignore_case = on/off When set to on, match files and directories case insensitively; the same as `--ignore-case'. ignore_length = on/off When set to on, ignore `Content-Length' header; the same as `--ignore-length'. ignore_tags = STRING Ignore certain HTML tags when doing a recursive retrieval, like `--ignore-tags=STRING'. include_directories = STRING Specify a comma-separated list of directories you wish to follow when downloading--the same as `-I STRING'. iri = on/off When set to on, enable internationalized URI (IRI) support; the same as `--iri'. inet4_only = on/off Force connecting to IPv4 addresses, off by default. You can put this in the global init file to disable Wget's attempts to resolve and connect to IPv6 hosts. Available only if Wget was compiled with IPv6 support. The same as `--inet4-only' or `-4'. inet6_only = on/off Force connecting to IPv6 addresses, off by default. Available only if Wget was compiled with IPv6 support. The same as `--inet6-only' or `-6'. input = FILE Read the URLs from STRING, like `-i FILE'. keep_session_cookies = on/off When specified, causes `save_cookies = on' to also save session cookies. See `--keep-session-cookies'. limit_rate = RATE Limit the download speed to no more than RATE bytes per second. The same as `--limit-rate=RATE'. load_cookies = FILE Load cookies from FILE. See `--load-cookies FILE'. local_encoding = ENCODING Force Wget to use ENCODING as the default system encoding. See `--local-encoding'. logfile = FILE Set logfile to FILE, the same as `-o FILE'. max_redirect = NUMBER Specifies the maximum number of redirections to follow for a resource. See `--max-redirect=NUMBER'. mirror = on/off Turn mirroring on/off. The same as `-m'. netrc = on/off Turn reading netrc on or off. no_clobber = on/off Same as `-nc'. no_parent = on/off Disallow retrieving outside the directory hierarchy, like `--no-parent' (*note Directory-Based Limits::). no_proxy = STRING Use STRING as the comma-separated list of domains to avoid in proxy loading, instead of the one specified in environment. output_document = FILE Set the output filename--the same as `-O FILE'. page_requisites = on/off Download all ancillary documents necessary for a single HTML page to display properly--the same as `-p'. passive_ftp = on/off Change setting of passive FTP, equivalent to the `--passive-ftp' option. password = STRING Specify password STRING for both FTP and HTTP file retrieval. This command can be overridden using the `ftp_password' and `http_password' command for FTP and HTTP respectively. post_data = STRING Use POST as the method for all HTTP requests and send STRING in the request body. The same as `--post-data=STRING'. post_file = FILE Use POST as the method for all HTTP requests and send the contents of FILE in the request body. The same as `--post-file=FILE'. prefer_family = none/IPv4/IPv6 When given a choice of several addresses, connect to the addresses with specified address family first. The address order returned by DNS is used without change by default. The same as `--prefer-family', which see for a detailed discussion of why this is useful. private_key = FILE Set the private key file to FILE. The same as `--private-key=FILE'. private_key_type = STRING Specify the type of the private key, legal values being `PEM' (the default) and `DER' (aka ASN1). The same as `--private-type=STRING'. progress = STRING Set the type of the progress indicator. Legal types are `dot' and `bar'. Equivalent to `--progress=STRING'. protocol_directories = on/off When set, use the protocol name as a directory component of local file names. The same as `--protocol-directories'. proxy_password = STRING Set proxy authentication password to STRING, like `--proxy-password=STRING'. proxy_user = STRING Set proxy authentication user name to STRING, like `--proxy-user=STRING'. quiet = on/off Quiet mode--the same as `-q'. quota = QUOTA Specify the download quota, which is useful to put in the global `wgetrc'. When download quota is specified, Wget will stop retrieving after the download sum has become greater than quota. The quota can be specified in bytes (default), kbytes `k' appended) or mbytes (`m' appended). Thus `quota = 5m' will set the quota to 5 megabytes. Note that the user's startup file overrides system settings. random_file = FILE Use FILE as a source of randomness on systems lacking `/dev/random'. random_wait = on/off Turn random between-request wait times on or off. The same as `--random-wait'. read_timeout = N Set the read (and write) timeout--the same as `--read-timeout=N'. reclevel = N Recursion level (depth)--the same as `-l N'. recursive = on/off Recursive on/off--the same as `-r'. referer = STRING Set HTTP `Referer:' header just like `--referer=STRING'. (Note that it was the folks who wrote the HTTP spec who got the spelling of "referrer" wrong.) relative_only = on/off Follow only relative links--the same as `-L' (*note Relative Links::). remote_encoding = ENCODING Force Wget to use ENCODING as the default remote server encoding. See `--remote-encoding'. remove_listing = on/off If set to on, remove FTP listings downloaded by Wget. Setting it to off is the same as `--no-remove-listing'. restrict_file_names = unix/windows Restrict the file names generated by Wget from URLs. See `--restrict-file-names' for a more detailed description. retr_symlinks = on/off When set to on, retrieve symbolic links as if they were plain files; the same as `--retr-symlinks'. retry_connrefused = on/off When set to on, consider "connection refused" a transient error--the same as `--retry-connrefused'. robots = on/off Specify whether the norobots convention is respected by Wget, "on" by default. This switch controls both the `/robots.txt' and the `nofollow' aspect of the spec. *Note Robot Exclusion::, for more details about this. Be sure you know what you are doing before turning this off. save_cookies = FILE Save cookies to FILE. The same as `--save-cookies FILE'. save_headers = on/off Same as `--save-headers'. secure_protocol = STRING Choose the secure protocol to be used. Legal values are `auto' (the default), `SSLv2', `SSLv3', and `TLSv1'. The same as `--secure-protocol=STRING'. server_response = on/off Choose whether or not to print the HTTP and FTP server responses--the same as `-S'. show_all_dns_entries = on/off When a DNS name is resolved, show all the IP addresses, not just the first three. span_hosts = on/off Same as `-H'. spider = on/off Same as `--spider'. strict_comments = on/off Same as `--strict-comments'. timeout = N Set all applicable timeout values to N, the same as `-T N'. timestamping = on/off Turn timestamping on/off. The same as `-N' (*note Time-Stamping::). use_server_timestamps = on/off If set to `off', Wget won't set the local file's timestamp by the one on the server (same as `--no-use-server-timestamps'). tries = N Set number of retries per URL--the same as `-t N'. use_proxy = on/off When set to off, don't use proxy even when proxy-related environment variables are set. In that case it is the same as using `--no-proxy'. user = STRING Specify username STRING for both FTP and HTTP file retrieval. This command can be overridden using the `ftp_user' and `http_user' command for FTP and HTTP respectively. user_agent = STRING User agent identification sent to the HTTP Server--the same as `--user-agent=STRING'. verbose = on/off Turn verbose on/off--the same as `-v'/`-nv'. wait = N Wait N seconds between retrievals--the same as `-w N'. wait_retry = N Wait up to N seconds between retries of failed retrievals only--the same as `--waitretry=N'. Note that this is turned on by default in the global `wgetrc'.  File: wget.info, Node: Sample Wgetrc, Prev: Wgetrc Commands, Up: Startup File 6.4 Sample Wgetrc ================= This is the sample initialization file, as given in the distribution. It is divided in two section--one for global usage (suitable for global startup file), and one for local usage (suitable for `$HOME/.wgetrc'). Be careful about the things you change. Note that almost all the lines are commented out. For a command to have any effect, you must remove the `#' character at the beginning of its line. ### ### Sample Wget initialization file .wgetrc ### ## You can use this file to change the default behaviour of wget or to ## avoid having to type many many command-line options. This file does ## not contain a comprehensive list of commands -- look at the manual ## to find out what you can put into this file. ## ## Wget initialization file can reside in /usr/local/etc/wgetrc ## (global, for all users) or $HOME/.wgetrc (for a single user). ## ## To use the settings in this file, you will have to uncomment them, ## as well as change them, in most cases, as the values on the ## commented-out lines are the default values (e.g. "off"). ## ## Global settings (useful for setting up in /usr/local/etc/wgetrc). ## Think well before you change them, since they may reduce wget's ## functionality, and make it behave contrary to the documentation: ## # You can set retrieve quota for beginners by specifying a value # optionally followed by 'K' (kilobytes) or 'M' (megabytes). The # default quota is unlimited. #quota = inf # You can lower (or raise) the default number of retries when # downloading a file (default is 20). #tries = 20 # Lowering the maximum depth of the recursive retrieval is handy to # prevent newbies from going too "deep" when they unwittingly start # the recursive retrieval. The default is 5. #reclevel = 5 # By default Wget uses "passive FTP" transfer where the client # initiates the data connection to the server rather than the other # way around. That is required on systems behind NAT where the client # computer cannot be easily reached from the Internet. However, some # firewalls software explicitly supports active FTP and in fact has # problems supporting passive transfer. If you are in such # environment, use "passive_ftp = off" to revert to active FTP. #passive_ftp = off # The "wait" command below makes Wget wait between every connection. # If, instead, you want Wget to wait only between retries of failed # downloads, set waitretry to maximum number of seconds to wait (Wget # will use "linear backoff", waiting 1 second after the first failure # on a file, 2 seconds after the second failure, etc. up to this max). #waitretry = 10 ## ## Local settings (for a user to set in his $HOME/.wgetrc). It is ## *highly* undesirable to put these settings in the global file, since ## they are potentially dangerous to "normal" users. ## ## Even when setting up your own ~/.wgetrc, you should know what you ## are doing before doing so. ## # Set this to on to use timestamping by default: #timestamping = off # It is a good idea to make Wget send your email address in a `From:' # header with your request (so that server administrators can contact # you in case of errors). Wget does *not* send `From:' by default. #header = From: Your Name # You can set up other headers, like Accept-Language. Accept-Language # is *not* sent by default. #header = Accept-Language: en # You can set the default proxies for Wget to use for http, https, and ftp. # They will override the value in the environment. #https_proxy = http://proxy.yoyodyne.com:18023/ #http_proxy = http://proxy.yoyodyne.com:18023/ #ftp_proxy = http://proxy.yoyodyne.com:18023/ # If you do not want to use proxy at all, set this to off. #use_proxy = on # You can customize the retrieval outlook. Valid options are default, # binary, mega and micro. #dot_style = default # Setting this to off makes Wget not download /robots.txt. Be sure to # know *exactly* what /robots.txt is and how it is used before changing # the default! #robots = on # It can be useful to make Wget wait between connections. Set this to # the number of seconds you want Wget to wait. #wait = 0 # You can force creating directory structure, even if a single is being # retrieved, by setting this to on. #dirstruct = off # You can turn on recursive retrieving by default (don't do this if # you are not sure you know what it means) by setting this to on. #recursive = off # To always back up file X as X.orig before converting its links (due # to -k / --convert-links / convert_links = on having been specified), # set this variable to on: #backup_converted = off # To have Wget follow FTP links from HTML files by default, set this # to on: #follow_ftp = off # To try ipv6 addresses first: #prefer-family = IPv6 # Set default IRI support state #iri = off # Force the default system encoding #locale = UTF-8 # Force the default remote server encoding #remoteencoding = UTF-8  File: wget.info, Node: Examples, Next: Various, Prev: Startup File, Up: Top 7 Examples ********** The examples are divided into three sections loosely based on their complexity. * Menu: * Simple Usage:: Simple, basic usage of the program. * Advanced Usage:: Advanced tips. * Very Advanced Usage:: The hairy stuff.  File: wget.info, Node: Simple Usage, Next: Advanced Usage, Prev: Examples, Up: Examples 7.1 Simple Usage ================ * Say you want to download a URL. Just type: wget http://fly.srk.fer.hr/ * But what will happen if the connection is slow, and the file is lengthy? The connection will probably fail before the whole file is retrieved, more than once. In this case, Wget will try getting the file until it either gets the whole of it, or exceeds the default number of retries (this being 20). It is easy to change the number of tries to 45, to insure that the whole file will arrive safely: wget --tries=45 http://fly.srk.fer.hr/jpg/flyweb.jpg * Now let's leave Wget to work in the background, and write its progress to log file `log'. It is tiring to type `--tries', so we shall use `-t'. wget -t 45 -o log http://fly.srk.fer.hr/jpg/flyweb.jpg & The ampersand at the end of the line makes sure that Wget works in the background. To unlimit the number of retries, use `-t inf'. * The usage of FTP is as simple. Wget will take care of login and password. wget ftp://gnjilux.srk.fer.hr/welcome.msg * If you specify a directory, Wget will retrieve the directory listing, parse it and convert it to HTML. Try: wget ftp://ftp.gnu.org/pub/gnu/ links index.html  File: wget.info, Node: Advanced Usage, Next: Very Advanced Usage, Prev: Simple Usage, Up: Examples 7.2 Advanced Usage ================== * You have a file that contains the URLs you want to download? Use the `-i' switch: wget -i FILE If you specify `-' as file name, the URLs will be read from standard input. * Create a five levels deep mirror image of the GNU web site, with the same directory structure the original has, with only one try per document, saving the log of the activities to `gnulog': wget -r http://www.gnu.org/ -o gnulog * The same as the above, but convert the links in the downloaded files to point to local files, so you can view the documents off-line: wget --convert-links -r http://www.gnu.org/ -o gnulog * Retrieve only one HTML page, but make sure that all the elements needed for the page to be displayed, such as inline images and external style sheets, are also downloaded. Also make sure the downloaded page references the downloaded links. wget -p --convert-links http://www.server.com/dir/page.html The HTML page will be saved to `www.server.com/dir/page.html', and the images, stylesheets, etc., somewhere under `www.server.com/', depending on where they were on the remote server. * The same as the above, but without the `www.server.com/' directory. In fact, I don't want to have all those random server directories anyway--just save _all_ those files under a `download/' subdirectory of the current directory. wget -p --convert-links -nH -nd -Pdownload \ http://www.server.com/dir/page.html * Retrieve the index.html of `www.lycos.com', showing the original server headers: wget -S http://www.lycos.com/ * Save the server headers with the file, perhaps for post-processing. wget --save-headers http://www.lycos.com/ more index.html * Retrieve the first two levels of `wuarchive.wustl.edu', saving them to `/tmp'. wget -r -l2 -P/tmp ftp://wuarchive.wustl.edu/ * You want to download all the GIFs from a directory on an HTTP server. You tried `wget http://www.server.com/dir/*.gif', but that didn't work because HTTP retrieval does not support globbing. In that case, use: wget -r -l1 --no-parent -A.gif http://www.server.com/dir/ More verbose, but the effect is the same. `-r -l1' means to retrieve recursively (*note Recursive Download::), with maximum depth of 1. `--no-parent' means that references to the parent directory are ignored (*note Directory-Based Limits::), and `-A.gif' means to download only the GIF files. `-A "*.gif"' would have worked too. * Suppose you were in the middle of downloading, when Wget was interrupted. Now you do not want to clobber the files already present. It would be: wget -nc -r http://www.gnu.org/ * If you want to encode your own username and password to HTTP or FTP, use the appropriate URL syntax (*note URL Format::). wget ftp://hniksic:mypassword@unix.server.com/.emacs Note, however, that this usage is not advisable on multi-user systems because it reveals your password to anyone who looks at the output of `ps'. * You would like the output documents to go to standard output instead of to files? wget -O - http://jagor.srce.hr/ http://www.srce.hr/ You can also combine the two options and make pipelines to retrieve the documents from remote hotlists: wget -O - http://cool.list.com/ | wget --force-html -i -  File: wget.info, Node: Very Advanced Usage, Prev: Advanced Usage, Up: Examples 7.3 Very Advanced Usage ======================= * If you wish Wget to keep a mirror of a page (or FTP subdirectories), use `--mirror' (`-m'), which is the shorthand for `-r -l inf -N'. You can put Wget in the crontab file asking it to recheck a site each Sunday: crontab 0 0 * * 0 wget --mirror http://www.gnu.org/ -o /home/me/weeklog * In addition to the above, you want the links to be converted for local viewing. But, after having read this manual, you know that link conversion doesn't play well with timestamping, so you also want Wget to back up the original HTML files before the conversion. Wget invocation would look like this: wget --mirror --convert-links --backup-converted \ http://www.gnu.org/ -o /home/me/weeklog * But you've also noticed that local viewing doesn't work all that well when HTML files are saved under extensions other than `.html', perhaps because they were served as `index.cgi'. So you'd like Wget to rename all the files served with content-type `text/html' or `application/xhtml+xml' to `NAME.html'. wget --mirror --convert-links --backup-converted \ --html-extension -o /home/me/weeklog \ http://www.gnu.org/ Or, with less typing: wget -m -k -K -E http://www.gnu.org/ -o /home/me/weeklog  File: wget.info, Node: Various, Next: Appendices, Prev: Examples, Up: Top 8 Various ********* This chapter contains all the stuff that could not fit anywhere else. * Menu: * Proxies:: Support for proxy servers. * Distribution:: Getting the latest version. * Web Site:: GNU Wget's presence on the World Wide Web. * Mailing Lists:: Wget mailing list for announcements and discussion. * Internet Relay Chat:: Wget's presence on IRC. * Reporting Bugs:: How and where to report bugs. * Portability:: The systems Wget works on. * Signals:: Signal-handling performed by Wget.  File: wget.info, Node: Proxies, Next: Distribution, Prev: Various, Up: Various 8.1 Proxies =========== "Proxies" are special-purpose HTTP servers designed to transfer data from remote servers to local clients. One typical use of proxies is lightening network load for users behind a slow connection. This is achieved by channeling all HTTP and FTP requests through the proxy which caches the transferred data. When a cached resource is requested again, proxy will return the data from cache. Another use for proxies is for companies that separate (for security reasons) their internal networks from the rest of Internet. In order to obtain information from the Web, their users connect and retrieve remote data using an authorized proxy. Wget supports proxies for both HTTP and FTP retrievals. The standard way to specify proxy location, which Wget recognizes, is using the following environment variables: `http_proxy' `https_proxy' If set, the `http_proxy' and `https_proxy' variables should contain the URLs of the proxies for HTTP and HTTPS connections respectively. `ftp_proxy' This variable should contain the URL of the proxy for FTP connections. It is quite common that `http_proxy' and `ftp_proxy' are set to the same URL. `no_proxy' This variable should contain a comma-separated list of domain extensions proxy should _not_ be used for. For instance, if the value of `no_proxy' is `.mit.edu', proxy will not be used to retrieve documents from MIT. In addition to the environment variables, proxy location and settings may be specified from within Wget itself. `--no-proxy' `proxy = on/off' This option and the corresponding command may be used to suppress the use of proxy, even if the appropriate environment variables are set. `http_proxy = URL' `https_proxy = URL' `ftp_proxy = URL' `no_proxy = STRING' These startup file variables allow you to override the proxy settings specified by the environment. Some proxy servers require authorization to enable you to use them. The authorization consists of "username" and "password", which must be sent by Wget. As with HTTP authorization, several authentication schemes exist. For proxy authorization only the `Basic' authentication scheme is currently implemented. You may specify your username and password either through the proxy URL or through the command-line options. Assuming that the company's proxy is located at `proxy.company.com' at port 8001, a proxy URL location containing authorization data might look like this: http://hniksic:mypassword@proxy.company.com:8001/ Alternatively, you may use the `proxy-user' and `proxy-password' options, and the equivalent `.wgetrc' settings `proxy_user' and `proxy_password' to set the proxy username and password.  File: wget.info, Node: Distribution, Next: Web Site, Prev: Proxies, Up: Various 8.2 Distribution ================ Like all GNU utilities, the latest version of Wget can be found at the master GNU archive site ftp.gnu.org, and its mirrors. For example, Wget 1.13.4 can be found at `ftp://ftp.gnu.org/pub/gnu/wget/wget-1.13.4.tar.gz'  File: wget.info, Node: Web Site, Next: Mailing Lists, Prev: Distribution, Up: Various 8.3 Web Site ============ The official web site for GNU Wget is at `http://www.gnu.org/software/wget/'. However, most useful information resides at "The Wget Wgiki", `http://wget.addictivecode.org/'.  File: wget.info, Node: Mailing Lists, Next: Internet Relay Chat, Prev: Web Site, Up: Various 8.4 Mailing Lists ================= Primary List ------------ The primary mailinglist for discussion, bug-reports, or questions about GNU Wget is at . To subscribe, send an email to , or visit `http://lists.gnu.org/mailman/listinfo/bug-wget'. You do not need to subscribe to send a message to the list; however, please note that unsubscribed messages are moderated, and may take a while before they hit the list--*usually around a day*. If you want your message to show up immediately, please subscribe to the list before posting. Archives for the list may be found at `http://lists.gnu.org/pipermail/bug-wget/'. An NNTP/Usenettish gateway is also available via Gmane (http://gmane.org/about.php). You can see the Gmane archives at `http://news.gmane.org/gmane.comp.web.wget.general'. Note that the Gmane archives conveniently include messages from both the current list, and the previous one. Messages also show up in the Gmane archives sooner than they do at `lists.gnu.org'. Bug Notices List ---------------- Additionally, there is the mailing list. This is a non-discussion list that receives bug report notifications from the bug-tracker. To subscribe to this list, send an email to , or visit `http://addictivecode.org/mailman/listinfo/wget-notify'. Obsolete Lists -------------- Previously, the mailing list was used as the main discussion list, and another list, was used for submitting and discussing patches to GNU Wget. Messages from are archived at `http://www.mail-archive.com/wget%40sunsite.dk/' and at `http://news.gmane.org/gmane.comp.web.wget.general' (which also continues to archive the current list, ). Messages from are archived at `http://news.gmane.org/gmane.comp.web.wget.patches'.  File: wget.info, Node: Internet Relay Chat, Next: Reporting Bugs, Prev: Mailing Lists, Up: Various 8.5 Internet Relay Chat ======================= In addition to the mailinglists, we also have a support channel set up via IRC at `irc.freenode.org', `#wget'. Come check it out!  File: wget.info, Node: Reporting Bugs, Next: Portability, Prev: Internet Relay Chat, Up: Various 8.6 Reporting Bugs ================== You are welcome to submit bug reports via the GNU Wget bug tracker (see `http://wget.addictivecode.org/BugTracker'). Before actually submitting a bug report, please try to follow a few simple guidelines. 1. Please try to ascertain that the behavior you see really is a bug. If Wget crashes, it's a bug. If Wget does not behave as documented, it's a bug. If things work strange, but you are not sure about the way they are supposed to work, it might well be a bug, but you might want to double-check the documentation and the mailing lists (*note Mailing Lists::). 2. Try to repeat the bug in as simple circumstances as possible. E.g. if Wget crashes while downloading `wget -rl0 -kKE -t5 --no-proxy http://yoyodyne.com -o /tmp/log', you should try to see if the crash is repeatable, and if will occur with a simpler set of options. You might even try to start the download at the page where the crash occurred to see if that page somehow triggered the crash. Also, while I will probably be interested to know the contents of your `.wgetrc' file, just dumping it into the debug message is probably a bad idea. Instead, you should first try to see if the bug repeats with `.wgetrc' moved out of the way. Only if it turns out that `.wgetrc' settings affect the bug, mail me the relevant parts of the file. 3. Please start Wget with `-d' option and send us the resulting output (or relevant parts thereof). If Wget was compiled without debug support, recompile it--it is _much_ easier to trace bugs with debug support on. Note: please make sure to remove any potentially sensitive information from the debug log before sending it to the bug address. The `-d' won't go out of its way to collect sensitive information, but the log _will_ contain a fairly complete transcript of Wget's communication with the server, which may include passwords and pieces of downloaded data. Since the bug address is publically archived, you may assume that all bug reports are visible to the public. 4. If Wget has crashed, try to run it in a debugger, e.g. `gdb `which wget` core' and type `where' to get the backtrace. This may not work if the system administrator has disabled core files, but it is safe to try.  File: wget.info, Node: Portability, Next: Signals, Prev: Reporting Bugs, Up: Various 8.7 Portability =============== Like all GNU software, Wget works on the GNU system. However, since it uses GNU Autoconf for building and configuring, and mostly avoids using "special" features of any particular Unix, it should compile (and work) on all common Unix flavors. Various Wget versions have been compiled and tested under many kinds of Unix systems, including GNU/Linux, Solaris, SunOS 4.x, Mac OS X, OSF (aka Digital Unix or Tru64), Ultrix, *BSD, IRIX, AIX, and others. Some of those systems are no longer in widespread use and may not be able to support recent versions of Wget. If Wget fails to compile on your system, we would like to know about it. Thanks to kind contributors, this version of Wget compiles and works on 32-bit Microsoft Windows platforms. It has been compiled successfully using MS Visual C++ 6.0, Watcom, Borland C, and GCC compilers. Naturally, it is crippled of some features available on Unix, but it should work as a substitute for people stuck with Windows. Note that Windows-specific portions of Wget are not guaranteed to be supported in the future, although this has been the case in practice for many years now. All questions and problems in Windows usage should be reported to Wget mailing list at where the volunteers who maintain the Windows-related features might look at them. Support for building on MS-DOS via DJGPP has been contributed by Gisle Vanem; a port to VMS is maintained by Steven Schweda, and is available at `http://antinode.org/'.  File: wget.info, Node: Signals, Prev: Portability, Up: Various 8.8 Signals =========== Since the purpose of Wget is background work, it catches the hangup signal (`SIGHUP') and ignores it. If the output was on standard output, it will be redirected to a file named `wget-log'. Otherwise, `SIGHUP' is ignored. This is convenient when you wish to redirect the output of Wget after having started it. $ wget http://www.gnus.org/dist/gnus.tar.gz & ... $ kill -HUP %% SIGHUP received, redirecting output to `wget-log'. Other than that, Wget will not try to interfere with signals in any way. `C-c', `kill -TERM' and `kill -KILL' should kill it alike.  File: wget.info, Node: Appendices, Next: Copying this manual, Prev: Various, Up: Top 9 Appendices ************ This chapter contains some references I consider useful. * Menu: * Robot Exclusion:: Wget's support for RES. * Security Considerations:: Security with Wget. * Contributors:: People who helped.  File: wget.info, Node: Robot Exclusion, Next: Security Considerations, Prev: Appendices, Up: Appendices 9.1 Robot Exclusion =================== It is extremely easy to make Wget wander aimlessly around a web site, sucking all the available data in progress. `wget -r SITE', and you're set. Great? Not for the server admin. As long as Wget is only retrieving static pages, and doing it at a reasonable rate (see the `--wait' option), there's not much of a problem. The trouble is that Wget can't tell the difference between the smallest static page and the most demanding CGI. A site I know has a section handled by a CGI Perl script that converts Info files to HTML on the fly. The script is slow, but works well enough for human users viewing an occasional Info file. However, when someone's recursive Wget download stumbles upon the index page that links to all the Info files through the script, the system is brought to its knees without providing anything useful to the user (This task of converting Info files could be done locally and access to Info documentation for all installed GNU software on a system is available from the `info' command). To avoid this kind of accident, as well as to preserve privacy for documents that need to be protected from well-behaved robots, the concept of "robot exclusion" was invented. The idea is that the server administrators and document authors can specify which portions of the site they wish to protect from robots and those they will permit access. The most popular mechanism, and the de facto standard supported by all the major robots, is the "Robots Exclusion Standard" (RES) written by Martijn Koster et al. in 1994. It specifies the format of a text file containing directives that instruct the robots which URL paths to avoid. To be found by the robots, the specifications must be placed in `/robots.txt' in the server root, which the robots are expected to download and parse. Although Wget is not a web robot in the strictest sense of the word, it can download large parts of the site without the user's intervention to download an individual page. Because of that, Wget honors RES when downloading recursively. For instance, when you issue: wget -r http://www.server.com/ First the index of `www.server.com' will be downloaded. If Wget finds that it wants to download more documents from that server, it will request `http://www.server.com/robots.txt' and, if found, use it for further downloads. `robots.txt' is loaded only once per each server. Until version 1.8, Wget supported the first version of the standard, written by Martijn Koster in 1994 and available at `http://www.robotstxt.org/wc/norobots.html'. As of version 1.8, Wget has supported the additional directives specified in the internet draft `' titled "A Method for Web Robots Control". The draft, which has as far as I know never made to an RFC, is available at `http://www.robotstxt.org/wc/norobots-rfc.txt'. This manual no longer includes the text of the Robot Exclusion Standard. The second, less known mechanism, enables the author of an individual document to specify whether they want the links from the file to be followed by a robot. This is achieved using the `META' tag, like this: This is explained in some detail at `http://www.robotstxt.org/wc/meta-user.html'. Wget supports this method of robot exclusion in addition to the usual `/robots.txt' exclusion. If you know what you are doing and really really wish to turn off the robot exclusion, set the `robots' variable to `off' in your `.wgetrc'. You can achieve the same effect from the command line using the `-e' switch, e.g. `wget -e robots=off URL...'.  File: wget.info, Node: Security Considerations, Next: Contributors, Prev: Robot Exclusion, Up: Appendices 9.2 Security Considerations =========================== When using Wget, you must be aware that it sends unencrypted passwords through the network, which may present a security problem. Here are the main issues, and some solutions. 1. The passwords on the command line are visible using `ps'. The best way around it is to use `wget -i -' and feed the URLs to Wget's standard input, each on a separate line, terminated by `C-d'. Another workaround is to use `.netrc' to store passwords; however, storing unencrypted passwords is also considered a security risk. 2. Using the insecure "basic" authentication scheme, unencrypted passwords are transmitted through the network routers and gateways. 3. The FTP passwords are also in no way encrypted. There is no good solution for this at the moment. 4. Although the "normal" output of Wget tries to hide the passwords, debugging logs show them, in all forms. This problem is avoided by being careful when you send debug logs (yes, even when you send them to me).  File: wget.info, Node: Contributors, Prev: Security Considerations, Up: Appendices 9.3 Contributors ================ GNU Wget was written by Hrvoje Niksic . However, the development of Wget could never have gone as far as it has, were it not for the help of many people, either with bug reports, feature proposals, patches, or letters saying "Thanks!". Special thanks goes to the following people (no particular order): * Dan Harkless--contributed a lot of code and documentation of extremely high quality, as well as the `--page-requisites' and related options. He was the principal maintainer for some time and released Wget 1.6. * Ian Abbott--contributed bug fixes, Windows-related fixes, and provided a prototype implementation of the breadth-first recursive download. Co-maintained Wget during the 1.8 release cycle. * The dotsrc.org crew, in particular Karsten Thygesen--donated system resources such as the mailing list, web space, FTP space, and version control repositories, along with a lot of time to make these actually work. Christian Reiniger was of invaluable help with setting up Subversion. * Heiko Herold--provided high-quality Windows builds and contributed bug and build reports for many years. * Shawn McHorse--bug reports and patches. * Kaveh R. Ghazi--on-the-fly `ansi2knr'-ization. Lots of portability fixes. * Gordon Matzigkeit--`.netrc' support. * Zlatko Calusic, Tomislav Vujec and Drazen Kacar--feature suggestions and "philosophical" discussions. * Darko Budor--initial port to Windows. * Antonio Rosella--help and suggestions, plus the initial Italian translation. * Tomislav Petrovic, Mario Mikocevic--many bug reports and suggestions. * Francois Pinard--many thorough bug reports and discussions. * Karl Eichwalder--lots of help with internationalization, Makefile layout and many other things. * Junio Hamano--donated support for Opie and HTTP `Digest' authentication. * Mauro Tortonesi--improved IPv6 support, adding support for dual family systems. Refactored and enhanced FTP IPv6 code. Maintained GNU Wget from 2004-2007. * Christopher G. Lewis--maintenance of the Windows version of GNU WGet. * Gisle Vanem--many helpful patches and improvements, especially for Windows and MS-DOS support. * Ralf Wildenhues--contributed patches to convert Wget to use Automake as part of its build process, and various bugfixes. * Steven Schubiger--Many helpful patches, bugfixes and improvements. Notably, conversion of Wget to use the Gnulib quotes and quoteargs modules, and the addition of password prompts at the console, via the Gnulib getpasswd-gnu module. * Ted Mielczarek--donated support for CSS. * Saint Xavier--Support for IRIs (RFC 3987). * People who provided donations for development--including Brian Gough. The following people have provided patches, bug/build reports, useful suggestions, beta testing services, fan mail and all the other things that make maintenance so much fun: Tim Adam, Adrian Aichner, Martin Baehr, Dieter Baron, Roger Beeman, Dan Berger, T. Bharath, Christian Biere, Paul Bludov, Daniel Bodea, Mark Boyns, John Burden, Julien Buty, Wanderlei Cavassin, Gilles Cedoc, Tim Charron, Noel Cragg, Kristijan Conkas, John Daily, Andreas Damm, Ahmon Dancy, Andrew Davison, Bertrand Demiddelaer, Alexander Dergachev, Andrew Deryabin, Ulrich Drepper, Marc Duponcheel, Damir Dzeko, Alan Eldridge, Hans-Andreas Engel, Aleksandar Erkalovic, Andy Eskilsson, Joao Ferreira, Christian Fraenkel, David Fritz, Mike Frysinger, Charles C. Fu, FUJISHIMA Satsuki, Masashi Fujita, Howard Gayle, Marcel Gerrits, Lemble Gregory, Hans Grobler, Alain Guibert, Mathieu Guillaume, Aaron Hawley, Jochen Hein, Karl Heuer, Madhusudan Hosaagrahara, HIROSE Masaaki, Ulf Harnhammar, Gregor Hoffleit, Erik Magnus Hulthen, Richard Huveneers, Jonas Jensen, Larry Jones, Simon Josefsson, Mario Juric, Hack Kampbjorn, Const Kaplinsky, Goran Kezunovic, Igor Khristophorov, Robert Kleine, KOJIMA Haime, Fila Kolodny, Alexander Kourakos, Martin Kraemer, Sami Krank, Jay Krell, Simos KSenitellis, Christian Lackas, Hrvoje Lacko, Daniel S. Lewart, Nicolas Lichtmeier, Dave Love, Alexander V. Lukyanov, Thomas Lussnig, Andre Majorel, Aurelien Marchand, Matthew J. Mellon, Jordan Mendelson, Ted Mielczarek, Robert Millan, Lin Zhe Min, Jan Minar, Tim Mooney, Keith Moore, Adam D. Moss, Simon Munton, Charlie Negyesi, R. K. Owen, Jim Paris, Kenny Parnell, Leonid Petrov, Simone Piunno, Andrew Pollock, Steve Pothier, Jan Prikryl, Marin Purgar, Csaba Raduly, Keith Refson, Bill Richardson, Tyler Riddle, Tobias Ringstrom, Jochen Roderburg, Juan Jose Rodriguez, Maciej W. Rozycki, Edward J. Sabol, Heinz Salzmann, Robert Schmidt, Nicolas Schodet, Benno Schulenberg, Andreas Schwab, Steven M. Schweda, Chris Seawood, Pranab Shenoy, Dennis Smit, Toomas Soome, Tage Stabell-Kulo, Philip Stadermann, Daniel Stenberg, Sven Sternberger, Markus Strasser, John Summerfield, Szakacsits Szabolcs, Mike Thomas, Philipp Thomas, Mauro Tortonesi, Dave Turner, Gisle Vanem, Rabin Vincent, Russell Vincent, Zeljko Vrba, Charles G Waldman, Douglas E. Wegscheid, Ralf Wildenhues, Joshua David Williams, Benjamin Wolsey, Saint Xavier, YAMAZAKI Makoto, Jasmin Zainul, Bojan Zdrnja, Kristijan Zimmer, Xin Zou. Apologies to all who I accidentally left out, and many thanks to all the subscribers of the Wget mailing list.  File: wget.info, Node: Copying this manual, Next: Concept Index, Prev: Appendices, Up: Top Appendix A Copying this manual ****************************** * Menu: * GNU Free Documentation License:: Licnse for copying this manual.  File: wget.info, Node: GNU Free Documentation License, Prev: Copying this manual, Up: Copying this manual A.1 GNU Free Documentation License ================================== Version 1.3, 3 November 2008 Copyright (C) 2000, 2001, 2002, 2007, 2008, 2009, 2010, 2011 Free Software Foundation, Inc. `http://fsf.org/' Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. 0. PREAMBLE The purpose of this License is to make a manual, textbook, or other functional and useful document "free" in the sense of freedom: to assure everyone the effective freedom to copy and redistribute it, with or without modifying it, either commercially or noncommercially. Secondarily, this License preserves for the author and publisher a way to get credit for their work, while not being considered responsible for modifications made by others. This License is a kind of "copyleft", which means that derivative works of the document must themselves be free in the same sense. It complements the GNU General Public License, which is a copyleft license designed for free software. We have designed this License in order to use it for manuals for free software, because free software needs free documentation: a free program should come with manuals providing the same freedoms that the software does. But this License is not limited to software manuals; it can be used for any textual work, regardless of subject matter or whether it is published as a printed book. We recommend this License principally for works whose purpose is instruction or reference. 1. APPLICABILITY AND DEFINITIONS This License applies to any manual or other work, in any medium, that contains a notice placed by the copyright holder saying it can be distributed under the terms of this License. Such a notice grants a world-wide, royalty-free license, unlimited in duration, to use that work under the conditions stated herein. The "Document", below, refers to any such manual or work. Any member of the public is a licensee, and is addressed as "you". You accept the license if you copy, modify or distribute the work in a way requiring permission under copyright law. A "Modified Version" of the Document means any work containing the Document or a portion of it, either copied verbatim, or with modifications and/or translated into another language. A "Secondary Section" is a named appendix or a front-matter section of the Document that deals exclusively with the relationship of the publishers or authors of the Document to the Document's overall subject (or to related matters) and contains nothing that could fall directly within that overall subject. (Thus, if the Document is in part a textbook of mathematics, a Secondary Section may not explain any mathematics.) The relationship could be a matter of historical connection with the subject or with related matters, or of legal, commercial, philosophical, ethical or political position regarding them. The "Invariant Sections" are certain Secondary Sections whose titles are designated, as being those of Invariant Sections, in the notice that says that the Document is released under this License. If a section does not fit the above definition of Secondary then it is not allowed to be designated as Invariant. The Document may contain zero Invariant Sections. If the Document does not identify any Invariant Sections then there are none. The "Cover Texts" are certain short passages of text that are listed, as Front-Cover Texts or Back-Cover Texts, in the notice that says that the Document is released under this License. A Front-Cover Text may be at most 5 words, and a Back-Cover Text may be at most 25 words. A "Transparent" copy of the Document means a machine-readable copy, represented in a format whose specification is available to the general public, that is suitable for revising the document straightforwardly with generic text editors or (for images composed of pixels) generic paint programs or (for drawings) some widely available drawing editor, and that is suitable for input to text formatters or for automatic translation to a variety of formats suitable for input to text formatters. A copy made in an otherwise Transparent file format whose markup, or absence of markup, has been arranged to thwart or discourage subsequent modification by readers is not Transparent. An image format is not Transparent if used for any substantial amount of text. A copy that is not "Transparent" is called "Opaque". Examples of suitable formats for Transparent copies include plain ASCII without markup, Texinfo input format, LaTeX input format, SGML or XML using a publicly available DTD, and standard-conforming simple HTML, PostScript or PDF designed for human modification. Examples of transparent image formats include PNG, XCF and JPG. Opaque formats include proprietary formats that can be read and edited only by proprietary word processors, SGML or XML for which the DTD and/or processing tools are not generally available, and the machine-generated HTML, PostScript or PDF produced by some word processors for output purposes only. The "Title Page" means, for a printed book, the title page itself, plus such following pages as are needed to hold, legibly, the material this License requires to appear in the title page. For works in formats which do not have any title page as such, "Title Page" means the text near the most prominent appearance of the work's title, preceding the beginning of the body of the text. The "publisher" means any person or entity that distributes copies of the Document to the public. A section "Entitled XYZ" means a named subunit of the Document whose title either is precisely XYZ or contains XYZ in parentheses following text that translates XYZ in another language. (Here XYZ stands for a specific section name mentioned below, such as "Acknowledgements", "Dedications", "Endorsements", or "History".) To "Preserve the Title" of such a section when you modify the Document means that it remains a section "Entitled XYZ" according to this definition. The Document may include Warranty Disclaimers next to the notice which states that this License applies to the Document. These Warranty Disclaimers are considered to be included by reference in this License, but only as regards disclaiming warranties: any other implication that these Warranty Disclaimers may have is void and has no effect on the meaning of this License. 2. VERBATIM COPYING You may copy and distribute the Document in any medium, either commercially or noncommercially, provided that this License, the copyright notices, and the license notice saying this License applies to the Document are reproduced in all copies, and that you add no other conditions whatsoever to those of this License. You may not use technical measures to obstruct or control the reading or further copying of the copies you make or distribute. However, you may accept compensation in exchange for copies. If you distribute a large enough number of copies you must also follow the conditions in section 3. You may also lend copies, under the same conditions stated above, and you may publicly display copies. 3. COPYING IN QUANTITY If you publish printed copies (or copies in media that commonly have printed covers) of the Document, numbering more than 100, and the Document's license notice requires Cover Texts, you must enclose the copies in covers that carry, clearly and legibly, all these Cover Texts: Front-Cover Texts on the front cover, and Back-Cover Texts on the back cover. Both covers must also clearly and legibly identify you as the publisher of these copies. The front cover must present the full title with all words of the title equally prominent and visible. You may add other material on the covers in addition. Copying with changes limited to the covers, as long as they preserve the title of the Document and satisfy these conditions, can be treated as verbatim copying in other respects. If the required texts for either cover are too voluminous to fit legibly, you should put the first ones listed (as many as fit reasonably) on the actual cover, and continue the rest onto adjacent pages. If you publish or distribute Opaque copies of the Document numbering more than 100, you must either include a machine-readable Transparent copy along with each Opaque copy, or state in or with each Opaque copy a computer-network location from which the general network-using public has access to download using public-standard network protocols a complete Transparent copy of the Document, free of added material. If you use the latter option, you must take reasonably prudent steps, when you begin distribution of Opaque copies in quantity, to ensure that this Transparent copy will remain thus accessible at the stated location until at least one year after the last time you distribute an Opaque copy (directly or through your agents or retailers) of that edition to the public. It is requested, but not required, that you contact the authors of the Document well before redistributing any large number of copies, to give them a chance to provide you with an updated version of the Document. 4. MODIFICATIONS You may copy and distribute a Modified Version of the Document under the conditions of sections 2 and 3 above, provided that you release the Modified Version under precisely this License, with the Modified Version filling the role of the Document, thus licensing distribution and modification of the Modified Version to whoever possesses a copy of it. In addition, you must do these things in the Modified Version: A. Use in the Title Page (and on the covers, if any) a title distinct from that of the Document, and from those of previous versions (which should, if there were any, be listed in the History section of the Document). You may use the same title as a previous version if the original publisher of that version gives permission. B. List on the Title Page, as authors, one or more persons or entities responsible for authorship of the modifications in the Modified Version, together with at least five of the principal authors of the Document (all of its principal authors, if it has fewer than five), unless they release you from this requirement. C. State on the Title page the name of the publisher of the Modified Version, as the publisher. D. Preserve all the copyright notices of the Document. E. Add an appropriate copyright notice for your modifications adjacent to the other copyright notices. F. Include, immediately after the copyright notices, a license notice giving the public permission to use the Modified Version under the terms of this License, in the form shown in the Addendum below. G. Preserve in that license notice the full lists of Invariant Sections and required Cover Texts given in the Document's license notice. H. Include an unaltered copy of this License. I. Preserve the section Entitled "History", Preserve its Title, and add to it an item stating at least the title, year, new authors, and publisher of the Modified Version as given on the Title Page. If there is no section Entitled "History" in the Document, create one stating the title, year, authors, and publisher of the Document as given on its Title Page, then add an item describing the Modified Version as stated in the previous sentence. J. Preserve the network location, if any, given in the Document for public access to a Transparent copy of the Document, and likewise the network locations given in the Document for previous versions it was based on. These may be placed in the "History" section. You may omit a network location for a work that was published at least four years before the Document itself, or if the original publisher of the version it refers to gives permission. K. For any section Entitled "Acknowledgements" or "Dedications", Preserve the Title of the section, and preserve in the section all the substance and tone of each of the contributor acknowledgements and/or dedications given therein. L. Preserve all the Invariant Sections of the Document, unaltered in their text and in their titles. Section numbers or the equivalent are not considered part of the section titles. M. Delete any section Entitled "Endorsements". Such a section may not be included in the Modified Version. N. Do not retitle any existing section to be Entitled "Endorsements" or to conflict in title with any Invariant Section. O. Preserve any Warranty Disclaimers. If the Modified Version includes new front-matter sections or appendices that qualify as Secondary Sections and contain no material copied from the Document, you may at your option designate some or all of these sections as invariant. To do this, add their titles to the list of Invariant Sections in the Modified Version's license notice. These titles must be distinct from any other section titles. You may add a section Entitled "Endorsements", provided it contains nothing but endorsements of your Modified Version by various parties--for example, statements of peer review or that the text has been approved by an organization as the authoritative definition of a standard. You may add a passage of up to five words as a Front-Cover Text, and a passage of up to 25 words as a Back-Cover Text, to the end of the list of Cover Texts in the Modified Version. Only one passage of Front-Cover Text and one of Back-Cover Text may be added by (or through arrangements made by) any one entity. If the Document already includes a cover text for the same cover, previously added by you or by arrangement made by the same entity you are acting on behalf of, you may not add another; but you may replace the old one, on explicit permission from the previous publisher that added the old one. The author(s) and publisher(s) of the Document do not by this License give permission to use their names for publicity for or to assert or imply endorsement of any Modified Version. 5. COMBINING DOCUMENTS You may combine the Document with other documents released under this License, under the terms defined in section 4 above for modified versions, provided that you include in the combination all of the Invariant Sections of all of the original documents, unmodified, and list them all as Invariant Sections of your combined work in its license notice, and that you preserve all their Warranty Disclaimers. The combined work need only contain one copy of this License, and multiple identical Invariant Sections may be replaced with a single copy. If there are multiple Invariant Sections with the same name but different contents, make the title of each such section unique by adding at the end of it, in parentheses, the name of the original author or publisher of that section if known, or else a unique number. Make the same adjustment to the section titles in the list of Invariant Sections in the license notice of the combined work. In the combination, you must combine any sections Entitled "History" in the various original documents, forming one section Entitled "History"; likewise combine any sections Entitled "Acknowledgements", and any sections Entitled "Dedications". You must delete all sections Entitled "Endorsements." 6. COLLECTIONS OF DOCUMENTS You may make a collection consisting of the Document and other documents released under this License, and replace the individual copies of this License in the various documents with a single copy that is included in the collection, provided that you follow the rules of this License for verbatim copying of each of the documents in all other respects. You may extract a single document from such a collection, and distribute it individually under this License, provided you insert a copy of this License into the extracted document, and follow this License in all other respects regarding verbatim copying of that document. 7. AGGREGATION WITH INDEPENDENT WORKS A compilation of the Document or its derivatives with other separate and independent documents or works, in or on a volume of a storage or distribution medium, is called an "aggregate" if the copyright resulting from the compilation is not used to limit the legal rights of the compilation's users beyond what the individual works permit. When the Document is included in an aggregate, this License does not apply to the other works in the aggregate which are not themselves derivative works of the Document. If the Cover Text requirement of section 3 is applicable to these copies of the Document, then if the Document is less than one half of the entire aggregate, the Document's Cover Texts may be placed on covers that bracket the Document within the aggregate, or the electronic equivalent of covers if the Document is in electronic form. Otherwise they must appear on printed covers that bracket the whole aggregate. 8. TRANSLATION Translation is considered a kind of modification, so you may distribute translations of the Document under the terms of section 4. Replacing Invariant Sections with translations requires special permission from their copyright holders, but you may include translations of some or all Invariant Sections in addition to the original versions of these Invariant Sections. You may include a translation of this License, and all the license notices in the Document, and any Warranty Disclaimers, provided that you also include the original English version of this License and the original versions of those notices and disclaimers. In case of a disagreement between the translation and the original version of this License or a notice or disclaimer, the original version will prevail. If a section in the Document is Entitled "Acknowledgements", "Dedications", or "History", the requirement (section 4) to Preserve its Title (section 1) will typically require changing the actual title. 9. TERMINATION You may not copy, modify, sublicense, or distribute the Document except as expressly provided under this License. Any attempt otherwise to copy, modify, sublicense, or distribute it is void, and will automatically terminate your rights under this License. However, if you cease all violation of this License, then your license from a particular copyright holder is reinstated (a) provisionally, unless and until the copyright holder explicitly and finally terminates your license, and (b) permanently, if the copyright holder fails to notify you of the violation by some reasonable means prior to 60 days after the cessation. Moreover, your license from a particular copyright holder is reinstated permanently if the copyright holder notifies you of the violation by some reasonable means, this is the first time you have received notice of violation of this License (for any work) from that copyright holder, and you cure the violation prior to 30 days after your receipt of the notice. Termination of your rights under this section does not terminate the licenses of parties who have received copies or rights from you under this License. If your rights have been terminated and not permanently reinstated, receipt of a copy of some or all of the same material does not give you any rights to use it. 10. FUTURE REVISIONS OF THIS LICENSE The Free Software Foundation may publish new, revised versions of the GNU Free Documentation License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. See `http://www.gnu.org/copyleft/'. Each version of the License is given a distinguishing version number. If the Document specifies that a particular numbered version of this License "or any later version" applies to it, you have the option of following the terms and conditions either of that specified version or of any later version that has been published (not as a draft) by the Free Software Foundation. If the Document does not specify a version number of this License, you may choose any version ever published (not as a draft) by the Free Software Foundation. If the Document specifies that a proxy can decide which future versions of this License can be used, that proxy's public statement of acceptance of a version permanently authorizes you to choose that version for the Document. 11. RELICENSING "Massive Multiauthor Collaboration Site" (or "MMC Site") means any World Wide Web server that publishes copyrightable works and also provides prominent facilities for anybody to edit those works. A public wiki that anybody can edit is an example of such a server. A "Massive Multiauthor Collaboration" (or "MMC") contained in the site means any set of copyrightable works thus published on the MMC site. "CC-BY-SA" means the Creative Commons Attribution-Share Alike 3.0 license published by Creative Commons Corporation, a not-for-profit corporation with a principal place of business in San Francisco, California, as well as future copyleft versions of that license published by that same organization. "Incorporate" means to publish or republish a Document, in whole or in part, as part of another Document. An MMC is "eligible for relicensing" if it is licensed under this License, and if all works that were first published under this License somewhere other than this MMC, and subsequently incorporated in whole or in part into the MMC, (1) had no cover texts or invariant sections, and (2) were thus incorporated prior to November 1, 2008. The operator of an MMC Site may republish an MMC contained in the site under CC-BY-SA on the same site at any time before August 1, 2009, provided the MMC is eligible for relicensing. ADDENDUM: How to use this License for your documents ==================================================== To use this License in a document you have written, include a copy of the License in the document and put the following copyright and license notices just after the title page: Copyright (C) YEAR YOUR NAME. Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.3 or any later version published by the Free Software Foundation; with no Invariant Sections, no Front-Cover Texts, and no Back-Cover Texts. A copy of the license is included in the section entitled ``GNU Free Documentation License''. If you have Invariant Sections, Front-Cover Texts and Back-Cover Texts, replace the "with...Texts." line with this: with the Invariant Sections being LIST THEIR TITLES, with the Front-Cover Texts being LIST, and with the Back-Cover Texts being LIST. If you have Invariant Sections without Cover Texts, or some other combination of the three, merge those two alternatives to suit the situation. If your document contains nontrivial examples of program code, we recommend releasing these examples in parallel under your choice of free software license, such as the GNU General Public License, to permit their use in free software.  File: wget.info, Node: Concept Index, Prev: Copying this manual, Up: Top Concept Index ************* [index] * Menu: * #wget: Internet Relay Chat. (line 6) * .css extension: HTTP Options. (line 10) * .html extension: HTTP Options. (line 10) * .listing files, removing: FTP Options. (line 21) * .netrc: Startup File. (line 6) * .wgetrc: Startup File. (line 6) * accept directories: Directory-Based Limits. (line 17) * accept suffixes: Types of Files. (line 15) * accept wildcards: Types of Files. (line 15) * append to log: Logging and Input File Options. (line 11) * arguments: Invoking. (line 6) * authentication <1>: HTTP Options. (line 39) * authentication: Download Options. (line 458) * backing up converted files: Recursive Retrieval Options. (line 71) * bandwidth, limit: Download Options. (line 249) * base for relative links in input file: Logging and Input File Options. (line 73) * bind address: Download Options. (line 6) * bug reports: Reporting Bugs. (line 6) * bugs: Reporting Bugs. (line 6) * cache: HTTP Options. (line 67) * caching of DNS lookups: Download Options. (line 334) * case fold: Recursive Accept/Reject Options. (line 51) * client IP address: Download Options. (line 6) * clobbering, file: Download Options. (line 51) * command line: Invoking. (line 6) * comments, HTML: Recursive Retrieval Options. (line 149) * connect timeout: Download Options. (line 232) * Content-Disposition: HTTP Options. (line 296) * Content-Length, ignore: HTTP Options. (line 156) * continue retrieval: Download Options. (line 87) * contributors: Contributors. (line 6) * conversion of links: Recursive Retrieval Options. (line 32) * cookies: HTTP Options. (line 76) * cookies, loading: HTTP Options. (line 86) * cookies, saving: HTTP Options. (line 134) * cookies, session: HTTP Options. (line 139) * cut directories: Directory Options. (line 32) * debug: Logging and Input File Options. (line 17) * default page name: HTTP Options. (line 6) * delete after retrieval: Recursive Retrieval Options. (line 16) * directories: Directory-Based Limits. (line 6) * directories, exclude: Directory-Based Limits. (line 30) * directories, include: Directory-Based Limits. (line 17) * directory limits: Directory-Based Limits. (line 6) * directory prefix: Directory Options. (line 60) * DNS cache: Download Options. (line 334) * DNS timeout: Download Options. (line 226) * dot style: Download Options. (line 148) * downloading multiple times: Download Options. (line 51) * EGD: HTTPS (SSL/TLS) Options. (line 101) * entropy, specifying source of: HTTPS (SSL/TLS) Options. (line 85) * examples: Examples. (line 6) * exclude directories: Directory-Based Limits. (line 30) * execute wgetrc command: Basic Startup Options. (line 19) * FDL, GNU Free Documentation License: GNU Free Documentation License. (line 6) * features: Overview. (line 6) * file names, restrict: Download Options. (line 353) * filling proxy cache: Recursive Retrieval Options. (line 16) * follow FTP links: Recursive Accept/Reject Options. (line 23) * following ftp links: FTP Links. (line 6) * following links: Following Links. (line 6) * force html: Logging and Input File Options. (line 66) * ftp authentication: FTP Options. (line 6) * ftp password: FTP Options. (line 6) * ftp time-stamping: FTP Time-Stamping Internals. (line 6) * ftp user: FTP Options. (line 6) * globbing, toggle: FTP Options. (line 45) * hangup: Signals. (line 6) * header, add: HTTP Options. (line 167) * hosts, spanning: Spanning Hosts. (line 6) * HTML comments: Recursive Retrieval Options. (line 149) * http password: HTTP Options. (line 39) * http referer: HTTP Options. (line 208) * http time-stamping: HTTP Time-Stamping Internals. (line 6) * http user: HTTP Options. (line 39) * idn support: Download Options. (line 471) * ignore case: Recursive Accept/Reject Options. (line 51) * ignore length: HTTP Options. (line 156) * include directories: Directory-Based Limits. (line 17) * incomplete downloads: Download Options. (line 87) * incremental updating: Time-Stamping. (line 6) * index.html: HTTP Options. (line 6) * input-file: Logging and Input File Options. (line 43) * Internet Relay Chat: Internet Relay Chat. (line 6) * invoking: Invoking. (line 6) * IP address, client: Download Options. (line 6) * IPv6: Download Options. (line 404) * IRC: Internet Relay Chat. (line 6) * iri support: Download Options. (line 471) * Keep-Alive, turning off: HTTP Options. (line 55) * latest version: Distribution. (line 6) * limit bandwidth: Download Options. (line 249) * link conversion: Recursive Retrieval Options. (line 32) * links: Following Links. (line 6) * list: Mailing Lists. (line 6) * loading cookies: HTTP Options. (line 86) * local encoding: Download Options. (line 479) * location of wgetrc: Wgetrc Location. (line 6) * log file: Logging and Input File Options. (line 6) * mailing list: Mailing Lists. (line 6) * mirroring: Very Advanced Usage. (line 6) * no parent: Directory-Based Limits. (line 43) * no-clobber: Download Options. (line 51) * nohup: Invoking. (line 6) * number of retries: Download Options. (line 12) * operating systems: Portability. (line 6) * option syntax: Option Syntax. (line 6) * output file: Logging and Input File Options. (line 6) * overview: Overview. (line 6) * page requisites: Recursive Retrieval Options. (line 84) * passive ftp: FTP Options. (line 61) * password: Download Options. (line 458) * pause: Download Options. (line 269) * Persistent Connections, disabling: HTTP Options. (line 55) * portability: Portability. (line 6) * POST: HTTP Options. (line 241) * progress indicator: Download Options. (line 148) * proxies: Proxies. (line 6) * proxy <1>: HTTP Options. (line 67) * proxy: Download Options. (line 311) * proxy authentication: HTTP Options. (line 199) * proxy filling: Recursive Retrieval Options. (line 16) * proxy password: HTTP Options. (line 199) * proxy user: HTTP Options. (line 199) * quiet: Logging and Input File Options. (line 28) * quota: Download Options. (line 318) * random wait: Download Options. (line 293) * randomness, specifying source of: HTTPS (SSL/TLS) Options. (line 85) * rate, limit: Download Options. (line 249) * read timeout: Download Options. (line 237) * recursion: Recursive Download. (line 6) * recursive download: Recursive Download. (line 6) * redirect: HTTP Options. (line 193) * redirecting output: Advanced Usage. (line 89) * referer, http: HTTP Options. (line 208) * reject directories: Directory-Based Limits. (line 30) * reject suffixes: Types of Files. (line 34) * reject wildcards: Types of Files. (line 34) * relative links: Relative Links. (line 6) * remote encoding: Download Options. (line 491) * reporting bugs: Reporting Bugs. (line 6) * required images, downloading: Recursive Retrieval Options. (line 84) * resume download: Download Options. (line 87) * retries: Download Options. (line 12) * retries, waiting between: Download Options. (line 283) * retrieving: Recursive Download. (line 6) * robot exclusion: Robot Exclusion. (line 6) * robots.txt: Robot Exclusion. (line 6) * sample wgetrc: Sample Wgetrc. (line 6) * saving cookies: HTTP Options. (line 134) * security: Security Considerations. (line 6) * server maintenance: Robot Exclusion. (line 6) * server response, print: Download Options. (line 192) * server response, save: HTTP Options. (line 215) * session cookies: HTTP Options. (line 139) * signal handling: Signals. (line 6) * spanning hosts: Spanning Hosts. (line 6) * specify config: Logging and Input File Options. (line 86) * spider: Download Options. (line 197) * SSL: HTTPS (SSL/TLS) Options. (line 6) * SSL certificate: HTTPS (SSL/TLS) Options. (line 47) * SSL certificate authority: HTTPS (SSL/TLS) Options. (line 73) * SSL certificate type, specify: HTTPS (SSL/TLS) Options. (line 53) * SSL certificate, check: HTTPS (SSL/TLS) Options. (line 23) * SSL protocol, choose: HTTPS (SSL/TLS) Options. (line 10) * startup: Startup File. (line 6) * startup file: Startup File. (line 6) * suffixes, accept: Types of Files. (line 15) * suffixes, reject: Types of Files. (line 34) * symbolic links, retrieving: FTP Options. (line 73) * syntax of options: Option Syntax. (line 6) * syntax of wgetrc: Wgetrc Syntax. (line 6) * tag-based recursive pruning: Recursive Accept/Reject Options. (line 27) * time-stamping: Time-Stamping. (line 6) * time-stamping usage: Time-Stamping Usage. (line 6) * timeout: Download Options. (line 208) * timeout, connect: Download Options. (line 232) * timeout, DNS: Download Options. (line 226) * timeout, read: Download Options. (line 237) * timestamping: Time-Stamping. (line 6) * tries: Download Options. (line 12) * Trust server names: HTTP Options. (line 307) * types of files: Types of Files. (line 6) * unlink: Download Options. (line 505) * updating the archives: Time-Stamping. (line 6) * URL: URL Format. (line 6) * URL syntax: URL Format. (line 6) * usage, time-stamping: Time-Stamping Usage. (line 6) * user: Download Options. (line 458) * user-agent: HTTP Options. (line 219) * various: Various. (line 6) * verbose: Logging and Input File Options. (line 32) * wait: Download Options. (line 269) * wait, random: Download Options. (line 293) * waiting between retries: Download Options. (line 283) * web site: Web Site. (line 6) * Wget as spider: Download Options. (line 197) * wgetrc: Startup File. (line 6) * wgetrc commands: Wgetrc Commands. (line 6) * wgetrc location: Wgetrc Location. (line 6) * wgetrc syntax: Wgetrc Syntax. (line 6) * wildcards, accept: Types of Files. (line 15) * wildcards, reject: Types of Files. (line 34) * Windows file names: Download Options. (line 353)  Tag Table: Node: Top840 Node: Overview2228 Node: Invoking5732 Node: URL Format6585 Ref: URL Format-Footnote-19175 Node: Option Syntax9277 Node: Basic Startup Options11954 Node: Logging and Input File Options12759 Node: Download Options16225 Node: Directory Options40426 Node: HTTP Options43131 Node: HTTPS (SSL/TLS) Options58254 Node: FTP Options63929 Node: Recursive Retrieval Options68395 Node: Recursive Accept/Reject Options76263 Node: Exit Status79741 Node: Recursive Download80764 Node: Following Links83937 Node: Spanning Hosts84899 Node: Types of Files87096 Node: Directory-Based Limits91458 Node: Relative Links94550 Node: FTP Links95387 Node: Time-Stamping96254 Node: Time-Stamping Usage97902 Node: HTTP Time-Stamping Internals99750 Ref: HTTP Time-Stamping Internals-Footnote-1101026 Node: FTP Time-Stamping Internals101225 Node: Startup File102691 Node: Wgetrc Location103605 Node: Wgetrc Syntax104425 Node: Wgetrc Commands105145 Node: Sample Wgetrc120498 Node: Examples126021 Node: Simple Usage126382 Node: Advanced Usage127803 Node: Very Advanced Usage131515 Node: Various133010 Node: Proxies133715 Node: Distribution136566 Node: Web Site136908 Node: Mailing Lists137203 Node: Internet Relay Chat139269 Node: Reporting Bugs139555 Node: Portability142074 Node: Signals143699 Node: Appendices144382 Node: Robot Exclusion144728 Node: Security Considerations148523 Node: Contributors149707 Node: Copying this manual155281 Node: GNU Free Documentation License155520 Node: Concept Index180702  End Tag Table 0707010005a6f5000041ed0000000000000000000000034fa8aa6600000000000000b500010002ffffffffffffffff0000001900000000root/usr/local/share/man0707010005a6f6000041ed0000000000000000000000024fa8aa6600000000000000b500010002ffffffffffffffff0000001e00000000root/usr/local/share/man/man10707010005a6f7000081a40000000000000000000000014fa8a70b00015065000000b500010002ffffffffffffffff0000002500000000root/usr/local/share/man/man1/wget.1.\" Automatically generated by Pod::Man 2.23 (Pod::Simple 3.14) .\" .\" Standard preamble: .\" ======================================================================== .de Sp \" Vertical space (when we can't use .PP) .if t .sp .5v .if n .sp .. .de Vb \" Begin verbatim text .ft CW .nf .ne \\$1 .. .de Ve \" End verbatim text .ft R .fi .. .\" Set up some character translations and predefined strings. \*(-- will .\" give an unbreakable dash, \*(PI will give pi, \*(L" will give a left .\" double quote, and \*(R" will give a right double quote. \*(C+ will .\" give a nicer C++. Capital omega is used to do unbreakable dashes and .\" therefore won't be available. \*(C` and \*(C' expand to `' in nroff, .\" nothing in troff, for use with C<>. .tr \(*W- .ds C+ C\v'-.1v'\h'-1p'\s-2+\h'-1p'+\s0\v'.1v'\h'-1p' .ie n \{\ . ds -- \(*W- . ds PI pi . if (\n(.H=4u)&(1m=24u) .ds -- \(*W\h'-12u'\(*W\h'-12u'-\" diablo 10 pitch . if (\n(.H=4u)&(1m=20u) .ds -- \(*W\h'-12u'\(*W\h'-8u'-\" diablo 12 pitch . ds L" "" . ds R" "" . ds C` "" . ds C' "" 'br\} .el\{\ . ds -- \|\(em\| . ds PI \(*p . ds L" `` . ds R" '' 'br\} .\" .\" Escape single quotes in literal strings from groff's Unicode transform. .ie \n(.g .ds Aq \(aq .el .ds Aq ' .\" .\" If the F register is turned on, we'll generate index entries on stderr for .\" titles (.TH), headers (.SH), subsections (.SS), items (.Ip), and index .\" entries marked with X<> in POD. Of course, you'll have to process the .\" output yourself in some meaningful fashion. .ie \nF \{\ . de IX . tm Index:\\$1\t\\n%\t"\\$2" .. . nr % 0 . rr F .\} .el \{\ . de IX .. .\} .\" .\" Accent mark definitions (@(#)ms.acc 1.5 88/02/08 SMI; from UCB 4.2). .\" Fear. Run. Save yourself. No user-serviceable parts. . \" fudge factors for nroff and troff .if n \{\ . ds #H 0 . ds #V .8m . ds #F .3m . ds #[ \f1 . ds #] \fP .\} .if t \{\ . ds #H ((1u-(\\\\n(.fu%2u))*.13m) . ds #V .6m . ds #F 0 . ds #[ \& . ds #] \& .\} . \" simple accents for nroff and troff .if n \{\ . ds ' \& . ds ` \& . ds ^ \& . ds , \& . ds ~ ~ . ds / .\} .if t \{\ . ds ' \\k:\h'-(\\n(.wu*8/10-\*(#H)'\'\h"|\\n:u" . ds ` \\k:\h'-(\\n(.wu*8/10-\*(#H)'\`\h'|\\n:u' . ds ^ \\k:\h'-(\\n(.wu*10/11-\*(#H)'^\h'|\\n:u' . ds , \\k:\h'-(\\n(.wu*8/10)',\h'|\\n:u' . ds ~ \\k:\h'-(\\n(.wu-\*(#H-.1m)'~\h'|\\n:u' . ds / \\k:\h'-(\\n(.wu*8/10-\*(#H)'\z\(sl\h'|\\n:u' .\} . \" troff and (daisy-wheel) nroff accents .ds : \\k:\h'-(\\n(.wu*8/10-\*(#H+.1m+\*(#F)'\v'-\*(#V'\z.\h'.2m+\*(#F'.\h'|\\n:u'\v'\*(#V' .ds 8 \h'\*(#H'\(*b\h'-\*(#H' .ds o \\k:\h'-(\\n(.wu+\w'\(de'u-\*(#H)/2u'\v'-.3n'\*(#[\z\(de\v'.3n'\h'|\\n:u'\*(#] .ds d- \h'\*(#H'\(pd\h'-\w'~'u'\v'-.25m'\f2\(hy\fP\v'.25m'\h'-\*(#H' .ds D- D\\k:\h'-\w'D'u'\v'-.11m'\z\(hy\v'.11m'\h'|\\n:u' .ds th \*(#[\v'.3m'\s+1I\s-1\v'-.3m'\h'-(\w'I'u*2/3)'\s-1o\s+1\*(#] .ds Th \*(#[\s+2I\s-2\h'-\w'I'u*3/5'\v'-.3m'o\v'.3m'\*(#] .ds ae a\h'-(\w'a'u*4/10)'e .ds Ae A\h'-(\w'A'u*4/10)'E . \" corrections for vroff .if v .ds ~ \\k:\h'-(\\n(.wu*9/10-\*(#H)'\s-2\u~\d\s+2\h'|\\n:u' .if v .ds ^ \\k:\h'-(\\n(.wu*10/11-\*(#H)'\v'-.4m'^\v'.4m'\h'|\\n:u' . \" for low resolution devices (crt and lpr) .if \n(.H>23 .if \n(.V>19 \ \{\ . ds : e . ds 8 ss . ds o a . ds d- d\h'-1'\(ga . ds D- D\h'-1'\(hy . ds th \o'bp' . ds Th \o'LP' . ds ae ae . ds Ae AE .\} .rm #[ #] #H #V #F C .\" ======================================================================== .\" .IX Title "WGET 1" .TH WGET 1 "2012-05-08" "GNU Wget 1.13.4" "GNU Wget" .\" For nroff, turn off justification. Always turn off hyphenation; it makes .\" way too many mistakes in technical documents. .if n .ad l .nh .SH "NAME" Wget \- The non\-interactive network downloader. .SH "SYNOPSIS" .IX Header "SYNOPSIS" wget [\fIoption\fR]... [\fI\s-1URL\s0\fR]... .SH "DESCRIPTION" .IX Header "DESCRIPTION" \&\s-1GNU\s0 Wget is a free utility for non-interactive download of files from the Web. It supports \s-1HTTP\s0, \s-1HTTPS\s0, and \s-1FTP\s0 protocols, as well as retrieval through \s-1HTTP\s0 proxies. .PP Wget is non-interactive, meaning that it can work in the background, while the user is not logged on. This allows you to start a retrieval and disconnect from the system, letting Wget finish the work. By contrast, most of the Web browsers require constant user's presence, which can be a great hindrance when transferring a lot of data. .PP Wget can follow links in \s-1HTML\s0, \s-1XHTML\s0, and \s-1CSS\s0 pages, to create local versions of remote web sites, fully recreating the directory structure of the original site. This is sometimes referred to as \*(L"recursive downloading.\*(R" While doing that, Wget respects the Robot Exclusion Standard (\fI/robots.txt\fR). Wget can be instructed to convert the links in downloaded files to point at the local files, for offline viewing. .PP Wget has been designed for robustness over slow or unstable network connections; if a download fails due to a network problem, it will keep retrying until the whole file has been retrieved. If the server supports regetting, it will instruct the server to continue the download from where it left off. .SH "OPTIONS" .IX Header "OPTIONS" .SS "Option Syntax" .IX Subsection "Option Syntax" Since Wget uses \s-1GNU\s0 getopt to process command-line arguments, every option has a long form along with the short one. Long options are more convenient to remember, but take time to type. You may freely mix different option styles, or specify options after the command-line arguments. Thus you may write: .PP .Vb 1 \& wget \-r \-\-tries=10 http://fly.srk.fer.hr/ \-o log .Ve .PP The space between the option accepting an argument and the argument may be omitted. Instead of \fB\-o log\fR you can write \fB\-olog\fR. .PP You may put several options that do not require arguments together, like: .PP .Vb 1 \& wget \-drc .Ve .PP This is completely equivalent to: .PP .Vb 1 \& wget \-d \-r \-c .Ve .PP Since the options can be specified after the arguments, you may terminate them with \fB\-\-\fR. So the following will try to download \&\s-1URL\s0 \fB\-x\fR, reporting failure to \fIlog\fR: .PP .Vb 1 \& wget \-o log \-\- \-x .Ve .PP The options that accept comma-separated lists all respect the convention that specifying an empty list clears its value. This can be useful to clear the \fI.wgetrc\fR settings. For instance, if your \fI.wgetrc\fR sets \f(CW\*(C`exclude_directories\*(C'\fR to \fI/cgi\-bin\fR, the following example will first reset it, and then set it to exclude \fI/~nobody\fR and \fI/~somebody\fR. You can also clear the lists in \fI.wgetrc\fR. .PP .Vb 1 \& wget \-X " \-X /~nobody,/~somebody .Ve .PP Most options that do not accept arguments are \fIboolean\fR options, so named because their state can be captured with a yes-or-no (\*(L"boolean\*(R") variable. For example, \fB\-\-follow\-ftp\fR tells Wget to follow \s-1FTP\s0 links from \s-1HTML\s0 files and, on the other hand, \&\fB\-\-no\-glob\fR tells it not to perform file globbing on \s-1FTP\s0 URLs. A boolean option is either \fIaffirmative\fR or \fInegative\fR (beginning with \fB\-\-no\fR). All such options share several properties. .PP Unless stated otherwise, it is assumed that the default behavior is the opposite of what the option accomplishes. For example, the documented existence of \fB\-\-follow\-ftp\fR assumes that the default is to \fInot\fR follow \s-1FTP\s0 links from \s-1HTML\s0 pages. .PP Affirmative options can be negated by prepending the \fB\-\-no\-\fR to the option name; negative options can be negated by omitting the \&\fB\-\-no\-\fR prefix. This might seem superfluous\-\-\-if the default for an affirmative option is to not do something, then why provide a way to explicitly turn it off? But the startup file may in fact change the default. For instance, using \f(CW\*(C`follow_ftp = on\*(C'\fR in \&\fI.wgetrc\fR makes Wget \fIfollow\fR \s-1FTP\s0 links by default, and using \fB\-\-no\-follow\-ftp\fR is the only way to restore the factory default from the command line. .SS "Basic Startup Options" .IX Subsection "Basic Startup Options" .IP "\fB\-V\fR" 4 .IX Item "-V" .PD 0 .IP "\fB\-\-version\fR" 4 .IX Item "--version" .PD Display the version of Wget. .IP "\fB\-h\fR" 4 .IX Item "-h" .PD 0 .IP "\fB\-\-help\fR" 4 .IX Item "--help" .PD Print a help message describing all of Wget's command-line options. .IP "\fB\-b\fR" 4 .IX Item "-b" .PD 0 .IP "\fB\-\-background\fR" 4 .IX Item "--background" .PD Go to background immediately after startup. If no output file is specified via the \fB\-o\fR, output is redirected to \fIwget-log\fR. .IP "\fB\-e\fR \fIcommand\fR" 4 .IX Item "-e command" .PD 0 .IP "\fB\-\-execute\fR \fIcommand\fR" 4 .IX Item "--execute command" .PD Execute \fIcommand\fR as if it were a part of \fI.wgetrc\fR. A command thus invoked will be executed \&\fIafter\fR the commands in \fI.wgetrc\fR, thus taking precedence over them. If you need to specify more than one wgetrc command, use multiple instances of \fB\-e\fR. .SS "Logging and Input File Options" .IX Subsection "Logging and Input File Options" .IP "\fB\-o\fR \fIlogfile\fR" 4 .IX Item "-o logfile" .PD 0 .IP "\fB\-\-output\-file=\fR\fIlogfile\fR" 4 .IX Item "--output-file=logfile" .PD Log all messages to \fIlogfile\fR. The messages are normally reported to standard error. .IP "\fB\-a\fR \fIlogfile\fR" 4 .IX Item "-a logfile" .PD 0 .IP "\fB\-\-append\-output=\fR\fIlogfile\fR" 4 .IX Item "--append-output=logfile" .PD Append to \fIlogfile\fR. This is the same as \fB\-o\fR, only it appends to \fIlogfile\fR instead of overwriting the old log file. If \&\fIlogfile\fR does not exist, a new file is created. .IP "\fB\-d\fR" 4 .IX Item "-d" .PD 0 .IP "\fB\-\-debug\fR" 4 .IX Item "--debug" .PD Turn on debug output, meaning various information important to the developers of Wget if it does not work properly. Your system administrator may have chosen to compile Wget without debug support, in which case \fB\-d\fR will not work. Please note that compiling with debug support is always safe\-\-\-Wget compiled with the debug support will \&\fInot\fR print any debug info unless requested with \fB\-d\fR. .IP "\fB\-q\fR" 4 .IX Item "-q" .PD 0 .IP "\fB\-\-quiet\fR" 4 .IX Item "--quiet" .PD Turn off Wget's output. .IP "\fB\-v\fR" 4 .IX Item "-v" .PD 0 .IP "\fB\-\-verbose\fR" 4 .IX Item "--verbose" .PD Turn on verbose output, with all the available data. The default output is verbose. .IP "\fB\-nv\fR" 4 .IX Item "-nv" .PD 0 .IP "\fB\-\-no\-verbose\fR" 4 .IX Item "--no-verbose" .PD Turn off verbose without being completely quiet (use \fB\-q\fR for that), which means that error messages and basic information still get printed. .IP "\fB\-i\fR \fIfile\fR" 4 .IX Item "-i file" .PD 0 .IP "\fB\-\-input\-file=\fR\fIfile\fR" 4 .IX Item "--input-file=file" .PD Read URLs from a local or external \fIfile\fR. If \fB\-\fR is specified as \fIfile\fR, URLs are read from the standard input. (Use \fB./\-\fR to read from a file literally named \fB\-\fR.) .Sp If this function is used, no URLs need be present on the command line. If there are URLs both on the command line and in an input file, those on the command lines will be the first ones to be retrieved. If \fB\-\-force\-html\fR is not specified, then \fIfile\fR should consist of a series of URLs, one per line. .Sp However, if you specify \fB\-\-force\-html\fR, the document will be regarded as \fBhtml\fR. In that case you may have problems with relative links, which you can solve either by adding \f(CW\*(C`\*(C'\fR to the documents or by specifying \&\fB\-\-base=\fR\fIurl\fR on the command line. .Sp If the \fIfile\fR is an external one, the document will be automatically treated as \fBhtml\fR if the Content-Type matches \fBtext/html\fR. Furthermore, the \fIfile\fR's location will be implicitly used as base href if none was specified. .IP "\fB\-F\fR" 4 .IX Item "-F" .PD 0 .IP "\fB\-\-force\-html\fR" 4 .IX Item "--force-html" .PD When input is read from a file, force it to be treated as an \s-1HTML\s0 file. This enables you to retrieve relative links from existing \&\s-1HTML\s0 files on your local disk, by adding \f(CW\*(C`\*(C'\fR to \s-1HTML\s0, or using the \fB\-\-base\fR command-line option. .IP "\fB\-B\fR \fI\s-1URL\s0\fR" 4 .IX Item "-B URL" .PD 0 .IP "\fB\-\-base=\fR\fI\s-1URL\s0\fR" 4 .IX Item "--base=URL" .PD Resolves relative links using \fI\s-1URL\s0\fR as the point of reference, when reading links from an \s-1HTML\s0 file specified via the \&\fB\-i\fR/\fB\-\-input\-file\fR option (together with \&\fB\-\-force\-html\fR, or when the input file was fetched remotely from a server describing it as \s-1HTML\s0). This is equivalent to the presence of a \f(CW\*(C`BASE\*(C'\fR tag in the \s-1HTML\s0 input file, with \&\fI\s-1URL\s0\fR as the value for the \f(CW\*(C`href\*(C'\fR attribute. .Sp For instance, if you specify \fBhttp://foo/bar/a.html\fR for \&\fI\s-1URL\s0\fR, and Wget reads \fB../baz/b.html\fR from the input file, it would be resolved to \fBhttp://foo/baz/b.html\fR. .IP "\fB\-\-config=\fR\fI\s-1FILE\s0\fR" 4 .IX Item "--config=FILE" Specify the location of a startup file you wish to use. .SS "Download Options" .IX Subsection "Download Options" .IP "\fB\-\-bind\-address=\fR\fI\s-1ADDRESS\s0\fR" 4 .IX Item "--bind-address=ADDRESS" When making client \s-1TCP/IP\s0 connections, bind to \fI\s-1ADDRESS\s0\fR on the local machine. \fI\s-1ADDRESS\s0\fR may be specified as a hostname or \s-1IP\s0 address. This option can be useful if your machine is bound to multiple IPs. .IP "\fB\-t\fR \fInumber\fR" 4 .IX Item "-t number" .PD 0 .IP "\fB\-\-tries=\fR\fInumber\fR" 4 .IX Item "--tries=number" .PD Set number of retries to \fInumber\fR. Specify 0 or \fBinf\fR for infinite retrying. The default is to retry 20 times, with the exception of fatal errors like \*(L"connection refused\*(R" or \*(L"not found\*(R" (404), which are not retried. .IP "\fB\-O\fR \fIfile\fR" 4 .IX Item "-O file" .PD 0 .IP "\fB\-\-output\-document=\fR\fIfile\fR" 4 .IX Item "--output-document=file" .PD The documents will not be written to the appropriate files, but all will be concatenated together and written to \fIfile\fR. If \fB\-\fR is used as \fIfile\fR, documents will be printed to standard output, disabling link conversion. (Use \fB./\-\fR to print to a file literally named \fB\-\fR.) .Sp Use of \fB\-O\fR is \fInot\fR intended to mean simply "use the name \&\fIfile\fR instead of the one in the \s-1URL\s0;" rather, it is analogous to shell redirection: \&\fBwget \-O file http://foo\fR is intended to work like \&\fBwget \-O \- http://foo > file\fR; \fIfile\fR will be truncated immediately, and \fIall\fR downloaded content will be written there. .Sp For this reason, \fB\-N\fR (for timestamp-checking) is not supported in combination with \fB\-O\fR: since \fIfile\fR is always newly created, it will always have a very new timestamp. A warning will be issued if this combination is used. .Sp Similarly, using \fB\-r\fR or \fB\-p\fR with \fB\-O\fR may not work as you expect: Wget won't just download the first file to \fIfile\fR and then download the rest to their normal names: \fIall\fR downloaded content will be placed in \fIfile\fR. This was disabled in version 1.11, but has been reinstated (with a warning) in 1.11.2, as there are some cases where this behavior can actually have some use. .Sp Note that a combination with \fB\-k\fR is only permitted when downloading a single document, as in that case it will just convert all relative URIs to external ones; \fB\-k\fR makes no sense for multiple URIs when they're all being downloaded to a single file; \&\fB\-k\fR can be used only when the output is a regular file. .IP "\fB\-nc\fR" 4 .IX Item "-nc" .PD 0 .IP "\fB\-\-no\-clobber\fR" 4 .IX Item "--no-clobber" .PD If a file is downloaded more than once in the same directory, Wget's behavior depends on a few options, including \fB\-nc\fR. In certain cases, the local file will be \fIclobbered\fR, or overwritten, upon repeated download. In other cases it will be preserved. .Sp When running Wget without \fB\-N\fR, \fB\-nc\fR, \fB\-r\fR, or \&\fB\-p\fR, downloading the same file in the same directory will result in the original copy of \fIfile\fR being preserved and the second copy being named \fIfile\fR\fB.1\fR. If that file is downloaded yet again, the third copy will be named \fIfile\fR\fB.2\fR, and so on. (This is also the behavior with \fB\-nd\fR, even if \fB\-r\fR or \&\fB\-p\fR are in effect.) When \fB\-nc\fR is specified, this behavior is suppressed, and Wget will refuse to download newer copies of \&\fIfile\fR. Therefore, "\f(CW\*(C`no\-clobber\*(C'\fR" is actually a misnomer in this mode\-\-\-it's not clobbering that's prevented (as the numeric suffixes were already preventing clobbering), but rather the multiple version saving that's prevented. .Sp When running Wget with \fB\-r\fR or \fB\-p\fR, but without \fB\-N\fR, \&\fB\-nd\fR, or \fB\-nc\fR, re-downloading a file will result in the new copy simply overwriting the old. Adding \fB\-nc\fR will prevent this behavior, instead causing the original version to be preserved and any newer copies on the server to be ignored. .Sp When running Wget with \fB\-N\fR, with or without \fB\-r\fR or \&\fB\-p\fR, the decision as to whether or not to download a newer copy of a file depends on the local and remote timestamp and size of the file. \fB\-nc\fR may not be specified at the same time as \fB\-N\fR. .Sp Note that when \fB\-nc\fR is specified, files with the suffixes \&\fB.html\fR or \fB.htm\fR will be loaded from the local disk and parsed as if they had been retrieved from the Web. .IP "\fB\-c\fR" 4 .IX Item "-c" .PD 0 .IP "\fB\-\-continue\fR" 4 .IX Item "--continue" .PD Continue getting a partially-downloaded file. This is useful when you want to finish up a download started by a previous instance of Wget, or by another program. For instance: .Sp .Vb 1 \& wget \-c ftp://sunsite.doc.ic.ac.uk/ls\-lR.Z .Ve .Sp If there is a file named \fIls\-lR.Z\fR in the current directory, Wget will assume that it is the first portion of the remote file, and will ask the server to continue the retrieval from an offset equal to the length of the local file. .Sp Note that you don't need to specify this option if you just want the current invocation of Wget to retry downloading a file should the connection be lost midway through. This is the default behavior. \&\fB\-c\fR only affects resumption of downloads started \fIprior\fR to this invocation of Wget, and whose local files are still sitting around. .Sp Without \fB\-c\fR, the previous example would just download the remote file to \fIls\-lR.Z.1\fR, leaving the truncated \fIls\-lR.Z\fR file alone. .Sp Beginning with Wget 1.7, if you use \fB\-c\fR on a non-empty file, and it turns out that the server does not support continued downloading, Wget will refuse to start the download from scratch, which would effectively ruin existing contents. If you really want the download to start from scratch, remove the file. .Sp Also beginning with Wget 1.7, if you use \fB\-c\fR on a file which is of equal size as the one on the server, Wget will refuse to download the file and print an explanatory message. The same happens when the file is smaller on the server than locally (presumably because it was changed on the server since your last download attempt)\-\-\-because \*(L"continuing\*(R" is not meaningful, no download occurs. .Sp On the other side of the coin, while using \fB\-c\fR, any file that's bigger on the server than locally will be considered an incomplete download and only \f(CW\*(C`(length(remote) \- length(local))\*(C'\fR bytes will be downloaded and tacked onto the end of the local file. This behavior can be desirable in certain cases\-\-\-for instance, you can use \fBwget \-c\fR to download just the new portion that's been appended to a data collection or log file. .Sp However, if the file is bigger on the server because it's been \&\fIchanged\fR, as opposed to just \fIappended\fR to, you'll end up with a garbled file. Wget has no way of verifying that the local file is really a valid prefix of the remote file. You need to be especially careful of this when using \fB\-c\fR in conjunction with \fB\-r\fR, since every file will be considered as an \*(L"incomplete download\*(R" candidate. .Sp Another instance where you'll get a garbled file if you try to use \&\fB\-c\fR is if you have a lame \s-1HTTP\s0 proxy that inserts a \&\*(L"transfer interrupted\*(R" string into the local file. In the future a \&\*(L"rollback\*(R" option may be added to deal with this case. .Sp Note that \fB\-c\fR only works with \s-1FTP\s0 servers and with \s-1HTTP\s0 servers that support the \f(CW\*(C`Range\*(C'\fR header. .IP "\fB\-\-progress=\fR\fItype\fR" 4 .IX Item "--progress=type" Select the type of the progress indicator you wish to use. Legal indicators are \*(L"dot\*(R" and \*(L"bar\*(R". .Sp The \*(L"bar\*(R" indicator is used by default. It draws an \s-1ASCII\s0 progress bar graphics (a.k.a \*(L"thermometer\*(R" display) indicating the status of retrieval. If the output is not a \s-1TTY\s0, the \*(L"dot\*(R" bar will be used by default. .Sp Use \fB\-\-progress=dot\fR to switch to the \*(L"dot\*(R" display. It traces the retrieval by printing dots on the screen, each dot representing a fixed amount of downloaded data. .Sp When using the dotted retrieval, you may also set the \fIstyle\fR by specifying the type as \fBdot:\fR\fIstyle\fR. Different styles assign different meaning to one dot. With the \f(CW\*(C`default\*(C'\fR style each dot represents 1K, there are ten dots in a cluster and 50 dots in a line. The \f(CW\*(C`binary\*(C'\fR style has a more \*(L"computer\*(R"\-like orientation\-\-\-8K dots, 16\-dots clusters and 48 dots per line (which makes for 384K lines). The \f(CW\*(C`mega\*(C'\fR style is suitable for downloading very large files\-\-\-each dot represents 64K retrieved, there are eight dots in a cluster, and 48 dots on each line (so each line contains 3M). .Sp Note that you can set the default style using the \f(CW\*(C`progress\*(C'\fR command in \fI.wgetrc\fR. That setting may be overridden from the command line. The exception is that, when the output is not a \s-1TTY\s0, the \&\*(L"dot\*(R" progress will be favored over \*(L"bar\*(R". To force the bar output, use \fB\-\-progress=bar:force\fR. .IP "\fB\-N\fR" 4 .IX Item "-N" .PD 0 .IP "\fB\-\-timestamping\fR" 4 .IX Item "--timestamping" .PD Turn on time-stamping. .IP "\fB\-\-no\-use\-server\-timestamps\fR" 4 .IX Item "--no-use-server-timestamps" Don't set the local file's timestamp by the one on the server. .Sp By default, when a file is downloaded, it's timestamps are set to match those from the remote file. This allows the use of \&\fB\-\-timestamping\fR on subsequent invocations of wget. However, it is sometimes useful to base the local file's timestamp on when it was actually downloaded; for that purpose, the \&\fB\-\-no\-use\-server\-timestamps\fR option has been provided. .IP "\fB\-S\fR" 4 .IX Item "-S" .PD 0 .IP "\fB\-\-server\-response\fR" 4 .IX Item "--server-response" .PD Print the headers sent by \s-1HTTP\s0 servers and responses sent by \&\s-1FTP\s0 servers. .IP "\fB\-\-spider\fR" 4 .IX Item "--spider" When invoked with this option, Wget will behave as a Web \fIspider\fR, which means that it will not download the pages, just check that they are there. For example, you can use Wget to check your bookmarks: .Sp .Vb 1 \& wget \-\-spider \-\-force\-html \-i bookmarks.html .Ve .Sp This feature needs much more work for Wget to get close to the functionality of real web spiders. .IP "\fB\-T seconds\fR" 4 .IX Item "-T seconds" .PD 0 .IP "\fB\-\-timeout=\fR\fIseconds\fR" 4 .IX Item "--timeout=seconds" .PD Set the network timeout to \fIseconds\fR seconds. This is equivalent to specifying \fB\-\-dns\-timeout\fR, \fB\-\-connect\-timeout\fR, and \&\fB\-\-read\-timeout\fR, all at the same time. .Sp When interacting with the network, Wget can check for timeout and abort the operation if it takes too long. This prevents anomalies like hanging reads and infinite connects. The only timeout enabled by default is a 900\-second read timeout. Setting a timeout to 0 disables it altogether. Unless you know what you are doing, it is best not to change the default timeout settings. .Sp All timeout-related options accept decimal values, as well as subsecond values. For example, \fB0.1\fR seconds is a legal (though unwise) choice of timeout. Subsecond timeouts are useful for checking server response times or for testing network latency. .IP "\fB\-\-dns\-timeout=\fR\fIseconds\fR" 4 .IX Item "--dns-timeout=seconds" Set the \s-1DNS\s0 lookup timeout to \fIseconds\fR seconds. \s-1DNS\s0 lookups that don't complete within the specified time will fail. By default, there is no timeout on \s-1DNS\s0 lookups, other than that implemented by system libraries. .IP "\fB\-\-connect\-timeout=\fR\fIseconds\fR" 4 .IX Item "--connect-timeout=seconds" Set the connect timeout to \fIseconds\fR seconds. \s-1TCP\s0 connections that take longer to establish will be aborted. By default, there is no connect timeout, other than that implemented by system libraries. .IP "\fB\-\-read\-timeout=\fR\fIseconds\fR" 4 .IX Item "--read-timeout=seconds" Set the read (and write) timeout to \fIseconds\fR seconds. The \&\*(L"time\*(R" of this timeout refers to \fIidle time\fR: if, at any point in the download, no data is received for more than the specified number of seconds, reading fails and the download is restarted. This option does not directly affect the duration of the entire download. .Sp Of course, the remote server may choose to terminate the connection sooner than this option requires. The default read timeout is 900 seconds. .IP "\fB\-\-limit\-rate=\fR\fIamount\fR" 4 .IX Item "--limit-rate=amount" Limit the download speed to \fIamount\fR bytes per second. Amount may be expressed in bytes, kilobytes with the \fBk\fR suffix, or megabytes with the \fBm\fR suffix. For example, \fB\-\-limit\-rate=20k\fR will limit the retrieval rate to 20KB/s. This is useful when, for whatever reason, you don't want Wget to consume the entire available bandwidth. .Sp This option allows the use of decimal numbers, usually in conjunction with power suffixes; for example, \fB\-\-limit\-rate=2.5k\fR is a legal value. .Sp Note that Wget implements the limiting by sleeping the appropriate amount of time after a network read that took less time than specified by the rate. Eventually this strategy causes the \s-1TCP\s0 transfer to slow down to approximately the specified rate. However, it may take some time for this balance to be achieved, so don't be surprised if limiting the rate doesn't work well with very small files. .IP "\fB\-w\fR \fIseconds\fR" 4 .IX Item "-w seconds" .PD 0 .IP "\fB\-\-wait=\fR\fIseconds\fR" 4 .IX Item "--wait=seconds" .PD Wait the specified number of seconds between the retrievals. Use of this option is recommended, as it lightens the server load by making the requests less frequent. Instead of in seconds, the time can be specified in minutes using the \f(CW\*(C`m\*(C'\fR suffix, in hours using \f(CW\*(C`h\*(C'\fR suffix, or in days using \f(CW\*(C`d\*(C'\fR suffix. .Sp Specifying a large value for this option is useful if the network or the destination host is down, so that Wget can wait long enough to reasonably expect the network error to be fixed before the retry. The waiting interval specified by this function is influenced by \&\f(CW\*(C`\-\-random\-wait\*(C'\fR, which see. .IP "\fB\-\-waitretry=\fR\fIseconds\fR" 4 .IX Item "--waitretry=seconds" If you don't want Wget to wait between \fIevery\fR retrieval, but only between retries of failed downloads, you can use this option. Wget will use \fIlinear backoff\fR, waiting 1 second after the first failure on a given file, then waiting 2 seconds after the second failure on that file, up to the maximum number of \fIseconds\fR you specify. .Sp By default, Wget will assume a value of 10 seconds. .IP "\fB\-\-random\-wait\fR" 4 .IX Item "--random-wait" Some web sites may perform log analysis to identify retrieval programs such as Wget by looking for statistically significant similarities in the time between requests. This option causes the time between requests to vary between 0.5 and 1.5 * \fIwait\fR seconds, where \fIwait\fR was specified using the \fB\-\-wait\fR option, in order to mask Wget's presence from such analysis. .Sp A 2001 article in a publication devoted to development on a popular consumer platform provided code to perform this analysis on the fly. Its author suggested blocking at the class C address level to ensure automated retrieval programs were blocked despite changing DHCP-supplied addresses. .Sp The \fB\-\-random\-wait\fR option was inspired by this ill-advised recommendation to block many unrelated users from a web site due to the actions of one. .IP "\fB\-\-no\-proxy\fR" 4 .IX Item "--no-proxy" Don't use proxies, even if the appropriate \f(CW*_proxy\fR environment variable is defined. .IP "\fB\-Q\fR \fIquota\fR" 4 .IX Item "-Q quota" .PD 0 .IP "\fB\-\-quota=\fR\fIquota\fR" 4 .IX Item "--quota=quota" .PD Specify download quota for automatic retrievals. The value can be specified in bytes (default), kilobytes (with \fBk\fR suffix), or megabytes (with \fBm\fR suffix). .Sp Note that quota will never affect downloading a single file. So if you specify \fBwget \-Q10k ftp://wuarchive.wustl.edu/ls\-lR.gz\fR, all of the \&\fIls\-lR.gz\fR will be downloaded. The same goes even when several URLs are specified on the command-line. However, quota is respected when retrieving either recursively, or from an input file. Thus you may safely type \fBwget \-Q2m \-i sites\fR\-\-\-download will be aborted when the quota is exceeded. .Sp Setting quota to 0 or to \fBinf\fR unlimits the download quota. .IP "\fB\-\-no\-dns\-cache\fR" 4 .IX Item "--no-dns-cache" Turn off caching of \s-1DNS\s0 lookups. Normally, Wget remembers the \s-1IP\s0 addresses it looked up from \s-1DNS\s0 so it doesn't have to repeatedly contact the \s-1DNS\s0 server for the same (typically small) set of hosts it retrieves from. This cache exists in memory only; a new Wget run will contact \s-1DNS\s0 again. .Sp However, it has been reported that in some situations it is not desirable to cache host names, even for the duration of a short-running application like Wget. With this option Wget issues a new \s-1DNS\s0 lookup (more precisely, a new call to \f(CW\*(C`gethostbyname\*(C'\fR or \&\f(CW\*(C`getaddrinfo\*(C'\fR) each time it makes a new connection. Please note that this option will \fInot\fR affect caching that might be performed by the resolving library or by an external caching layer, such as \s-1NSCD\s0. .Sp If you don't understand exactly what this option does, you probably won't need it. .IP "\fB\-\-restrict\-file\-names=\fR\fImodes\fR" 4 .IX Item "--restrict-file-names=modes" Change which characters found in remote URLs must be escaped during generation of local filenames. Characters that are \fIrestricted\fR by this option are escaped, i.e. replaced with \fB\f(CB%HH\fB\fR, where \&\fB\s-1HH\s0\fR is the hexadecimal number that corresponds to the restricted character. This option may also be used to force all alphabetical cases to be either lower\- or uppercase. .Sp By default, Wget escapes the characters that are not valid or safe as part of file names on your operating system, as well as control characters that are typically unprintable. This option is useful for changing these defaults, perhaps because you are downloading to a non-native partition, or because you want to disable escaping of the control characters, or you want to further restrict characters to only those in the \s-1ASCII\s0 range of values. .Sp The \fImodes\fR are a comma-separated set of text values. The acceptable values are \fBunix\fR, \fBwindows\fR, \fBnocontrol\fR, \&\fBascii\fR, \fBlowercase\fR, and \fBuppercase\fR. The values \&\fBunix\fR and \fBwindows\fR are mutually exclusive (one will override the other), as are \fBlowercase\fR and \&\fBuppercase\fR. Those last are special cases, as they do not change the set of characters that would be escaped, but rather force local file paths to be converted either to lower\- or uppercase. .Sp When \*(L"unix\*(R" is specified, Wget escapes the character \fB/\fR and the control characters in the ranges 0\-\-31 and 128\-\-159. This is the default on Unix-like operating systems. .Sp When \*(L"windows\*(R" is given, Wget escapes the characters \fB\e\fR, \&\fB|\fR, \fB/\fR, \fB:\fR, \fB?\fR, \fB"\fR, \fB*\fR, \fB<\fR, \&\fB>\fR, and the control characters in the ranges 0\-\-31 and 128\-\-159. In addition to this, Wget in Windows mode uses \fB+\fR instead of \&\fB:\fR to separate host and port in local file names, and uses \&\fB@\fR instead of \fB?\fR to separate the query portion of the file name from the rest. Therefore, a \s-1URL\s0 that would be saved as \&\fBwww.xemacs.org:4300/search.pl?input=blah\fR in Unix mode would be saved as \fBwww.xemacs.org+4300/search.pl@input=blah\fR in Windows mode. This mode is the default on Windows. .Sp If you specify \fBnocontrol\fR, then the escaping of the control characters is also switched off. This option may make sense when you are downloading URLs whose names contain \s-1UTF\-8\s0 characters, on a system which can save and display filenames in \s-1UTF\-8\s0 (some possible byte values used in \s-1UTF\-8\s0 byte sequences fall in the range of values designated by Wget as \*(L"controls\*(R"). .Sp The \fBascii\fR mode is used to specify that any bytes whose values are outside the range of \s-1ASCII\s0 characters (that is, greater than 127) shall be escaped. This can be useful when saving filenames whose encoding does not match the one used locally. .IP "\fB\-4\fR" 4 .IX Item "-4" .PD 0 .IP "\fB\-\-inet4\-only\fR" 4 .IX Item "--inet4-only" .IP "\fB\-6\fR" 4 .IX Item "-6" .IP "\fB\-\-inet6\-only\fR" 4 .IX Item "--inet6-only" .PD Force connecting to IPv4 or IPv6 addresses. With \fB\-\-inet4\-only\fR or \fB\-4\fR, Wget will only connect to IPv4 hosts, ignoring \s-1AAAA\s0 records in \s-1DNS\s0, and refusing to connect to IPv6 addresses specified in URLs. Conversely, with \fB\-\-inet6\-only\fR or \fB\-6\fR, Wget will only connect to IPv6 hosts and ignore A records and IPv4 addresses. .Sp Neither options should be needed normally. By default, an IPv6\-aware Wget will use the address family specified by the host's \s-1DNS\s0 record. If the \s-1DNS\s0 responds with both IPv4 and IPv6 addresses, Wget will try them in sequence until it finds one it can connect to. (Also see \&\f(CW\*(C`\-\-prefer\-family\*(C'\fR option described below.) .Sp These options can be used to deliberately force the use of IPv4 or IPv6 address families on dual family systems, usually to aid debugging or to deal with broken network configuration. Only one of \&\fB\-\-inet6\-only\fR and \fB\-\-inet4\-only\fR may be specified at the same time. Neither option is available in Wget compiled without IPv6 support. .IP "\fB\-\-prefer\-family=none/IPv4/IPv6\fR" 4 .IX Item "--prefer-family=none/IPv4/IPv6" When given a choice of several addresses, connect to the addresses with specified address family first. The address order returned by \&\s-1DNS\s0 is used without change by default. .Sp This avoids spurious errors and connect attempts when accessing hosts that resolve to both IPv6 and IPv4 addresses from IPv4 networks. For example, \fBwww.kame.net\fR resolves to \&\fB2001:200:0:8002:203:47ff:fea5:3085\fR and to \&\fB203.178.141.194\fR. When the preferred family is \f(CW\*(C`IPv4\*(C'\fR, the IPv4 address is used first; when the preferred family is \f(CW\*(C`IPv6\*(C'\fR, the IPv6 address is used first; if the specified value is \f(CW\*(C`none\*(C'\fR, the address order returned by \s-1DNS\s0 is used without change. .Sp Unlike \fB\-4\fR and \fB\-6\fR, this option doesn't inhibit access to any address family, it only changes the \fIorder\fR in which the addresses are accessed. Also note that the reordering performed by this option is \fIstable\fR\-\-\-it doesn't affect order of addresses of the same family. That is, the relative order of all IPv4 addresses and of all IPv6 addresses remains intact in all cases. .IP "\fB\-\-retry\-connrefused\fR" 4 .IX Item "--retry-connrefused" Consider \*(L"connection refused\*(R" a transient error and try again. Normally Wget gives up on a \s-1URL\s0 when it is unable to connect to the site because failure to connect is taken as a sign that the server is not running at all and that retries would not help. This option is for mirroring unreliable sites whose servers tend to disappear for short periods of time. .IP "\fB\-\-user=\fR\fIuser\fR" 4 .IX Item "--user=user" .PD 0 .IP "\fB\-\-password=\fR\fIpassword\fR" 4 .IX Item "--password=password" .PD Specify the username \fIuser\fR and password \fIpassword\fR for both \&\s-1FTP\s0 and \s-1HTTP\s0 file retrieval. These parameters can be overridden using the \fB\-\-ftp\-user\fR and \fB\-\-ftp\-password\fR options for \&\s-1FTP\s0 connections and the \fB\-\-http\-user\fR and \fB\-\-http\-password\fR options for \s-1HTTP\s0 connections. .IP "\fB\-\-ask\-password\fR" 4 .IX Item "--ask-password" Prompt for a password for each connection established. Cannot be specified when \fB\-\-password\fR is being used, because they are mutually exclusive. .IP "\fB\-\-no\-iri\fR" 4 .IX Item "--no-iri" Turn off internationalized \s-1URI\s0 (\s-1IRI\s0) support. Use \fB\-\-iri\fR to turn it on. \s-1IRI\s0 support is activated by default. .Sp You can set the default state of \s-1IRI\s0 support using the \f(CW\*(C`iri\*(C'\fR command in \fI.wgetrc\fR. That setting may be overridden from the command line. .IP "\fB\-\-local\-encoding=\fR\fIencoding\fR" 4 .IX Item "--local-encoding=encoding" Force Wget to use \fIencoding\fR as the default system encoding. That affects how Wget converts URLs specified as arguments from locale to \s-1UTF\-8\s0 for \&\s-1IRI\s0 support. .Sp Wget use the function \f(CW\*(C`nl_langinfo()\*(C'\fR and then the \f(CW\*(C`CHARSET\*(C'\fR environment variable to get the locale. If it fails, \s-1ASCII\s0 is used. .Sp You can set the default local encoding using the \f(CW\*(C`local_encoding\*(C'\fR command in \fI.wgetrc\fR. That setting may be overridden from the command line. .IP "\fB\-\-remote\-encoding=\fR\fIencoding\fR" 4 .IX Item "--remote-encoding=encoding" Force Wget to use \fIencoding\fR as the default remote server encoding. That affects how Wget converts URIs found in files from remote encoding to \s-1UTF\-8\s0 during a recursive fetch. This options is only useful for \&\s-1IRI\s0 support, for the interpretation of non-ASCII characters. .Sp For \s-1HTTP\s0, remote encoding can be found in \s-1HTTP\s0 \f(CW\*(C`Content\-Type\*(C'\fR header and in \s-1HTML\s0 \f(CW\*(C`Content\-Type http\-equiv\*(C'\fR meta tag. .Sp You can set the default encoding using the \f(CW\*(C`remoteencoding\*(C'\fR command in \fI.wgetrc\fR. That setting may be overridden from the command line. .IP "\fB\-\-unlink\fR" 4 .IX Item "--unlink" Force Wget to unlink file instead of clobbering existing file. This option is useful for downloading to the directory with hardlinks. .SS "Directory Options" .IX Subsection "Directory Options" .IP "\fB\-nd\fR" 4 .IX Item "-nd" .PD 0 .IP "\fB\-\-no\-directories\fR" 4 .IX Item "--no-directories" .PD Do not create a hierarchy of directories when retrieving recursively. With this option turned on, all files will get saved to the current directory, without clobbering (if a name shows up more than once, the filenames will get extensions \fB.n\fR). .IP "\fB\-x\fR" 4 .IX Item "-x" .PD 0 .IP "\fB\-\-force\-directories\fR" 4 .IX Item "--force-directories" .PD The opposite of \fB\-nd\fR\-\-\-create a hierarchy of directories, even if one would not have been created otherwise. E.g. \fBwget \-x http://fly.srk.fer.hr/robots.txt\fR will save the downloaded file to \&\fIfly.srk.fer.hr/robots.txt\fR. .IP "\fB\-nH\fR" 4 .IX Item "-nH" .PD 0 .IP "\fB\-\-no\-host\-directories\fR" 4 .IX Item "--no-host-directories" .PD Disable generation of host-prefixed directories. By default, invoking Wget with \fB\-r http://fly.srk.fer.hr/\fR will create a structure of directories beginning with \fIfly.srk.fer.hr/\fR. This option disables such behavior. .IP "\fB\-\-protocol\-directories\fR" 4 .IX Item "--protocol-directories" Use the protocol name as a directory component of local file names. For example, with this option, \fBwget \-r http://\fR\fIhost\fR will save to \&\fBhttp/\fR\fIhost\fR\fB/...\fR rather than just to \fIhost\fR\fB/...\fR. .IP "\fB\-\-cut\-dirs=\fR\fInumber\fR" 4 .IX Item "--cut-dirs=number" Ignore \fInumber\fR directory components. This is useful for getting a fine-grained control over the directory where recursive retrieval will be saved. .Sp Take, for example, the directory at \&\fBftp://ftp.xemacs.org/pub/xemacs/\fR. If you retrieve it with \&\fB\-r\fR, it will be saved locally under \&\fIftp.xemacs.org/pub/xemacs/\fR. While the \fB\-nH\fR option can remove the \fIftp.xemacs.org/\fR part, you are still stuck with \&\fIpub/xemacs\fR. This is where \fB\-\-cut\-dirs\fR comes in handy; it makes Wget not \*(L"see\*(R" \fInumber\fR remote directory components. Here are several examples of how \fB\-\-cut\-dirs\fR option works. .Sp .Vb 4 \& No options \-> ftp.xemacs.org/pub/xemacs/ \& \-nH \-> pub/xemacs/ \& \-nH \-\-cut\-dirs=1 \-> xemacs/ \& \-nH \-\-cut\-dirs=2 \-> . \& \& \-\-cut\-dirs=1 \-> ftp.xemacs.org/xemacs/ \& ... .Ve .Sp If you just want to get rid of the directory structure, this option is similar to a combination of \fB\-nd\fR and \fB\-P\fR. However, unlike \&\fB\-nd\fR, \fB\-\-cut\-dirs\fR does not lose with subdirectories\-\-\-for instance, with \fB\-nH \-\-cut\-dirs=1\fR, a \fIbeta/\fR subdirectory will be placed to \fIxemacs/beta\fR, as one would expect. .IP "\fB\-P\fR \fIprefix\fR" 4 .IX Item "-P prefix" .PD 0 .IP "\fB\-\-directory\-prefix=\fR\fIprefix\fR" 4 .IX Item "--directory-prefix=prefix" .PD Set directory prefix to \fIprefix\fR. The \fIdirectory prefix\fR is the directory where all other files and subdirectories will be saved to, i.e. the top of the retrieval tree. The default is \fB.\fR (the current directory). .SS "\s-1HTTP\s0 Options" .IX Subsection "HTTP Options" .IP "\fB\-\-default\-page=\fR\fIname\fR" 4 .IX Item "--default-page=name" Use \fIname\fR as the default file name when it isn't known (i.e., for URLs that end in a slash), instead of \fIindex.html\fR. .IP "\fB\-E\fR" 4 .IX Item "-E" .PD 0 .IP "\fB\-\-adjust\-extension\fR" 4 .IX Item "--adjust-extension" .PD If a file of type \fBapplication/xhtml+xml\fR or \fBtext/html\fR is downloaded and the \s-1URL\s0 does not end with the regexp \&\fB\e.[Hh][Tt][Mm][Ll]?\fR, this option will cause the suffix \fB.html\fR to be appended to the local filename. This is useful, for instance, when you're mirroring a remote site that uses \fB.asp\fR pages, but you want the mirrored pages to be viewable on your stock Apache server. Another good use for this is when you're downloading CGI-generated materials. A \s-1URL\s0 like \fBhttp://site.com/article.cgi?25\fR will be saved as \&\fIarticle.cgi?25.html\fR. .Sp Note that filenames changed in this way will be re-downloaded every time you re-mirror a site, because Wget can't tell that the local \&\fI\fIX\fI.html\fR file corresponds to remote \s-1URL\s0 \fIX\fR (since it doesn't yet know that the \s-1URL\s0 produces output of type \&\fBtext/html\fR or \fBapplication/xhtml+xml\fR. .Sp As of version 1.12, Wget will also ensure that any downloaded files of type \fBtext/css\fR end in the suffix \fB.css\fR, and the option was renamed from \fB\-\-html\-extension\fR, to better reflect its new behavior. The old option name is still acceptable, but should now be considered deprecated. .Sp At some point in the future, this option may well be expanded to include suffixes for other types of content, including content types that are not parsed by Wget. .IP "\fB\-\-http\-user=\fR\fIuser\fR" 4 .IX Item "--http-user=user" .PD 0 .IP "\fB\-\-http\-password=\fR\fIpassword\fR" 4 .IX Item "--http-password=password" .PD Specify the username \fIuser\fR and password \fIpassword\fR on an \&\s-1HTTP\s0 server. According to the type of the challenge, Wget will encode them using either the \f(CW\*(C`basic\*(C'\fR (insecure), the \f(CW\*(C`digest\*(C'\fR, or the Windows \f(CW\*(C`NTLM\*(C'\fR authentication scheme. .Sp Another way to specify username and password is in the \s-1URL\s0 itself. Either method reveals your password to anyone who bothers to run \f(CW\*(C`ps\*(C'\fR. To prevent the passwords from being seen, store them in \fI.wgetrc\fR or \fI.netrc\fR, and make sure to protect those files from other users with \f(CW\*(C`chmod\*(C'\fR. If the passwords are really important, do not leave them lying in those files either\-\-\-edit the files and delete them after Wget has started the download. .IP "\fB\-\-no\-http\-keep\-alive\fR" 4 .IX Item "--no-http-keep-alive" Turn off the \*(L"keep-alive\*(R" feature for \s-1HTTP\s0 downloads. Normally, Wget asks the server to keep the connection open so that, when you download more than one document from the same server, they get transferred over the same \s-1TCP\s0 connection. This saves time and at the same time reduces the load on the server. .Sp This option is useful when, for some reason, persistent (keep-alive) connections don't work for you, for example due to a server bug or due to the inability of server-side scripts to cope with the connections. .IP "\fB\-\-no\-cache\fR" 4 .IX Item "--no-cache" Disable server-side cache. In this case, Wget will send the remote server an appropriate directive (\fBPragma: no-cache\fR) to get the file from the remote service, rather than returning the cached version. This is especially useful for retrieving and flushing out-of-date documents on proxy servers. .Sp Caching is allowed by default. .IP "\fB\-\-no\-cookies\fR" 4 .IX Item "--no-cookies" Disable the use of cookies. Cookies are a mechanism for maintaining server-side state. The server sends the client a cookie using the \&\f(CW\*(C`Set\-Cookie\*(C'\fR header, and the client responds with the same cookie upon further requests. Since cookies allow the server owners to keep track of visitors and for sites to exchange this information, some consider them a breach of privacy. The default is to use cookies; however, \fIstoring\fR cookies is not on by default. .IP "\fB\-\-load\-cookies\fR \fIfile\fR" 4 .IX Item "--load-cookies file" Load cookies from \fIfile\fR before the first \s-1HTTP\s0 retrieval. \&\fIfile\fR is a textual file in the format originally used by Netscape's \&\fIcookies.txt\fR file. .Sp You will typically use this option when mirroring sites that require that you be logged in to access some or all of their content. The login process typically works by the web server issuing an \s-1HTTP\s0 cookie upon receiving and verifying your credentials. The cookie is then resent by the browser when accessing that part of the site, and so proves your identity. .Sp Mirroring such a site requires Wget to send the same cookies your browser sends when communicating with the site. This is achieved by \&\fB\-\-load\-cookies\fR\-\-\-simply point Wget to the location of the \&\fIcookies.txt\fR file, and it will send the same cookies your browser would send in the same situation. Different browsers keep textual cookie files in different locations: .RS 4 .IP "Netscape 4.x." 4 .IX Item "Netscape 4.x." The cookies are in \fI~/.netscape/cookies.txt\fR. .IP "Mozilla and Netscape 6.x." 4 .IX Item "Mozilla and Netscape 6.x." Mozilla's cookie file is also named \fIcookies.txt\fR, located somewhere under \fI~/.mozilla\fR, in the directory of your profile. The full path usually ends up looking somewhat like \&\fI~/.mozilla/default/\fIsome-weird-string\fI/cookies.txt\fR. .IP "Internet Explorer." 4 .IX Item "Internet Explorer." You can produce a cookie file Wget can use by using the File menu, Import and Export, Export Cookies. This has been tested with Internet Explorer 5; it is not guaranteed to work with earlier versions. .IP "Other browsers." 4 .IX Item "Other browsers." If you are using a different browser to create your cookies, \&\fB\-\-load\-cookies\fR will only work if you can locate or produce a cookie file in the Netscape format that Wget expects. .RE .RS 4 .Sp If you cannot use \fB\-\-load\-cookies\fR, there might still be an alternative. If your browser supports a \*(L"cookie manager\*(R", you can use it to view the cookies used when accessing the site you're mirroring. Write down the name and value of the cookie, and manually instruct Wget to send those cookies, bypassing the \*(L"official\*(R" cookie support: .Sp .Vb 1 \& wget \-\-no\-cookies \-\-header "Cookie: =" .Ve .RE .IP "\fB\-\-save\-cookies\fR \fIfile\fR" 4 .IX Item "--save-cookies file" Save cookies to \fIfile\fR before exiting. This will not save cookies that have expired or that have no expiry time (so-called \*(L"session cookies\*(R"), but also see \fB\-\-keep\-session\-cookies\fR. .IP "\fB\-\-keep\-session\-cookies\fR" 4 .IX Item "--keep-session-cookies" When specified, causes \fB\-\-save\-cookies\fR to also save session cookies. Session cookies are normally not saved because they are meant to be kept in memory and forgotten when you exit the browser. Saving them is useful on sites that require you to log in or to visit the home page before you can access some pages. With this option, multiple Wget runs are considered a single browser session as far as the site is concerned. .Sp Since the cookie file format does not normally carry session cookies, Wget marks them with an expiry timestamp of 0. Wget's \&\fB\-\-load\-cookies\fR recognizes those as session cookies, but it might confuse other browsers. Also note that cookies so loaded will be treated as other session cookies, which means that if you want \&\fB\-\-save\-cookies\fR to preserve them again, you must use \&\fB\-\-keep\-session\-cookies\fR again. .IP "\fB\-\-ignore\-length\fR" 4 .IX Item "--ignore-length" Unfortunately, some \s-1HTTP\s0 servers (\s-1CGI\s0 programs, to be more precise) send out bogus \f(CW\*(C`Content\-Length\*(C'\fR headers, which makes Wget go wild, as it thinks not all the document was retrieved. You can spot this syndrome if Wget retries getting the same document again and again, each time claiming that the (otherwise normal) connection has closed on the very same byte. .Sp With this option, Wget will ignore the \f(CW\*(C`Content\-Length\*(C'\fR header\-\-\-as if it never existed. .IP "\fB\-\-header=\fR\fIheader-line\fR" 4 .IX Item "--header=header-line" Send \fIheader-line\fR along with the rest of the headers in each \&\s-1HTTP\s0 request. The supplied header is sent as-is, which means it must contain name and value separated by colon, and must not contain newlines. .Sp You may define more than one additional header by specifying \&\fB\-\-header\fR more than once. .Sp .Vb 3 \& wget \-\-header=\*(AqAccept\-Charset: iso\-8859\-2\*(Aq \e \& \-\-header=\*(AqAccept\-Language: hr\*(Aq \e \& http://fly.srk.fer.hr/ .Ve .Sp Specification of an empty string as the header value will clear all previous user-defined headers. .Sp As of Wget 1.10, this option can be used to override headers otherwise generated automatically. This example instructs Wget to connect to localhost, but to specify \fBfoo.bar\fR in the \f(CW\*(C`Host\*(C'\fR header: .Sp .Vb 1 \& wget \-\-header="Host: foo.bar" http://localhost/ .Ve .Sp In versions of Wget prior to 1.10 such use of \fB\-\-header\fR caused sending of duplicate headers. .IP "\fB\-\-max\-redirect=\fR\fInumber\fR" 4 .IX Item "--max-redirect=number" Specifies the maximum number of redirections to follow for a resource. The default is 20, which is usually far more than necessary. However, on those occasions where you want to allow more (or fewer), this is the option to use. .IP "\fB\-\-proxy\-user=\fR\fIuser\fR" 4 .IX Item "--proxy-user=user" .PD 0 .IP "\fB\-\-proxy\-password=\fR\fIpassword\fR" 4 .IX Item "--proxy-password=password" .PD Specify the username \fIuser\fR and password \fIpassword\fR for authentication on a proxy server. Wget will encode them using the \&\f(CW\*(C`basic\*(C'\fR authentication scheme. .Sp Security considerations similar to those with \fB\-\-http\-password\fR pertain here as well. .IP "\fB\-\-referer=\fR\fIurl\fR" 4 .IX Item "--referer=url" Include `Referer: \fIurl\fR' header in \s-1HTTP\s0 request. Useful for retrieving documents with server-side processing that assume they are always being retrieved by interactive web browsers and only come out properly when Referer is set to one of the pages that point to them. .IP "\fB\-\-save\-headers\fR" 4 .IX Item "--save-headers" Save the headers sent by the \s-1HTTP\s0 server to the file, preceding the actual contents, with an empty line as the separator. .IP "\fB\-U\fR \fIagent-string\fR" 4 .IX Item "-U agent-string" .PD 0 .IP "\fB\-\-user\-agent=\fR\fIagent-string\fR" 4 .IX Item "--user-agent=agent-string" .PD Identify as \fIagent-string\fR to the \s-1HTTP\s0 server. .Sp The \s-1HTTP\s0 protocol allows the clients to identify themselves using a \&\f(CW\*(C`User\-Agent\*(C'\fR header field. This enables distinguishing the \&\s-1WWW\s0 software, usually for statistical purposes or for tracing of protocol violations. Wget normally identifies as \&\fBWget/\fR\fIversion\fR, \fIversion\fR being the current version number of Wget. .Sp However, some sites have been known to impose the policy of tailoring the output according to the \f(CW\*(C`User\-Agent\*(C'\fR\-supplied information. While this is not such a bad idea in theory, it has been abused by servers denying information to clients other than (historically) Netscape or, more frequently, Microsoft Internet Explorer. This option allows you to change the \f(CW\*(C`User\-Agent\*(C'\fR line issued by Wget. Use of this option is discouraged, unless you really know what you are doing. .Sp Specifying empty user agent with \fB\-\-user\-agent=""\fR instructs Wget not to send the \f(CW\*(C`User\-Agent\*(C'\fR header in \s-1HTTP\s0 requests. .IP "\fB\-\-post\-data=\fR\fIstring\fR" 4 .IX Item "--post-data=string" .PD 0 .IP "\fB\-\-post\-file=\fR\fIfile\fR" 4 .IX Item "--post-file=file" .PD Use \s-1POST\s0 as the method for all \s-1HTTP\s0 requests and send the specified data in the request body. \fB\-\-post\-data\fR sends \fIstring\fR as data, whereas \fB\-\-post\-file\fR sends the contents of \fIfile\fR. Other than that, they work in exactly the same way. In particular, they \fIboth\fR expect content of the form \f(CW\*(C`key1=value1&key2=value2\*(C'\fR, with percent-encoding for special characters; the only difference is that one expects its content as a command-line parameter and the other accepts its content from a file. In particular, \fB\-\-post\-file\fR is \&\fInot\fR for transmitting files as form attachments: those must appear as \f(CW\*(C`key=value\*(C'\fR data (with appropriate percent-coding) just like everything else. Wget does not currently support \&\f(CW\*(C`multipart/form\-data\*(C'\fR for transmitting \s-1POST\s0 data; only \&\f(CW\*(C`application/x\-www\-form\-urlencoded\*(C'\fR. Only one of \&\fB\-\-post\-data\fR and \fB\-\-post\-file\fR should be specified. .Sp Please be aware that Wget needs to know the size of the \s-1POST\s0 data in advance. Therefore the argument to \f(CW\*(C`\-\-post\-file\*(C'\fR must be a regular file; specifying a \s-1FIFO\s0 or something like \fI/dev/stdin\fR won't work. It's not quite clear how to work around this limitation inherent in \&\s-1HTTP/1\s0.0. Although \s-1HTTP/1\s0.1 introduces \fIchunked\fR transfer that doesn't require knowing the request length in advance, a client can't use chunked unless it knows it's talking to an \s-1HTTP/1\s0.1 server. And it can't know that until it receives a response, which in turn requires the request to have been completed \*(-- a chicken-and-egg problem. .Sp Note: if Wget is redirected after the \s-1POST\s0 request is completed, it will not send the \s-1POST\s0 data to the redirected \s-1URL\s0. This is because URLs that process \s-1POST\s0 often respond with a redirection to a regular page, which does not desire or accept \s-1POST\s0. It is not completely clear that this behavior is optimal; if it doesn't work out, it might be changed in the future. .Sp This example shows how to log to a server using \s-1POST\s0 and then proceed to download the desired pages, presumably only accessible to authorized users: .Sp .Vb 4 \& # Log in to the server. This can be done only once. \& wget \-\-save\-cookies cookies.txt \e \& \-\-post\-data \*(Aquser=foo&password=bar\*(Aq \e \& http://server.com/auth.php \& \& # Now grab the page or pages we care about. \& wget \-\-load\-cookies cookies.txt \e \& \-p http://server.com/interesting/article.php .Ve .Sp If the server is using session cookies to track user authentication, the above will not work because \fB\-\-save\-cookies\fR will not save them (and neither will browsers) and the \fIcookies.txt\fR file will be empty. In that case use \fB\-\-keep\-session\-cookies\fR along with \&\fB\-\-save\-cookies\fR to force saving of session cookies. .IP "\fB\-\-content\-disposition\fR" 4 .IX Item "--content-disposition" If this is set to on, experimental (not fully-functional) support for \&\f(CW\*(C`Content\-Disposition\*(C'\fR headers is enabled. This can currently result in extra round-trips to the server for a \f(CW\*(C`HEAD\*(C'\fR request, and is known to suffer from a few bugs, which is why it is not currently enabled by default. .Sp This option is useful for some file-downloading \s-1CGI\s0 programs that use \&\f(CW\*(C`Content\-Disposition\*(C'\fR headers to describe what the name of a downloaded file should be. .IP "\fB\-\-trust\-server\-names\fR" 4 .IX Item "--trust-server-names" If this is set to on, on a redirect the last component of the redirection \s-1URL\s0 will be used as the local file name. By default it is used the last component in the original \s-1URL\s0. .IP "\fB\-\-auth\-no\-challenge\fR" 4 .IX Item "--auth-no-challenge" If this option is given, Wget will send Basic \s-1HTTP\s0 authentication information (plaintext username and password) for all requests, just like Wget 1.10.2 and prior did by default. .Sp Use of this option is not recommended, and is intended only to support some few obscure servers, which never send \s-1HTTP\s0 authentication challenges, but accept unsolicited auth info, say, in addition to form-based authentication. .SS "\s-1HTTPS\s0 (\s-1SSL/TLS\s0) Options" .IX Subsection "HTTPS (SSL/TLS) Options" To support encrypted \s-1HTTP\s0 (\s-1HTTPS\s0) downloads, Wget must be compiled with an external \s-1SSL\s0 library, currently OpenSSL. If Wget is compiled without \s-1SSL\s0 support, none of these options are available. .IP "\fB\-\-secure\-protocol=\fR\fIprotocol\fR" 4 .IX Item "--secure-protocol=protocol" Choose the secure protocol to be used. Legal values are \fBauto\fR, \&\fBSSLv2\fR, \fBSSLv3\fR, and \fBTLSv1\fR. If \fBauto\fR is used, the \s-1SSL\s0 library is given the liberty of choosing the appropriate protocol automatically, which is achieved by sending an SSLv2 greeting and announcing support for SSLv3 and TLSv1. This is the default. .Sp Specifying \fBSSLv2\fR, \fBSSLv3\fR, or \fBTLSv1\fR forces the use of the corresponding protocol. This is useful when talking to old and buggy \s-1SSL\s0 server implementations that make it hard for OpenSSL to choose the correct protocol version. Fortunately, such servers are quite rare. .IP "\fB\-\-no\-check\-certificate\fR" 4 .IX Item "--no-check-certificate" Don't check the server certificate against the available certificate authorities. Also don't require the \s-1URL\s0 host name to match the common name presented by the certificate. .Sp As of Wget 1.10, the default is to verify the server's certificate against the recognized certificate authorities, breaking the \s-1SSL\s0 handshake and aborting the download if the verification fails. Although this provides more secure downloads, it does break interoperability with some sites that worked with previous Wget versions, particularly those using self-signed, expired, or otherwise invalid certificates. This option forces an \*(L"insecure\*(R" mode of operation that turns the certificate verification errors into warnings and allows you to proceed. .Sp If you encounter \*(L"certificate verification\*(R" errors or ones saying that \*(L"common name doesn't match requested host name\*(R", you can use this option to bypass the verification and proceed with the download. \&\fIOnly use this option if you are otherwise convinced of the site's authenticity, or if you really don't care about the validity of its certificate.\fR It is almost always a bad idea not to check the certificates when transmitting confidential or important data. .IP "\fB\-\-certificate=\fR\fIfile\fR" 4 .IX Item "--certificate=file" Use the client certificate stored in \fIfile\fR. This is needed for servers that are configured to require certificates from the clients that connect to them. Normally a certificate is not required and this switch is optional. .IP "\fB\-\-certificate\-type=\fR\fItype\fR" 4 .IX Item "--certificate-type=type" Specify the type of the client certificate. Legal values are \&\fB\s-1PEM\s0\fR (assumed by default) and \fB\s-1DER\s0\fR, also known as \&\fB\s-1ASN1\s0\fR. .IP "\fB\-\-private\-key=\fR\fIfile\fR" 4 .IX Item "--private-key=file" Read the private key from \fIfile\fR. This allows you to provide the private key in a file separate from the certificate. .IP "\fB\-\-private\-key\-type=\fR\fItype\fR" 4 .IX Item "--private-key-type=type" Specify the type of the private key. Accepted values are \fB\s-1PEM\s0\fR (the default) and \fB\s-1DER\s0\fR. .IP "\fB\-\-ca\-certificate=\fR\fIfile\fR" 4 .IX Item "--ca-certificate=file" Use \fIfile\fR as the file with the bundle of certificate authorities (\*(L"\s-1CA\s0\*(R") to verify the peers. The certificates must be in \s-1PEM\s0 format. .Sp Without this option Wget looks for \s-1CA\s0 certificates at the system-specified locations, chosen at OpenSSL installation time. .IP "\fB\-\-ca\-directory=\fR\fIdirectory\fR" 4 .IX Item "--ca-directory=directory" Specifies directory containing \s-1CA\s0 certificates in \s-1PEM\s0 format. Each file contains one \s-1CA\s0 certificate, and the file name is based on a hash value derived from the certificate. This is achieved by processing a certificate directory with the \f(CW\*(C`c_rehash\*(C'\fR utility supplied with OpenSSL. Using \fB\-\-ca\-directory\fR is more efficient than \&\fB\-\-ca\-certificate\fR when many certificates are installed because it allows Wget to fetch certificates on demand. .Sp Without this option Wget looks for \s-1CA\s0 certificates at the system-specified locations, chosen at OpenSSL installation time. .IP "\fB\-\-random\-file=\fR\fIfile\fR" 4 .IX Item "--random-file=file" Use \fIfile\fR as the source of random data for seeding the pseudo-random number generator on systems without \fI/dev/random\fR. .Sp On such systems the \s-1SSL\s0 library needs an external source of randomness to initialize. Randomness may be provided by \s-1EGD\s0 (see \&\fB\-\-egd\-file\fR below) or read from an external source specified by the user. If this option is not specified, Wget looks for random data in \f(CW$RANDFILE\fR or, if that is unset, in \fI\f(CI$HOME\fI/.rnd\fR. If none of those are available, it is likely that \s-1SSL\s0 encryption will not be usable. .Sp If you're getting the \*(L"Could not seed OpenSSL \s-1PRNG\s0; disabling \s-1SSL\s0.\*(R" error, you should provide random data using some of the methods described above. .IP "\fB\-\-egd\-file=\fR\fIfile\fR" 4 .IX Item "--egd-file=file" Use \fIfile\fR as the \s-1EGD\s0 socket. \s-1EGD\s0 stands for \fIEntropy Gathering Daemon\fR, a user-space program that collects data from various unpredictable system sources and makes it available to other programs that might need it. Encryption software, such as the \s-1SSL\s0 library, needs sources of non-repeating randomness to seed the random number generator used to produce cryptographically strong keys. .Sp OpenSSL allows the user to specify his own source of entropy using the \&\f(CW\*(C`RAND_FILE\*(C'\fR environment variable. If this variable is unset, or if the specified file does not produce enough randomness, OpenSSL will read random data from \s-1EGD\s0 socket specified using this option. .Sp If this option is not specified (and the equivalent startup command is not used), \s-1EGD\s0 is never contacted. \s-1EGD\s0 is not needed on modern Unix systems that support \fI/dev/random\fR. .SS "\s-1FTP\s0 Options" .IX Subsection "FTP Options" .IP "\fB\-\-ftp\-user=\fR\fIuser\fR" 4 .IX Item "--ftp-user=user" .PD 0 .IP "\fB\-\-ftp\-password=\fR\fIpassword\fR" 4 .IX Item "--ftp-password=password" .PD Specify the username \fIuser\fR and password \fIpassword\fR on an \&\s-1FTP\s0 server. Without this, or the corresponding startup option, the password defaults to \fB\-wget@\fR, normally used for anonymous \&\s-1FTP\s0. .Sp Another way to specify username and password is in the \s-1URL\s0 itself. Either method reveals your password to anyone who bothers to run \f(CW\*(C`ps\*(C'\fR. To prevent the passwords from being seen, store them in \fI.wgetrc\fR or \fI.netrc\fR, and make sure to protect those files from other users with \f(CW\*(C`chmod\*(C'\fR. If the passwords are really important, do not leave them lying in those files either\-\-\-edit the files and delete them after Wget has started the download. .IP "\fB\-\-no\-remove\-listing\fR" 4 .IX Item "--no-remove-listing" Don't remove the temporary \fI.listing\fR files generated by \s-1FTP\s0 retrievals. Normally, these files contain the raw directory listings received from \s-1FTP\s0 servers. Not removing them can be useful for debugging purposes, or when you want to be able to easily check on the contents of remote server directories (e.g. to verify that a mirror you're running is complete). .Sp Note that even though Wget writes to a known filename for this file, this is not a security hole in the scenario of a user making \&\fI.listing\fR a symbolic link to \fI/etc/passwd\fR or something and asking \f(CW\*(C`root\*(C'\fR to run Wget in his or her directory. Depending on the options used, either Wget will refuse to write to \fI.listing\fR, making the globbing/recursion/time\-stamping operation fail, or the symbolic link will be deleted and replaced with the actual \&\fI.listing\fR file, or the listing will be written to a \&\fI.listing.\fInumber\fI\fR file. .Sp Even though this situation isn't a problem, though, \f(CW\*(C`root\*(C'\fR should never run Wget in a non-trusted user's directory. A user could do something as simple as linking \fIindex.html\fR to \fI/etc/passwd\fR and asking \f(CW\*(C`root\*(C'\fR to run Wget with \fB\-N\fR or \fB\-r\fR so the file will be overwritten. .IP "\fB\-\-no\-glob\fR" 4 .IX Item "--no-glob" Turn off \s-1FTP\s0 globbing. Globbing refers to the use of shell-like special characters (\fIwildcards\fR), like \fB*\fR, \fB?\fR, \fB[\fR and \fB]\fR to retrieve more than one file from the same directory at once, like: .Sp .Vb 1 \& wget ftp://gnjilux.srk.fer.hr/*.msg .Ve .Sp By default, globbing will be turned on if the \s-1URL\s0 contains a globbing character. This option may be used to turn globbing on or off permanently. .Sp You may have to quote the \s-1URL\s0 to protect it from being expanded by your shell. Globbing makes Wget look for a directory listing, which is system-specific. This is why it currently works only with Unix \s-1FTP\s0 servers (and the ones emulating Unix \f(CW\*(C`ls\*(C'\fR output). .IP "\fB\-\-no\-passive\-ftp\fR" 4 .IX Item "--no-passive-ftp" Disable the use of the \fIpassive\fR \s-1FTP\s0 transfer mode. Passive \s-1FTP\s0 mandates that the client connect to the server to establish the data connection rather than the other way around. .Sp If the machine is connected to the Internet directly, both passive and active \s-1FTP\s0 should work equally well. Behind most firewall and \s-1NAT\s0 configurations passive \s-1FTP\s0 has a better chance of working. However, in some rare firewall configurations, active \s-1FTP\s0 actually works when passive \s-1FTP\s0 doesn't. If you suspect this to be the case, use this option, or set \f(CW\*(C`passive_ftp=off\*(C'\fR in your init file. .IP "\fB\-\-retr\-symlinks\fR" 4 .IX Item "--retr-symlinks" Usually, when retrieving \s-1FTP\s0 directories recursively and a symbolic link is encountered, the linked-to file is not downloaded. Instead, a matching symbolic link is created on the local filesystem. The pointed-to file will not be downloaded unless this recursive retrieval would have encountered it separately and downloaded it anyway. .Sp When \fB\-\-retr\-symlinks\fR is specified, however, symbolic links are traversed and the pointed-to files are retrieved. At this time, this option does not cause Wget to traverse symlinks to directories and recurse through them, but in the future it should be enhanced to do this. .Sp Note that when retrieving a file (not a directory) because it was specified on the command-line, rather than because it was recursed to, this option has no effect. Symbolic links are always traversed in this case. .SS "Recursive Retrieval Options" .IX Subsection "Recursive Retrieval Options" .IP "\fB\-r\fR" 4 .IX Item "-r" .PD 0 .IP "\fB\-\-recursive\fR" 4 .IX Item "--recursive" .PD Turn on recursive retrieving. The default maximum depth is 5. .IP "\fB\-l\fR \fIdepth\fR" 4 .IX Item "-l depth" .PD 0 .IP "\fB\-\-level=\fR\fIdepth\fR" 4 .IX Item "--level=depth" .PD Specify recursion maximum depth level \fIdepth\fR. .IP "\fB\-\-delete\-after\fR" 4 .IX Item "--delete-after" This option tells Wget to delete every single file it downloads, \&\fIafter\fR having done so. It is useful for pre-fetching popular pages through a proxy, e.g.: .Sp .Vb 1 \& wget \-r \-nd \-\-delete\-after http://whatever.com/~popular/page/ .Ve .Sp The \fB\-r\fR option is to retrieve recursively, and \fB\-nd\fR to not create directories. .Sp Note that \fB\-\-delete\-after\fR deletes files on the local machine. It does not issue the \fB\s-1DELE\s0\fR command to remote \s-1FTP\s0 sites, for instance. Also note that when \fB\-\-delete\-after\fR is specified, \&\fB\-\-convert\-links\fR is ignored, so \fB.orig\fR files are simply not created in the first place. .IP "\fB\-k\fR" 4 .IX Item "-k" .PD 0 .IP "\fB\-\-convert\-links\fR" 4 .IX Item "--convert-links" .PD After the download is complete, convert the links in the document to make them suitable for local viewing. This affects not only the visible hyperlinks, but any part of the document that links to external content, such as embedded images, links to style sheets, hyperlinks to non-HTML content, etc. .Sp Each link will be changed in one of the two ways: .RS 4 .IP "\(bu" 4 The links to files that have been downloaded by Wget will be changed to refer to the file they point to as a relative link. .Sp Example: if the downloaded file \fI/foo/doc.html\fR links to \&\fI/bar/img.gif\fR, also downloaded, then the link in \fIdoc.html\fR will be modified to point to \fB../bar/img.gif\fR. This kind of transformation works reliably for arbitrary combinations of directories. .IP "\(bu" 4 The links to files that have not been downloaded by Wget will be changed to include host name and absolute path of the location they point to. .Sp Example: if the downloaded file \fI/foo/doc.html\fR links to \&\fI/bar/img.gif\fR (or to \fI../bar/img.gif\fR), then the link in \&\fIdoc.html\fR will be modified to point to \&\fIhttp://\fIhostname\fI/bar/img.gif\fR. .RE .RS 4 .Sp Because of this, local browsing works reliably: if a linked file was downloaded, the link will refer to its local name; if it was not downloaded, the link will refer to its full Internet address rather than presenting a broken link. The fact that the former links are converted to relative links ensures that you can move the downloaded hierarchy to another directory. .Sp Note that only at the end of the download can Wget know which links have been downloaded. Because of that, the work done by \fB\-k\fR will be performed at the end of all the downloads. .RE .IP "\fB\-K\fR" 4 .IX Item "-K" .PD 0 .IP "\fB\-\-backup\-converted\fR" 4 .IX Item "--backup-converted" .PD When converting a file, back up the original version with a \fB.orig\fR suffix. Affects the behavior of \fB\-N\fR. .IP "\fB\-m\fR" 4 .IX Item "-m" .PD 0 .IP "\fB\-\-mirror\fR" 4 .IX Item "--mirror" .PD Turn on options suitable for mirroring. This option turns on recursion and time-stamping, sets infinite recursion depth and keeps \s-1FTP\s0 directory listings. It is currently equivalent to \&\fB\-r \-N \-l inf \-\-no\-remove\-listing\fR. .IP "\fB\-p\fR" 4 .IX Item "-p" .PD 0 .IP "\fB\-\-page\-requisites\fR" 4 .IX Item "--page-requisites" .PD This option causes Wget to download all the files that are necessary to properly display a given \s-1HTML\s0 page. This includes such things as inlined images, sounds, and referenced stylesheets. .Sp Ordinarily, when downloading a single \s-1HTML\s0 page, any requisite documents that may be needed to display it properly are not downloaded. Using \&\fB\-r\fR together with \fB\-l\fR can help, but since Wget does not ordinarily distinguish between external and inlined documents, one is generally left with \*(L"leaf documents\*(R" that are missing their requisites. .Sp For instance, say document \fI1.html\fR contains an \f(CW\*(C`\*(C'\fR tag referencing \fI1.gif\fR and an \f(CW\*(C`\*(C'\fR tag pointing to external document \fI2.html\fR. Say that \fI2.html\fR is similar but that its image is \fI2.gif\fR and it links to \fI3.html\fR. Say this continues up to some arbitrarily high number. .Sp If one executes the command: .Sp .Vb 1 \& wget \-r \-l 2 http:///1.html .Ve .Sp then \fI1.html\fR, \fI1.gif\fR, \fI2.html\fR, \fI2.gif\fR, and \&\fI3.html\fR will be downloaded. As you can see, \fI3.html\fR is without its requisite \fI3.gif\fR because Wget is simply counting the number of hops (up to 2) away from \fI1.html\fR in order to determine where to stop the recursion. However, with this command: .Sp .Vb 1 \& wget \-r \-l 2 \-p http:///1.html .Ve .Sp all the above files \fIand\fR \fI3.html\fR's requisite \fI3.gif\fR will be downloaded. Similarly, .Sp .Vb 1 \& wget \-r \-l 1 \-p http:///1.html .Ve .Sp will cause \fI1.html\fR, \fI1.gif\fR, \fI2.html\fR, and \fI2.gif\fR to be downloaded. One might think that: .Sp .Vb 1 \& wget \-r \-l 0 \-p http:///1.html .Ve .Sp would download just \fI1.html\fR and \fI1.gif\fR, but unfortunately this is not the case, because \fB\-l 0\fR is equivalent to \&\fB\-l inf\fR\-\-\-that is, infinite recursion. To download a single \s-1HTML\s0 page (or a handful of them, all specified on the command-line or in a \&\fB\-i\fR \s-1URL\s0 input file) and its (or their) requisites, simply leave off \&\fB\-r\fR and \fB\-l\fR: .Sp .Vb 1 \& wget \-p http:///1.html .Ve .Sp Note that Wget will behave as if \fB\-r\fR had been specified, but only that single page and its requisites will be downloaded. Links from that page to external documents will not be followed. Actually, to download a single page and all its requisites (even if they exist on separate websites), and make sure the lot displays properly locally, this author likes to use a few options in addition to \fB\-p\fR: .Sp .Vb 1 \& wget \-E \-H \-k \-K \-p http:/// .Ve .Sp To finish off this topic, it's worth knowing that Wget's idea of an external document link is any \s-1URL\s0 specified in an \f(CW\*(C`\*(C'\fR tag, an \&\f(CW\*(C`\*(C'\fR tag, or a \f(CW\*(C`\*(C'\fR tag other than \f(CW\*(C`\*(C'\fR. .IP "\fB\-\-strict\-comments\fR" 4 .IX Item "--strict-comments" Turn on strict parsing of \s-1HTML\s0 comments. The default is to terminate comments at the first occurrence of \fB\-\->\fR. .Sp According to specifications, \s-1HTML\s0 comments are expressed as \s-1SGML\s0 \&\fIdeclarations\fR. Declaration is special markup that begins with \&\fB\fR, such as \fB\fR, that may contain comments between a pair of \fB\-\-\fR delimiters. \s-1HTML\s0 comments are \*(L"empty declarations\*(R", \s-1SGML\s0 declarations without any non-comment text. Therefore, \fB\fR is a valid comment, and so is \fB\fR, but \fB\fR is not. .Sp On the other hand, most \s-1HTML\s0 writers don't perceive comments as anything other than text delimited with \fB\fR, which is not quite the same. For example, something like \fB\fR works as a valid comment as long as the number of dashes is a multiple of four (!). If not, the comment technically lasts until the next \&\fB\-\-\fR, which may be at the other end of the document. Because of this, many popular browsers completely ignore the specification and implement what users have come to expect: comments delimited with \&\fB\fR. .Sp Until version 1.9, Wget interpreted comments strictly, which resulted in missing links in many web pages that displayed fine in browsers, but had the misfortune of containing non-compliant comments. Beginning with version 1.9, Wget has joined the ranks of clients that implements \&\*(L"naive\*(R" comments, terminating each comment at the first occurrence of \&\fB\-\->\fR. .Sp If, for whatever reason, you want strict comment parsing, use this option to turn it on. .SS "Recursive Accept/Reject Options" .IX Subsection "Recursive Accept/Reject Options" .IP "\fB\-A\fR \fIacclist\fR \fB\-\-accept\fR \fIacclist\fR" 4 .IX Item "-A acclist --accept acclist" .PD 0 .IP "\fB\-R\fR \fIrejlist\fR \fB\-\-reject\fR \fIrejlist\fR" 4 .IX Item "-R rejlist --reject rejlist" .PD Specify comma-separated lists of file name suffixes or patterns to accept or reject. Note that if any of the wildcard characters, \fB*\fR, \fB?\fR, \fB[\fR or \&\fB]\fR, appear in an element of \fIacclist\fR or \fIrejlist\fR, it will be treated as a pattern, rather than a suffix. .IP "\fB\-D\fR \fIdomain-list\fR" 4 .IX Item "-D domain-list" .PD 0 .IP "\fB\-\-domains=\fR\fIdomain-list\fR" 4 .IX Item "--domains=domain-list" .PD Set domains to be followed. \fIdomain-list\fR is a comma-separated list of domains. Note that it does \fInot\fR turn on \fB\-H\fR. .IP "\fB\-\-exclude\-domains\fR \fIdomain-list\fR" 4 .IX Item "--exclude-domains domain-list" Specify the domains that are \fInot\fR to be followed. .IP "\fB\-\-follow\-ftp\fR" 4 .IX Item "--follow-ftp" Follow \s-1FTP\s0 links from \s-1HTML\s0 documents. Without this option, Wget will ignore all the \s-1FTP\s0 links. .IP "\fB\-\-follow\-tags=\fR\fIlist\fR" 4 .IX Item "--follow-tags=list" Wget has an internal table of \s-1HTML\s0 tag / attribute pairs that it considers when looking for linked documents during a recursive retrieval. If a user wants only a subset of those tags to be considered, however, he or she should be specify such tags in a comma-separated \fIlist\fR with this option. .IP "\fB\-\-ignore\-tags=\fR\fIlist\fR" 4 .IX Item "--ignore-tags=list" This is the opposite of the \fB\-\-follow\-tags\fR option. To skip certain \s-1HTML\s0 tags when recursively looking for documents to download, specify them in a comma-separated \fIlist\fR. .Sp In the past, this option was the best bet for downloading a single page and its requisites, using a command-line like: .Sp .Vb 1 \& wget \-\-ignore\-tags=a,area \-H \-k \-K \-r http:/// .Ve .Sp However, the author of this option came across a page with tags like \&\f(CW\*(C`\*(C'\fR and came to the realization that specifying tags to ignore was not enough. One can't just tell Wget to ignore \f(CW\*(C`\*(C'\fR, because then stylesheets will not be downloaded. Now the best bet for downloading a single page and its requisites is the dedicated \fB\-\-page\-requisites\fR option. .IP "\fB\-\-ignore\-case\fR" 4 .IX Item "--ignore-case" Ignore case when matching files and directories. This influences the behavior of \-R, \-A, \-I, and \-X options, as well as globbing implemented when downloading from \s-1FTP\s0 sites. For example, with this option, \fB\-A *.txt\fR will match \fBfile1.txt\fR, but also \&\fBfile2.TXT\fR, \fBfile3.TxT\fR, and so on. .IP "\fB\-H\fR" 4 .IX Item "-H" .PD 0 .IP "\fB\-\-span\-hosts\fR" 4 .IX Item "--span-hosts" .PD Enable spanning across hosts when doing recursive retrieving. .IP "\fB\-L\fR" 4 .IX Item "-L" .PD 0 .IP "\fB\-\-relative\fR" 4 .IX Item "--relative" .PD Follow relative links only. Useful for retrieving a specific home page without any distractions, not even those from the same hosts. .IP "\fB\-I\fR \fIlist\fR" 4 .IX Item "-I list" .PD 0 .IP "\fB\-\-include\-directories=\fR\fIlist\fR" 4 .IX Item "--include-directories=list" .PD Specify a comma-separated list of directories you wish to follow when downloading. Elements of \fIlist\fR may contain wildcards. .IP "\fB\-X\fR \fIlist\fR" 4 .IX Item "-X list" .PD 0 .IP "\fB\-\-exclude\-directories=\fR\fIlist\fR" 4 .IX Item "--exclude-directories=list" .PD Specify a comma-separated list of directories you wish to exclude from download. Elements of \&\fIlist\fR may contain wildcards. .IP "\fB\-np\fR" 4 .IX Item "-np" .PD 0 .IP "\fB\-\-no\-parent\fR" 4 .IX Item "--no-parent" .PD Do not ever ascend to the parent directory when retrieving recursively. This is a useful option, since it guarantees that only the files \&\fIbelow\fR a certain hierarchy will be downloaded. .SH "FILES" .IX Header "FILES" .IP "\fB/usr/local/etc/wgetrc\fR" 4 .IX Item "/usr/local/etc/wgetrc" Default location of the \fIglobal\fR startup file. .IP "\fB.wgetrc\fR" 4 .IX Item ".wgetrc" User startup file. .SH "BUGS" .IX Header "BUGS" You are welcome to submit bug reports via the \s-1GNU\s0 Wget bug tracker (see <\fBhttp://wget.addictivecode.org/BugTracker\fR>). .PP Before actually submitting a bug report, please try to follow a few simple guidelines. .IP "1." 4 Please try to ascertain that the behavior you see really is a bug. If Wget crashes, it's a bug. If Wget does not behave as documented, it's a bug. If things work strange, but you are not sure about the way they are supposed to work, it might well be a bug, but you might want to double-check the documentation and the mailing lists. .IP "2." 4 Try to repeat the bug in as simple circumstances as possible. E.g. if Wget crashes while downloading \fBwget \-rl0 \-kKE \-t5 \-\-no\-proxy http://yoyodyne.com \-o /tmp/log\fR, you should try to see if the crash is repeatable, and if will occur with a simpler set of options. You might even try to start the download at the page where the crash occurred to see if that page somehow triggered the crash. .Sp Also, while I will probably be interested to know the contents of your \&\fI.wgetrc\fR file, just dumping it into the debug message is probably a bad idea. Instead, you should first try to see if the bug repeats with \fI.wgetrc\fR moved out of the way. Only if it turns out that \&\fI.wgetrc\fR settings affect the bug, mail me the relevant parts of the file. .IP "3." 4 Please start Wget with \fB\-d\fR option and send us the resulting output (or relevant parts thereof). If Wget was compiled without debug support, recompile it\-\-\-it is \fImuch\fR easier to trace bugs with debug support on. .Sp Note: please make sure to remove any potentially sensitive information from the debug log before sending it to the bug address. The \&\f(CW\*(C`\-d\*(C'\fR won't go out of its way to collect sensitive information, but the log \fIwill\fR contain a fairly complete transcript of Wget's communication with the server, which may include passwords and pieces of downloaded data. Since the bug address is publically archived, you may assume that all bug reports are visible to the public. .IP "4." 4 If Wget has crashed, try to run it in a debugger, e.g. \f(CW\*(C`gdb \`which wget\` core\*(C'\fR and type \f(CW\*(C`where\*(C'\fR to get the backtrace. This may not work if the system administrator has disabled core files, but it is safe to try. .SH "SEE ALSO" .IX Header "SEE ALSO" This is \fBnot\fR the complete manual for \s-1GNU\s0 Wget. For more complete information, including more detailed explanations of some of the options, and a number of commands available for use with \fI.wgetrc\fR files and the \fB\-e\fR option, see the \s-1GNU\s0 Info entry for \fIwget\fR. .SH "AUTHOR" .IX Header "AUTHOR" Originally written by Hrvoje Niksic . .SH "COPYRIGHT" .IX Header "COPYRIGHT" Copyright (c) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011 Free Software Foundation, Inc. .PP Permission is granted to copy, distribute and/or modify this document under the terms of the \s-1GNU\s0 Free Documentation License, Version 1.2 or any later version published by the Free Software Foundation; with no Invariant Sections, no Front-Cover Texts, and no Back-Cover Texts. A copy of the license is included in the section entitled \*(L"\s-1GNU\s0 Free Documentation License\*(R". 0707010005a67a000041ed0000000000000000000000294fa8aa6600000000000000b500010002ffffffffffffffff0000001c00000000root/usr/local/share/locale0707010005a67b000041ed0000000000000000000000034fa8aa6600000000000000b500010002ffffffffffffffff0000001f00000000root/usr/local/share/locale/be0707010005a67c000041ed0000000000000000000000024fa8aa6600000000000000b500010002ffffffffffffffff0000002b00000000root/usr/local/share/locale/be/LC_MESSAGES0707010005a67d000081a40000000000000000000000014fa8a70b00007269000000b500010002ffffffffffffffff0000003300000000root/usr/local/share/locale/be/LC_MESSAGES/wget.mo4[L:( 2;A%}9NE,>r>72(=[: A AK7:8A96{;M><,{<I3/Oc?A'5] fr (%2)X'$&$8@<y/ ! "= `     ' !!5!W!#o!)!.!6!;#"_"w"""7"&"##B#D# U#_#s###'####-$=$Z$z$$ $$3$% 9%C%[%"w%#%%%)%"&B&4T&2&&& & &) '4' T'_'*e'''%''6(!7(Y( x(( ("( (!) &)'3)([))))0)) *2$* W*d*s****** +'+D+4V+8++ ++ ,,*,,, , -"-8-8J--J---.#.,.J.e.}... ... / $/=//m//+///0-0=08S0"0;0 0 01 1&#1J1Y1+h1<1121 2-&2/T2$221222,)3"V3y3$333 3 34/46K44!44445*5H5*Q5"|555 5#555 5 6)6?6S6o66 6666 66`879GT99H9C9V@:|:[;sp;\;LA<J<^<G8= ====[=[>Om>L>O ?GZ?L?P?u@@P@CANKAmARBq[B[B\)CJCCCC DWDrD'vD$D@D4EB9EF|E0E-E"F=F?PF@FiFz;GsG<*H2gH*H=H6I2:I,mI<I3IZ J)fJ/J$JBJ9(KUbKhKw!L4L2L6M8MWVMCMSMFN)INsNNN NNDN'AO"iOO_OMPGUPGP(P=QBLQQQ0QR#)R'MR7uR8R/R>SBUS9S!S@S25T/hT4TTTFT;BU~UUWU<U'9VdaV3VsV?nW9WXW&AXhX?yX<X5X,Y-=Y.kYY/YY<Z/ZPZL[^[p[2[5[[\/\*N\Fy\,\t\eb]]]]^^r^R_a__7__$_m `4{``#4a/Xa"aaIaB b/Pb"b#b=bc.c:Hc*c cic&&d>Mdd8e-SeeRe'e`f<sfcfg*gDg"Vgbyggg\h[lh*hqheijtiRiF2j5yjPjUk<VkUk+k@l2Vl<l!ll4mP9mm2n&Gn=nn2nNn .oD9o~oOo8o3pDp+Gp?spppppGp%Aqgqqq7q!q r9rXr"<$`yhZ+{IrUW~u>BG8v_sz39N e!^:Ap*jXqmtd7%\nSL 5QJ6D#/cf,)];0.'KobRw (P 1=EMO[ 4 -2kVFTx@l?Y|&aCi}gH The file is already fully retrieved; nothing to do. %*s[ skipping %sK ] %s received, redirecting output to %s. %s received. Originally written by Hrvoje Niksic . REST failed, starting from scratch. --certificate=FILE client certificate file. --ignore-case ignore case when matching files/directories. --ignore-length ignore `Content-Length' header field. --limit-rate=RATE limit download rate to RATE. --no-dns-cache disable caching DNS lookups. --no-iri turn off IRI support. --private-key=FILE private key file. --progress=TYPE select progress gauge type. --spider don't download anything. %s (env) %s (system) %s (user) in -4, --inet4-only connect only to IPv4 addresses. -6, --inet6-only connect only to IPv6 addresses. -F, --force-html treat input file as HTML. -O, --output-document=FILE write documents to FILE. -S, --server-response print server response. -V, --version display the version of Wget and exit. -a, --append-output=FILE append messages to FILE. -b, --background go to background after startup. -c, --continue resume getting a partially-downloaded file. -e, --execute=COMMAND execute a `.wgetrc'-style command. -h, --help print this help. -nd, --no-directories don't create directories. -np, --no-parent don't ascend to the parent directory. -o, --output-file=FILE log messages to FILE. -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). -v, --verbose be verbose (this is the default). -x, --force-directories force creation of directories. Self-signed certificate encountered. eta %s (%s bytes) (unauthoritative) [following]%d redirections exceeded. %s %s (%s) - %s saved [%s/%s] %s (%s) - %s saved [%s] %s (%s) - Connection closed at byte %s. %s (%s) - Data connection: %s; %s (%s) - Read error at byte %s (%s).%s (%s) - Read error at byte %s/%s (%s). %s (%s) - written to stdout %s[%s/%s] %s (%s) - written to stdout %s[%s] %s ERROR %d: %s. %s URL: %s %2d %s %s request sent, awaiting response... %s: %s, closing control connection. %s: %s: Failed to allocate %ld bytes; memory exhausted. %s: %s: Failed to allocate enough memory; memory exhausted. %s: %s: Invalid boolean %s; use `on' or `off'. %s: %s: Invalid byte value %s %s: %s: Invalid header %s. %s: %s: Invalid number %s. %s: %s: Invalid progress type %s. %s: %s: Invalid time period %s %s: %s: Invalid value %s. %s: %s:%d: unknown token "%s" %s: %s; disabling logging. %s: Cannot read %s (%s). %s: Cannot resolve incomplete link %s. %s: Error in %s at line %d. %s: Invalid --execute command %s %s: Invalid URL %s: %s %s: Syntax error in %s at line %d. %s: Unknown command %s in %s at line %d. %s: WGETRC points to %s, which doesn't exist. %s: Warning: Both system and user wgetrc point to %s. %s: aprintf: text buffer is too big (%ld bytes), aborting. %s: cannot stat %s: %s %s: corrupt time-stamp. %s: illegal option -- `-n%c' %s: missing URL %s: unable to resolve bind address %s; disabling bind. %s: unable to resolve host address %s %s: unknown/unsupported file type. '(no description)(try:%2d), %s (%s) remaining, %s remaining==> CWD not needed. ==> CWD not required. Already have correct symlink %s -> %s Authorization failed. Bad port numberBind error (%s). Can't be verbose and quiet at the same time. Cannot back up %s as %s: %s Cannot convert links in %s: %s Cannot initiate PASV transfer. Cannot open %s: %sCannot open cookies file %s: %s Cannot parse PASV response. Cannot specify both --ask-password and --password. Cannot write to %s (%s). Compile: Connecting to %s:%d... Connecting to %s|%s|:%d... Continuing in background, pid %d. Continuing in background, pid %lu. Continuing in background. Control connection closed. Conversion from %s to %s isn't supported Converted %d files in %s seconds. Converting %s... Cookie coming from %s attempted to set domain to %s Copyright (C) 2009 Free Software Foundation, Inc. Creating symlink %s -> %s Data transfer aborted. Directories: Directory Disabling SSL due to encountered errors. Download quota of %s EXCEEDED! Download: ERRORERROR: Redirection (%d) without location. Encoding %s isn't valid Error closing %s: %s Error in proxy URL %s: Must be HTTP. Error in server greeting. Error in server response, closing control connection. Error matching %s against %s: %s Error parsing certificate: %s Error parsing proxy URL %s: %s. Error writing to %s: %s FTP options: Failed reading proxy response: %s Failed to unlink symlink %s: %s Failed writing HTTP request: %s. File File %s already there; not retrieving. File %s already there; not retrieving. File %s exists. File `%s' already there; not retrieving. Found %d broken link. Found %d broken links. Found no broken links. GNU Wget %s built on %s. GNU Wget %s, a non-interactive network retriever. Giving up. HTTP options: HTTPS (SSL/TLS) options: HTTPS support not compiled inIPv6 addresses not supportedIndex of /%s on %s:%dInvalid IPv6 numeric addressInvalid PORT. Invalid host nameInvalid name of the symlink, skipping. Invalid user nameLast-modified header invalid -- time-stamp ignored. Last-modified header missing -- time-stamps turned off. Length: Length: %sLicense GPLv3+: GNU GPL version 3 or later . This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. Link Link: Loading robots.txt; please ignore errors. Locale: Location: %s%s Logged in! Logging and input file: Logging in as %s ... Login incorrect. Mail bug reports and suggestions to . Malformed status lineMandatory arguments to long options are mandatory for short options too. No URLs found in %s. No certificate found No data received. No errorNo headers, assuming HTTP/0.9No matches on pattern %s. No such directory %s. No such file %s. No such file %s. No such file or directory %s. Not sure Output will be written to %s. POST data file %s missing: %s Password for user %s: Password: Please send bug reports and questions to . Proxy tunneling failed: %sRead error (%s) in headers. Recursion depth %d exceeded max. depth %d. Recursive accept/reject: Recursive download: Rejecting %s. Remote file does not exist -- broken link!!! Remote file exists. Remote file is newer than local file %s -- retrieving. Remote file is newer, retrieving. Remote file no newer than local file %s -- not retrieving. Removed %s. Removing %s. Resolving %s... Retrying. Reusing existing connection to %s:%d. Saving to: %s Scheme missingServer error, can't determine system type. Server file no newer than local file %s -- not retrieving. Skipping directory %s. Spider mode enabled. Check if remote file exists. Startup: Symlinks not supported, skipping symlink %s. Syntax error in Set-Cookie: %s at position %d. Temporary failure in name resolutionThe server refuses login. The sizes do not match (local %s) -- retrieving. The sizes do not match (local %s) -- retrieving. This version does not have support for IRIs Try `%s --help' for more options. Unable to delete %s: %s Unable to establish SSL connection. Unhandled errno %d Unknown authentication scheme. Unknown errorUnknown hostUnknown system errorUnknown type `%c', closing control connection. Unsupported listing type, trying Unix listing parser. Unsupported scheme %sUnterminated IPv6 numeric addressUsage: %s NETRC [HOSTNAME] Usage: %s [OPTION]... [URL]... Using %s as listing tmp file. WARNINGWarning: wildcards not supported in HTTP. Wgetrc: Write failed, closing control connection. Wrote HTML-ized index to %s [%s]. Wrote HTML-ized index to %s. `connected. couldn't connect to %s port %d: %s done. done. done. failed: %s. failed: No IPv4/IPv6 addresses for host. failed: timed out. idn_decode failed (%d): %s idn_encode failed (%d): %s ignoredlocale_to_utf8: locale is unset memory exhaustednothing to do. time unknown unspecifiedProject-Id-Version: wget 1.12-pre6 Report-Msgid-Bugs-To: bug-wget@gnu.org POT-Creation-Date: 2011-09-13 10:17+0200 PO-Revision-Date: 2010-04-13 02:23+0300 Last-Translator: Alexander Nyakhaychyk Language-Team: Belarusian Language: be MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2); Файл ужо цалкам атрыманы; рабіць нічога ня трэба. %*s[ абмінаем %sK ] %s атрымана; перанакірванне вываду ў %s. %s атрымана. Першастваральнік - Hrvoje Niksic . Збой загаду REST; пачынаем усё нанова. --certificate=FILE файл кліенцкага пасведчання. --ignore-case ігнараваць рэгістар у назвах файлаў/дырэкторыяў. --ignore-length ігнараваць загаловак «Content-Length». --limit-rate=RATE абмежаваць хуткасць запампоўкі ўзроўнем RATE. --no-dns-cache адключыць кэш вынікаў DNS пошуку. --no-iri адключыць падтрымку IRI. --private-key=FILE файл сакрэтнага ключа. --progress=TYPE выбар выгляду дыяграмы прагрэсу. --spider не запампоўваць усё. %s (env) %s (system) %s (user) у -4, --inet4-only далучацца толькі да IPv4 адрасоў. -6, --inet6-only далучацца толькі да IPv6 адрасоў. -F, --force-html лічыць уваходны файл за HTML. -O, --output-document=FILE запісвае дакумент у FILE. -S, --server-response друкаваць адказ сэрвера. -V, --version адлюстроўвае версію Wget. -a, --append-output=FILE дадаць паведамленні ў FILE. -b, --background фонавая праца пасля запуску. -c, --continue працяг запампоўкі часткова-атрыманага файла. -e, --execute=COMMAND выконвае загад у стылі ".wgetrc". -h, --help друкую гэтую даведку. -nd, --no-directories не ствараць дырэкторыі. -np, --no-parent не ўваходзіць у бацькоўскую дырэкторыю. -o, --output-file=FILE запісваць паведамленні ў FILE. -t, --tries=NUMBER задае колькасць спроб NUMBER (0 - неабмежавана). -v, --verbose быць шматслоўным (прадвызначана). -x, --force-directories прымусіць ствараць дырэкторыі. Напаткана самападпісанае пасведчанне. ~ %s (%s байтаў) (неаўтарытэтны) [крочым]перавышэньне колькасьці перанакіраваньняў (%d). %s %s (%s) - %s захаваны [%s/%s] %s (%s) - %s захаваны [%s] %s (%s) - злучэньне закрыта на байце %s. %s (%s) - далучэнне для даных: %s; %s (%s) - памылка чытаньня на байце %s (%s).%s (%s) - памылка чытаньня на байце %s/%s (%s). %s (%s) - запісаны ў stdout %s[%s/%s] %s (%s) - запісаны ў stdout %s[%s] %s ПАМЫЛКА %d: %s. %s URL: %s %2d %s %s зварот дасланы, чакаецца адказ... %s: %s; закрыццё кіруючага далучэння. %s: %s: немагчыма размеркаваць %ld байтаў; памяць вычэрпаная. %s: %s: немагчыма размеркаваць дастаткова памяці; памяць вычэрпаная. %s: %s: Нядзейснае булева значэнне %s; выкарыстоўвайце «on» ці «off». %s: %s: Нядзейснае значэнне байта %s %s: %s: Нядзейсны загаловак %s. %s: %s: Нядзейсны нумар %s. %s: %s: Нядзейсны тып прагрэсбару %s. %s: %s: Нядзейсны адрэзак часу %s %s: %s: Нядзейснае значэнне %s. %s: %s:%d: невядомы токен "%s" %s: %s; запіс храналогіі адключаны. %s: Немагчыма прачытаць %s (%s). %s: немагчыма разьвязаць незавершаную спасылку %s. %s: Памылка ў %s, радок %d. %s: Нядзейсны загад --execute %s %s: нерэчаісны URL %s: %s %s: Сінтаксічаня памылка ў %s, радок %d. %s: невядомы загад %s у %s; радок %d. %s: WGETRC спасылаецца на %s, але ён(яна) адсутнічае. %s: УВАГА! Сістэмны і карыстальніцкі wgetrc спасылаюцца на %s. %s: aprintf: тэкставы буфер завялікі (%ld байтаў); аварыйнае завяршэнне. %s: немагчыма выканаць stat %s: %s %s: пашкоджаны адбітак часу. %s: недапушчальная опцыя -- "-n%c" %s: прапушчаны URL %s: немагчыма вызначыць bind-адрас %s; bind адключаны. %s: немагчыма вызначыць назву вузла %s %s: тып файла не падтрымліваецца або невядомы. »(апісаньне адсутнічае)(спроба: %2d), %s (%s) засталося, %s засталося==> CWD непатрэбнае. ==> CWD непатрэбны. Ужо маецца правільная спасылка %s -> %s Збой аўтарызаваньня. Кепскі нумар портаПамылка bind (%s). Немагчыма адначасова быць шматслоўным і маўклівым. Немагчыма зрабіць запасную копію %s як %s: %s Немагчыма пераўтварыць спасылкі ў %s: %s Немагчыма ініцыялізаваць PASV-перадачу. Немагчыма адкрыць %s: %sНемагчыма адкрыць файл з cookies %s: %s Немагчыма зрабіць разбор PASV адказу. Нельга адначасова выбіраць --ask-password і --password. Немагчыма запісаць у %s (%s). Кампілятар: Далучэньне да %s:%d... Далучэньне да %s[%s]:%d... Праца працягваецца ў тле, pid %d. Праца працягнецца ў фоне, pid %lu. Праца працягнецца ў фоне. Кантрольнае далучэньне зачынена. Канверсія з %s у %s непадтрымліваецца Пераўтворана %d файлаў за %s сэк. Пераўтварэнне %s... Cookie з %s спрабуе выставіць дамэн у %s Copyright (C) 2009 Free Software Foundation, Inc. Стварэньне спасылкі %s -> %s Абарваная перадача даньняў. Дырэкторыі: Дырэкторыя SSL адключаны з-за пералічаных памылак. Квота запампоўкі (%s) перавышана! Запампоўка: ПАМЫЛКАПАМЫЛКА: перанакіраваньне (%d) без знаходжаньня. Кадоўка %s не з'яўляецца дзейснай Памылка закрыцця %s: %s Памылка ў URL паўнамоцнага паслужніка %s: мусіць быць HTTP. Памылка ў вітаньні сэрвэра. Памылка ў адказе паслужніка; кантрольнае далучэньне зачынена. Памылка супадзеньня %s супраць %s: %s Памылка разбору пасведчання: %s Памылка разбору URL паўнамоцнага паслужніка %s: %s. Памылка запісу ў %s: %s Опцыі FTP: Памылка чытаньня адказу проксі: %s. Немагчыма выдаліць спасылку %s: %s Памылка запісу HTTP зварота: %s. Файл Файл %s ужо тут; абмінаем. Файл %s ужо тут; абмінаем. Файл %s існуе. Файл "%s" ужо тут; абмінаем. Знойдзена %d зламаная спсылка. Знойдзены %d зламаныя спсылкі. Знойдзена %d зламаных спсылак. Зламаныя спасылкі ня знойдзены. GNU Wget %s скампіляваны на %s. Неінтэрактыўны сеткавы запампоўнік GNU Wget %s. Здаемся. Опцыі HTTP: Опцыі HTTPS (SSL/TLS): Падтрымка HTTPS не ўбудаванаяАдрасы IPv6 не падтрымліваюццаЗьмест /%s на %s:%dКепскі адрас IPv6Кепскі загад PORT. Нядзейсная назва вузлаНерэчаісная назва спасылкі; мінаецца. Нядзейснае ўліковае імяЗагаловак Last-Modified нерэчаісны -- адбітак часу будзе ігнаравацца. Загаловак Last-Modified адсутнічае -- адбіткі часу адключаны. Даўжыня: Даўжыня: %sLicense GPLv3+: GNU GPL version 3 or later . This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. Лучыва Спасылка: Загружаецца robots.txt; калі ласка, не зьвяртайце ўвагі на памылкі. Лакаль: Знаходжаньне: %s%s Увайшоў! Храналогія і ўваходныя файлы: Уваходжу як %s ... Уваход не карэктны. Лістуйце справаздачы аб памылках і пажаданні на . Дрэннаскладзены радок стануАргумэнты, абавязкоўвыя для доўгіх опцыяў, абавязковыя й для кароткіх. Ня знойдзены URL у %s. Пасведчанне ня знойдзена Даныя не атрыманы. Няма памылакАдсутнічаюць загалоўкі; верагодна, HTTP/0.9Адсутнічаюць супадзенні з узорам %s. Адсутнічае дырэкторыя %s. Адсутнічае файл %s. Адсутнічае файл %s. Адсутнічае файл ці дырэкторыя %s. Ня пэўны Вывад будзе запісаны ў %s. Адсутнічае файл %s з POST-данымі: %s Пароль карыстальіка %s: Пароль:Лістуйце справаздачы аб памылках і пытанні на . Збой проксі-тунэлю: %sПамылка чытаньня (%s) у загалоўках. Значэньне рэкурсыўнае глыбіні %d большае за найбольшую дазволеную глыбіню %d. Рэкурсіўныя дазволы/забароны: Рэкурсіўная запампоўка: Адхіляем %s. Аддалены файл не існуе -- зламаная спасылка!!! Аддалены файл існуе. Аддалены файл навейшы за мясцовы файл %s -- выцягваем. Аддалены файл навейшы, загружаю. Аддалены файл не навейшы за мясцовы файл %s -- абмінаем. Выдалены %s. Выдаленьне %s. Пошук %s... Паўтараем спробу. Паўторнае выкарыстаньне існуючага далучэньня да %s:%d. Запіс у %s. Адсутнічае схемаПамылка сэрвэра, немагчыма вызначыць тып сыстэмы. Аддалены файл не навейшы за мясцовы %s -- абмінаем. Абмінаем дырэкторыю %s. Уключаны рэжым павука. Праверка наяўнасьці аддаленага файла. Запуск: Сімвалічныя спасылкі не падтрымліваюцца; абмінаем symlink %s. Сінтаксічная памылка ў Set-Cookie: %s на пазіцыі %d. Часовая памылка ў разьвязваньні назвыСэрвэр адмаўляе ва ўваходзе. Памеры не супадаюць (мясцовы %s) -- выцягваем. Памеры не супадаюць (мясцовы %s) -- выцягваецца. Гэтая версія ня мае падтрымкі IRIs Паспрабуйце "%s --help", каб пабачыць больш опцыяў. Немагчыма выдаліць %s: %s Немагчыма ўсталяваць SSL злучэньне. Неапрацаваны код памылкі %d Невядомая схема аўтарызаваньня. Невядомая памылкаНевядомы вузелНевядомая сістэмная памылкаНевядомы тып `%c', закрыю кіроўнае злучэньне. Гэты від сьпіса файлаў не падтрымліваецца, спроба ўжыць разбор Unix-сьпісаў. Схема %s не падтрымліваеццаНезавершаны адрас IPv6Выкарыстаньне: %s NETRC [НАЗВА_ВУЗЛА] Выкарыстанне: %s [OPTION]... [URL]... Выкарыстанне %s у якасьці лістынгу tmp-файла УВАГАУвага! Узоры не падтрымліваюцца ў HTTP. Wgetrc: Памылка запісу, закрыю кіроўнае злучэньне. Запіс HTML-ізаваны індэкс у %s [%s]. Запіс HTML-ізаваны індэкс у %s. «далучэньне ўсталявана. немагчыма далучыцца да %s, порт %d: %s зроблена. зроблена.зроблена.збой: %s. збой: адсутнічае IPv4/IPv6 адрас для вузла. збой: скончыўся час. збой idn_decode (%d): %s збой idn_encode (%d): %s праігнараванаlocale_to_utf8: лакаль не вызначаная памяць вычэрпанаяняма чаго рабіць. час невядомы невядома0707010005a6e6000041ed0000000000000000000000034fa8aa6600000000000000b500010002ffffffffffffffff0000001f00000000root/usr/local/share/locale/tr0707010005a6e7000041ed0000000000000000000000024fa8aa6600000000000000b500010002ffffffffffffffff0000002b00000000root/usr/local/share/locale/tr/LC_MESSAGES0707010005a6e8000081a40000000000000000000000014fa8a70c00007662000000b500010002ffffffffffffffff0000003300000000root/usr/local/share/locale/tr/LC_MESSAGES/wget.moK:;%OQu>MET9BMIeEMMCIO9+5e@:6ENNN>2Fq<I2?>r@QDD<>IMOK>x2=D( ;m ; P ?6!Nv!Q!N"Ff"C">"~0#:#M#E8$Q~$A$A%PT%M%7%G+&@s&I&?&s>':';'@)(Pj(8(D(J9)A)A)6*;?*M{*B*> +,K+Mx+K+A,<T,I,H,3$-NX-0-8-O.?a.B.A. &/2/ F/S/(n//%/)/00&80$_080000'1(:1c11$1#1.12(2A2_2#p22 22222'2&3=3M3-_3<333(404P4c43444"4# 5/5J5f54x53555 6 "6)/6 Y6d6*j6%6666 7 .7"<7!_7 7)727 778!8>8T8q88'884889:9 C9 N9*[99 999989:J2:}:::: :::+;>;X;"m;); ;; ;&;+ < 8</B<$r<<1<2<;="S=$v== = =/=6>!=>_>{>>#>*>3>*&? Q?#]??? ? ?)????? @@6ABJ'B*rB|BQCTlCGC: DQDDRDwDLaEyE(FGFwG9|G8G=G9-H9gHMHxHQhI7ILIG?JCJ6JHKMKKRKDK21LGdL}Ly*MM%NCN6O;:O`vOYO:1PwlPLPw1QQhRKRL8SESSJXTMTzTulUCUC&V{jVvVL]WNW_WYX;XOYZeYSY?ZyTZ;ZG [ER[F[_[8?\7x\w\B(]Pk]8]]Lv^c^0'_4X_B_F_~`J`2`AaLVasa7b ObZb lbwb(b"b(b+c3cDc-`c-cJc$d,dKd*dd1d*dd5e8>e/weee$ef,f?f Pf^f nfyff*fffg'g>Eg!g*gg"g h h,@hmhhh)hh#i&i?AiFi'ii j j;"j ^jij.njj$j>j) kJk ]k'~k k'k;kl(lOv_[jY`EDRHI W-w y71Pn,<?{!k6pZ/|(U ^: bf%$VGQK8}+X3dL'MCum5iS;Jh"]9e@aF0stB #4&=go)\NqAr*.~Tc The file is already fully retrieved; nothing to do. %s received. Originally written by Hrvoje Niksic . REST failed, starting from scratch. --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host. --ca-certificate=FILE file with the bundle of CA's. --ca-directory=DIR directory where hash list of CA's is stored. --certificate-type=TYPE client certificate type, PEM or DER. --certificate=FILE client certificate file. --connect-timeout=SECS set the connect timeout to SECS. --cut-dirs=NUMBER ignore NUMBER remote directory components. --delete-after delete files locally after downloading them. --dns-timeout=SECS set the DNS lookup timeout to SECS. --egd-file=FILE file naming the EGD socket with random data. --exclude-domains=LIST comma-separated list of rejected domains. --follow-ftp follow FTP links from HTML documents. --follow-tags=LIST comma-separated list of followed HTML tags. --ftp-password=PASS set ftp password to PASS. --ftp-user=USER set ftp user to USER. --header=STRING insert STRING among the headers. --http-password=PASS set http password to PASS. --http-user=USER set http user to USER. --ignore-length ignore `Content-Length' header field. --ignore-tags=LIST comma-separated list of ignored HTML tags. --keep-session-cookies load and save session (non-permanent) cookies. --limit-rate=RATE limit download rate to RATE. --load-cookies=FILE load cookies from FILE before session. --no-cache disallow server-cached data. --no-check-certificate don't validate the server's certificate. --no-cookies don't use cookies. --no-dns-cache disable caching DNS lookups. --no-glob turn off FTP file name globbing. --no-http-keep-alive disable HTTP keep-alive (persistent connections). --no-passive-ftp disable the "passive" transfer mode. --no-proxy explicitly turn off proxy. --no-remove-listing don't remove `.listing' files. --password=PASS set both ftp and http password to PASS. --post-data=STRING use the POST method; send STRING as the data. --post-file=FILE use the POST method; send contents of FILE. --prefer-family=FAMILY connect first to addresses of specified family, one of IPv6, IPv4, or none. --private-key-type=TYPE private key type, PEM or DER. --private-key=FILE private key file. --progress=TYPE select progress gauge type. --protocol-directories use protocol name in directories. --proxy-password=PASS set PASS as proxy password. --proxy-user=USER set USER as proxy username. --random-file=FILE file with random data for seeding the SSL PRNG. --read-timeout=SECS set the read timeout to SECS. --referer=URL include `Referer: URL' header in HTTP request. --restrict-file-names=OS restrict chars in file names to ones OS allows. --retr-symlinks when recursing, get linked-to files (not dir). --retry-connrefused retry even if connection is refused. --save-cookies=FILE save cookies to FILE after session. --save-headers save the HTTP headers to file. --secure-protocol=PR choose secure protocol, one of auto, SSLv2, SSLv3, and TLSv1. --spider don't download anything. --strict-comments turn on strict (SGML) handling of HTML comments. --user=USER set both ftp and http user to USER. --waitretry=SECONDS wait 1..SECONDS between retries of a retrieval. -4, --inet4-only connect only to IPv4 addresses. -6, --inet6-only connect only to IPv6 addresses. -A, --accept=LIST comma-separated list of accepted extensions. -D, --domains=LIST comma-separated list of accepted domains. -F, --force-html treat input file as HTML. -H, --span-hosts go to foreign hosts when recursive. -I, --include-directories=LIST list of allowed directories. -K, --backup-converted before converting file X, back up as X.orig. -L, --relative follow relative links only. -N, --timestamping don't re-retrieve files unless newer than local. -O, --output-document=FILE write documents to FILE. -P, --directory-prefix=PREFIX save files to PREFIX/... -Q, --quota=NUMBER set retrieval quota to NUMBER. -R, --reject=LIST comma-separated list of rejected extensions. -S, --server-response print server response. -T, --timeout=SECONDS set all timeout values to SECONDS. -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION. -V, --version display the version of Wget and exit. -X, --exclude-directories=LIST list of excluded directories. -a, --append-output=FILE append messages to FILE. -b, --background go to background after startup. -c, --continue resume getting a partially-downloaded file. -d, --debug print lots of debugging information. -e, --execute=COMMAND execute a `.wgetrc'-style command. -h, --help print this help. -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite). -m, --mirror shortcut for -N -r -l inf --no-remove-listing. -nH, --no-host-directories don't create host directories. -nd, --no-directories don't create directories. -np, --no-parent don't ascend to the parent directory. -nv, --no-verbose turn off verboseness, without being quiet. -o, --output-file=FILE log messages to FILE. -p, --page-requisites get all images, etc. needed to display HTML page. -q, --quiet quiet (no output). -r, --recursive specify recursive download. -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). -v, --verbose be verbose (this is the default). -w, --wait=SECONDS wait SECONDS between retrievals. -x, --force-directories force creation of directories. (%s bytes) (unauthoritative) [following]%d redirections exceeded. %s (%s) - Connection closed at byte %s. %s (%s) - Data connection: %s; %s (%s) - Read error at byte %s (%s).%s (%s) - Read error at byte %s/%s (%s). %s ERROR %d: %s. %s has sprung into existence. %s request sent, awaiting response... %s: %s, closing control connection. %s: %s: Failed to allocate %ld bytes; memory exhausted. %s: %s:%d: unknown token "%s" %s: %s; disabling logging. %s: Cannot read %s (%s). %s: Cannot resolve incomplete link %s. %s: Couldn't find usable socket driver. %s: Error in %s at line %d. %s: Invalid URL %s: %s %s: No certificate presented by %s. %s: Syntax error in %s at line %d. %s: WGETRC points to %s, which doesn't exist. %s: cannot stat %s: %s %s: corrupt time-stamp. %s: illegal option -- `-n%c' %s: missing URL %s: unknown/unsupported file type. (no description)(try:%2d), %s (%s) remaining, %s remaining==> CWD not needed. ==> CWD not required. Already have correct symlink %s -> %s Authorization failed. Bad port numberBind error (%s). Can't be verbose and quiet at the same time. Can't timestamp and not clobber old files at the same time. Cannot back up %s as %s: %s Cannot convert links in %s: %s Cannot get REALTIME clock frequency: %s Cannot initiate PASV transfer. Cannot open %s: %sCannot parse PASV response. Cannot specify both --inet4-only and --inet6-only. Connecting to %s:%d... Connecting to %s|%s|:%d... Continuing in background, pid %d. Continuing in background, pid %lu. Continuing in background. Control connection closed. Converting %s... Cookie coming from %s attempted to set domain to %s Could not seed PRNG; consider using --random-file. Creating symlink %s -> %s Data transfer aborted. Directories: Directory Disabling SSL due to encountered errors. Download: ERRORERROR: Redirection (%d) without location. Error in proxy URL %s: Must be HTTP. Error in server greeting. Error in server response, closing control connection. Error parsing proxy URL %s: %s. FTP options: Failed reading proxy response: %s Failed writing HTTP request: %s. File File `%s' already there; not retrieving. GNU Wget %s, a non-interactive network retriever. Giving up. HTTP options: HTTPS (SSL/TLS) options: IPv6 addresses not supportedIndex of /%s on %s:%dInvalid IPv6 numeric addressInvalid PORT. Invalid host nameInvalid name of the symlink, skipping. Invalid user nameLast-modified header invalid -- time-stamp ignored. Last-modified header missing -- time-stamps turned off. Length: Length: %sLink Loading robots.txt; please ignore errors. Location: %s%s Logged in! Logging and input file: Logging in as %s ... Login incorrect. Mail bug reports and suggestions to . Malformed status lineMandatory arguments to long options are mandatory for short options too. No URLs found in %s. No data received. No errorNo headers, assuming HTTP/0.9Not sure Proxy tunneling failed: %sRead error (%s) in headers. Recursion depth %d exceeded max. depth %d. Recursive accept/reject: Recursive download: Remote file is newer, retrieving. Removing %s since it should be rejected. Removing %s. Resolving %s... Retrying. Reusing existing connection to %s:%d. Server error, can't determine system type. Startup: Syntax error in Set-Cookie: %s at position %d. Temporary failure in name resolutionThe server refuses login. The sizes do not match (local %s) -- retrieving. The sizes do not match (local %s) -- retrieving. To connect to %s insecurely, use `--no-check-certificate'. Try `%s --help' for more options. Unable to establish SSL connection. Unknown authentication scheme. Unknown errorUnknown hostUnknown type `%c', closing control connection. Unsupported listing type, trying Unix listing parser. Unterminated IPv6 numeric addressUsage: %s NETRC [HOSTNAME] Usage: %s [OPTION]... [URL]... WARNINGWARNING: using a weak random seed. Warning: wildcards not supported in HTTP. Will not retrieve dirs since depth is %d (max %d). Write failed, closing control connection. connected. couldn't connect to %s port %d: %s done. done. done. failed: %s. failed: No IPv4/IPv6 addresses for host. failed: timed out. ignorednothing to do. time unknown unspecifiedProject-Id-Version: wget 1.10.1-b1 Report-Msgid-Bugs-To: bug-wget@gnu.org POT-Creation-Date: 2011-09-13 10:17+0200 PO-Revision-Date: 2005-07-16 19:09+0300 Last-Translator: Nilgün Belma Bugüner Language-Team: Turkish Language: tr MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit X-Generator: KBabel 1.9.1 Plural-Forms: nplurals=2; plural=(n != 1); Dosya zaten alınmıştı; birşey yapılmadı. %s alındı. Özgün olarak Hrvoje Niksic tarafından yazıldı. REST başarısız, baştan başlanıyor. --bind-address=ADRES makinenizin adresi (isim ya da IP) olarak bu ADRES gösterilir. --ca-certificate=DOSYA sertifika yetkilisinin (CA) bohçası için DOSYA. --ca-directory=DİZİN sertifika yetkilisinin (CA) çırpılarının yeri. --certificate-type=TÜR istemci sertifika TÜRü; PEM veya DER. --certificate=DOSYA istemci sertifika DOSYAsı. --connect-timeout=SÜRE saniye cinsinden bağlantı zamanaşımı SÜREsi --cut-dirs=SAYI belirtilen SAYIda uzak dizin bileşeni yoksayılır --delete-after indirilen dosyaları indirdikten sonra siler. (tabii ki yerel) --dns-timeout=SÜRE saniye cinsinden isim çözümleme SÜREsi. --egd-file=DOSYA EGD soketini isimlendirmek için rasgele veri içeren DOSYA. --exclude-domains=LISTE reddedilecek alan isimlerinin virgül ayraçlı listesi --follow-ftp HTML belgelerdeki FTP bağları izlenir. --follow-tags=LISTE izin verilen HTML etiketlerinin virgül ayraçlı listesi. --ftp-password=PAROLA ftp kullanıcı PAROLAsı. --ftp-user=İSİM ftp kullanıcı İSMİ. --header=DİZGE başlık yerine DİZGE konur. --http-password=PAROLA http kullanıcı PAROLASI. --http-user=İSİM http kullanıcı İSMİ. --ignore-length `Content-Length' başlık alanı yoksayılır. --ignore-tags=LISTE yoksayılacak HTML etiketlerinin virgül ayraçlı listesi. --keep-session-cookies çerezleri sadece oturum için yükler ve kaydeder --limit-rate=HIZ indirme HIZ sınırı. --load-cookies=DOSYA çerezler oturumdan önce DOSYAdan yüklenir. --no-cache sunucu-arabellekli veriye izin verilmez. --no-check-certificate sunucu sertifikası doğrulatılmaz. --no-cookies çerezler kullanılmaz. --no-dns-cache isim çözümlemesi kayıtları tutulmaz. --no-glob FTP dosya ismi arama kalıpları kullanılmaz. --no-http-keep-alive HTTP keep-alive (sürekli bağlantı) iptal edilir. --no-passive-ftp "passive" aktarım kipini iptal eder. --no-proxy vekil kullanılmaz. --no-remove-listing `.listing' uzantılı dosyalar silinmez. --password=PAROLA ftp ve http kullanıcı parolası olarak bu PAROLA kullanılır. --post-data=DİZGE POST yöntemi kullanılır; veri olarak DİZGE gönderilir. --post-file=DOSYA POST yöntemi kullanılır; veri olarak DOSYA içeriği gönderilir --prefer-family=AİLE ilk bağlantı belirtilen AİLEdeki adrese yapılır. IPv6, IPv4 ya da none belirtilebilir. --private-key-type=TÜR gizli anahtar TÜRü; PEM veya DER. --private-key=DOSYA gizli anahtar DOSYAsı. --progress=TÜR süreç göstergesi TÜRü. --protocol-directories dizinlerde protokol ismi kullanılır. --proxy-password=PAROLA vekil kullanıcı PAROLASI. --proxy-user=İSİM vekil kullanıcı İSMİ. --random-file=DOSYA SSL PRNG'sini tohumlamak için rasgele veri içeren DOSYA. --read-timeout=SÜRE saniye cinsinden okuma zamanaşımı SÜREsi --referer=ADRES HTTP isteğinde `Referer: ADRES' başlığı kullanılır. --restrict-file-names=İŞLETİM-SİSTEMİ dosya ismi uzunluğunu İŞLETİM-SİSTEMİnin izin verdiği uzunluğa ayarlar. --retr-symlinks alt dizinlerdeki sembolik bağlı dosyalar (dizinler değil) alınır. --retry-connrefused bağlantı reddedilse bile yeniden dener. --save-cookies=DOSYA çerezler oturumdan sonra DOSYAya kaydedilir. --save-headers HTTP başlıkları dosyaya kaydedilir. --secure-protocol=PR güvenlik protokolü belirtilir; auto, SSLv2, SSLv3 veya TLSv1 belirtilebilir. --spider hiçbir şey indirilmez (araştırma kipi). --strict-comments HTML açıklama alanlarında belirtime uyulur. --user=İSİM ftp ve http kullanıcı ismi olarak bu İSİM kullanılır. --waitretry=BSÜRE saniye cinsinden alımın yinelenmesini bekleme SÜREsi -4, --inet4-only sadece IPv4 adreslere bağlanılır. -6, --inet6-only sadece IPv6 adreslere bağlanılır. -A, --accept=LISTE izin verilecek dosya uzatılarının virgül ayraçlı listesi -D, --domains=LISTE izin verilecek alan isimlerinin virgül ayraçlı listesi -F, --force-html girdi dosyasının HTML olduğu varsayılır. -H, --span-hosts rastlandıkça başka makinelerdekilerde alınır. -I, --include-directories=LISTE izin verilen dizinlerin listesi. -K, --backup-converted dosyayı dönüştürmeden önce .orig uzantılı yedeğini alır. -L, --relative sadece göreli bağlar izlenir. -N, --timestamping mevcuttan daha yeni olmayan dosyalar indirilmez. -O, --output-document=DOSYA belgeler DOSYAya yazılır. -P, --directory-prefix=DİZİN dosyalar belirtilen DİZİN altına kaydedilir. -Q, --quota=SAYI alım kotasını SAYIya ayarlar. -R, --reject=LISTE reddedilecek dosya uzatılarının virgül ayraçlı listesi -S, --server-response sunucunun yanıtını basar. -T, --timeout=SÜRE saniye cinsinden zamanaşımı SÜREsi. -U, --user-agent=AJAN Wget/SÜRÜM yerine AJAN kullanılır. -V, --version Wget sürümünü gösterir ve çıkar. -X, --exclude-directories=LISTE dışlanacak dizinlerin listesi. -a, --append-output=DOSYA iletiler DOSYAya eklenir. -b, --background artalanda başlatılır. -c, --continue dosya yarım kalmışsa kaldığı yerden devam ettirilir. -d, --debug hata ayıklama bilgileri basılır. -e, --execute=KOMUT `.wgetrc' tarzı bir komut çalıştırmak için. -h, --help bu yardım metnini basar. -l, --level=SAYI inilecek azami dizin derinliği (sonsuz için inf veya 0 belirtin). -m, --mirror -N -r -l inf--no-remove-listing için kısayol. -nH, --no-host-directories karşı tarafın dizin yapısına uyulmaz. -nd, --no-directories dizin oluşturulmaz. -np, --no-parent üst dizine çıkılmaz. -nv, --no-verbose daha az ayrıntılı bilgi verilir. -o, --output-file=DOSYA Günlük kayıtları DOSYAya yazılır. -p, --page-requisites HTML sayfada gösterilmesi gerekli herşeyi (resimler, v.s.) indirir. -q, --quiet hiçbir bilgi verilmez (sessiz çalışma). -r, --recursive ne varsa indirilir. -t, --tries=SAYI yineleme SAYIsı (0: sınırsız). -v, --verbose ayrıtılı bilgi verilir (öntanımlıdır). -w, --wait=SÜRE saniye cinsinden alımlar arasındaki bekleme SÜREsi -x, --force-directories mutlaka dizin oluşturulur. (%s bayt) (yetkin değil) [izleyen]%d yönlendirme geçildi. %s (%s) - %s baytta bağlantı kesildi. %s (%s) - Veri bağlantısı: %s; %s (%s) - %s. baytta okuma hatası (%s).%s (%s) - %s/%s baytta okuma hatası (%s). %s HATA %d: %s. %s birden ortaya çıktı. %s isteği gönderildi, yanıt bekleniyor... %s: %s, kontrol bağlantısı kapatılıyor. %s: %s: %ld baytı ayırmak mümkün olmadı; bellek tükenmiş olabilir. %s: %s:%d: bilinmeyen dizgecik "%s" %s: %s; giriş iptalediliyor. %s: %s okunamadı (%s). %s: İçi boş %s bağı çözümlenemez. %s: Kullanılabilir soket sürücü bulunamadı. %s: %s dosyasının %d. satırında hata. %s: URL `%s' geçersiz: %s %s: %s tarafından sunulun böyle bir sertifika yok. %s: %s dosyasının %d. satırında sözdizimi hatası. %s: WGETRC olmayan %s dosyasını gösteriyor. %s: %s durumlanamadı: %s %s: zaman damgası bozuk. %s: seçenek uygun değil -- `-n%c' %s: URL kayıp %s: bilinmeyen/desteklenmeyen dosya türü. (açıklama yok)(deneme: %2d), %s (%s) kalan, %s kalan==> CWD gereksiz. ==> CWD gerekli değil. Zaten doğru sembolik bağ var: %s -> %s Yetkilendirme başarısız. Port numarası hatalıBağlanma hatası (%s). Hem çok detaylı hem de sessiz olmaz. Eski dosyaları hem zaman damgalamak hem de dokunmamak olmaz. %s, %s olarak yedeklenemiyor: %s %s deki bağlar dönüştürülemiyor: %s RTC saptanamadı: %s PASV aktarımı başlatılamadı. %s açılamıyor: %sPASV yanıtı çözümlenemedi. Hem --inet4-only hem de --inet6-only olmaz. %s:%d bağlanılıyor...%s[%s]:%d bağlanılıyor... Ardalanda sürüyor, pid %d. İşlem PID %lu ile artalanda sürüyor. Ardalanda sürüyor. Kontrol bağlantısı kapatıldı. %s dönüştürülüyor...%s adresinden gelen çerez alan adını %s yapmaya çalıştı Rasgele sayı üreteci tohumlanamadı; --random-file kullanılabilir. Sembolik bağ oluşturuluyor: %s -> %s Veri aktarımı kesildi. Dizinler: Dizin Ne olduğu belirsiz hatalardan dolayı SSL iptal ediliyor. İndirme: HATAHATA: Yönlendirmede (%d) yer belirtilmemiş. Vekil URLsi %s: HTTP olmalı. Sunucu karşılama iletisinde hata. Sunucu yanıtında hata, kontrol bağlantısı kapatılıyor. Vekil URLsi %s çözümlenirken hata: %s FTP seçenekleri: Vekilin yanıtı okunamadı: %s HTTP isteğini yazma başarısız: %s. Dosya `%s' dosyası zaten var; alınmayacak. GNU Wget %s, bir etkileşimsiz dosya/dizin indirme aracı. Vazgeçiliyor. HTTP seçenekleri: HTTPS (SSL/TLS) seçenekleri: IPv6 adresler desteklenmiyor%2$s:%3$d üstünde /%1$s indeksiIPv6 sayısal adresi geçersizPORT geçersiz. Makine ismi geçersizSembolik bağın ismi geçersiz, atlanıyor. Kullanıcı ismi geçersizLast-modified başlığı geçersiz -- zaman damgası yoksayıldı. Last-modified başlığı kayıp -- zaman damgası kapatıldı. Uzunluk: Uzunluk: %sBağ robots.txt yükleniyor; lütfen hataları yoksayın. Yer: %s%s Oturum açıldı! Günlük kaydı ve girdi dosyası: %s olarak oturuma giriliyor ... Oturum açma başarısız. Yazılım hatalarını ve önerilerinizi adresine çeviri hatalarını adresine bildiriniz. Durum satırı bozukUzun seçeneklerdeki zorunlu argümanlar kısa seçeneklerde de zorunludur. %s de URL yok. Hiçbir veri alınmadı. Hata yokBaşlıklar eksik, HTTP/0.9 olduğu varsayılıyorKesin değil Vekil tünellenemedi: %sBaşlıklar okunurken hata (%s). Yineleme derinliği %d aşıldı. En fazla derinlik %d. Ne varsa indirmede kabul/red seçenekleri: Ne varsa indirme seçenekleri: Uzak dosya daha yeni, alınıyor. Reddedileceğinden %s kaldırılıyor. %s kaldırılıyor. %s çözümleniyor... Tekrarlanıyor. Bağlantı tekrar kullanılıyor: %s:%d. Sunucu hatası, sistem türü saptanamadı. Başlangıç: Set-Cookie'de sözdizimi hatası: %2$d. konumda %1$s. İsim çözümlemesinde geçici bir hata oluştuSunucu oturum açmayı reddetti. Uzunlukları aynı değil (bizdeki %s), -- alınıyor. Uzunlukları aynı değil (bizdeki %s), -- alınıyor. %s adresine güvenliği gözardı ederek bağlanmak için `--no-check-certificate' seçeneğini kullanın. Daha fazla seçenek için `%s --help' yazın. SSL bağlantısı kurulamıyor. Kimlik tanımlama şeması bilinmiyor. Hata anlaşılamadıBilinmeyen makineTür `%c' bilinmiyor, kontrol bağlantısı kapatılıyor. Desteklenmeyen listeleme türü, Unix liste çözümleyici deneniyor. IPv6 sayısal adresi sonlandırılmamışKullanım: %s NETRC [MAKİNA-ADI] Kullanımı: %s [SEÇENEK]... [URL]... DİKKATDİKKAT: rasgele sayı üreteci yeterli değil. Uyarı: HTTP ile genel arama karakterleri kullanılamaz. %d derinliğindeki dizinler alınamayacak (en çok %d) Yazma başarısız, kontrol bağlantısı kapatılıyor. bağlantı kuruldu. bağlanılamadı: %s:%d: %s tamam. tamam. tamam. olmadı: %s. olmadı: Makinenin bir IPv4/IPv6 adresi yok. olmadı: zamanaşımı. yoksayıldıbirşey yapılmadı. zaman bilinmiyor belirtilmeyen0707010005a6da000041ed0000000000000000000000034fa8aa6600000000000000b500010002ffffffffffffffff0000001f00000000root/usr/local/share/locale/sk0707010005a6db000041ed0000000000000000000000024fa8aa6600000000000000b500010002ffffffffffffffff0000002b00000000root/usr/local/share/locale/sk/LC_MESSAGES0707010005a6dc000081a40000000000000000000000014fa8a70c0000baf5000000b500010002ffffffffffffffff0000003300000000root/usr/local/share/locale/sk/LC_MESSAGES/wget.mol 0!:1!l!(!!;!%!7"S"Q#>`#M#E#93$Bm$$MC%}%I&EY&M&M&I;'O'9'N(5^(@(:(6)NG)E)N)N+*>z*F*I+FJ+<+I+2,>K,@,Q,7-DU-<->-I.M`.K..>/2/=/D90;~0;0P0XG1?1N1I/2Qy2N2F3Ca3>3~3:c4M4E4Q2595 555I56666At7A7P7rI8M8O 97Z9G9@9I:Ie:?:s::c;;;@;P<8l<D<J<A5=Aw=6=;=M,>Bz>>>,>L)?sv?M?K8@A@<@IAHMA3ANA0B8JBOB?BBCAVC"C$C'C3DF<wF/FFGG";Gb^GGGG=HYHuH'H(HH!HI$7I#\I,I5I*I)J.8J6gJ;JJ2J%K>K\KxKMK,K,L'1L-YL L(L(L7L&2M#YM}MMMM MMMFMDNYN'pNNNN-N<NWtWWW7WW'X(X4:X8oXX XX YY*YYY YYZZ8.ZgZJ}ZZZZ[[.[I[a[s[[5[ [[\'\ >\=I\\\+\\]]-)]bW]N]E ^O^8e^"^;^ ^) _ 4_B_ S_&____+_<_ `2%` X`-b`/`$``+a3.aba1}a2a,a;b"Kbnb$bbb b bb/c6@cwc!cccc d|dXd#d* e7e3@e*te"eee e#eff !f +f)8fbfvfff ffff ggEh i,$iQiLbi!i7i jkj7kQWkIk>kO2ll\AmmK%nYqn[nS'oM{o[o=%p\cpQp@q>SqRqeqMKrZrWrSLsPsTsNFtOt@t9&uS`ucuMv7fvDv<vC wFdwSwNwNxJx?-yAmyKy@yUZχQ*G|DĈ: <DXJډ>%3dlWJE-:sNK>Ie5?$[d@GDI.*47U ^k % ې,!&/H3x85-"@1c&@JBH$ ѓ"h'|ÔS!7"Y-|7#$">%a"2)ݖ++3O_V-;4,p#ߘn(^(&)י&'('PHx1)9U Y fr Lޛ4I`!s7N͜$$A=f+Н,(4D4y1 Q_x'()&,P}E1֠A%J'p */ݡ +!3M'&7 /D&t$$ '47.l ..ؤ0Mli&֥?] lz' Bܦ 2S>d4DKW ?ީ #@[t/+Q[ɫ & 3Pj&;  #*Nlt(%F5l&ɮ 5r'WC6CT*Hð 3Rd)б4IaH{ IJKв/%L!r$;45H#~E*'-U"m1͵88'R)z#*ȶ sK1J|M9Ӹ< 7J (Ź ͹ ׹+"4Q n5zĺֺ7R*tI Mn]XmAj.E O#Zv/^11[4+dETZi)}\" fo%:5c3|!gF+J@(' 9L3K$LwN8lGp>zn60C\B^K,wmh9Q_pb[SB@k}=2*?q7u4 za#xQFhSrb_dTJ Y]2!O{Ri;H eel&kP),tD85gMy-UIC0> W?<&(|VHsfU~~'aq{ -X:.6`y%"o`rGAWsY VN<=c/vD jxu $;P The file is already fully retrieved; nothing to do. %*s[ skipping %sK ] %s received, redirecting output to %s. %s received. Originally written by Hrvoje Niksic . REST failed, starting from scratch. --ask-password prompt for passwords. --auth-no-challenge send Basic HTTP authentication information without first waiting for the server's challenge. --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host. --ca-certificate=FILE file with the bundle of CA's. --ca-directory=DIR directory where hash list of CA's is stored. --certificate-type=TYPE client certificate type, PEM or DER. --certificate=FILE client certificate file. --connect-timeout=SECS set the connect timeout to SECS. --content-disposition honor the Content-Disposition header when choosing local file names (EXPERIMENTAL). --cut-dirs=NUMBER ignore NUMBER remote directory components. --default-page=NAME Change the default page name (normally this is `index.html'.). --delete-after delete files locally after downloading them. --dns-timeout=SECS set the DNS lookup timeout to SECS. --egd-file=FILE file naming the EGD socket with random data. --exclude-domains=LIST comma-separated list of rejected domains. --follow-ftp follow FTP links from HTML documents. --follow-tags=LIST comma-separated list of followed HTML tags. --ftp-password=PASS set ftp password to PASS. --ftp-stmlf Use Stream_LF format for all binary FTP files. --ftp-user=USER set ftp user to USER. --header=STRING insert STRING among the headers. --http-password=PASS set http password to PASS. --http-user=USER set http user to USER. --ignore-case ignore case when matching files/directories. --ignore-length ignore `Content-Length' header field. --ignore-tags=LIST comma-separated list of ignored HTML tags. --keep-session-cookies load and save session (non-permanent) cookies. --limit-rate=RATE limit download rate to RATE. --load-cookies=FILE load cookies from FILE before session. --local-encoding=ENC use ENC as the local encoding for IRIs. --max-redirect maximum redirections allowed per page. --no-cache disallow server-cached data. --no-check-certificate don't validate the server's certificate. --no-cookies don't use cookies. --no-dns-cache disable caching DNS lookups. --no-glob turn off FTP file name globbing. --no-http-keep-alive disable HTTP keep-alive (persistent connections). --no-iri turn off IRI support. --no-passive-ftp disable the "passive" transfer mode. --no-proxy explicitly turn off proxy. --no-remove-listing don't remove `.listing' files. --password=PASS set both ftp and http password to PASS. --post-data=STRING use the POST method; send STRING as the data. --post-file=FILE use the POST method; send contents of FILE. --prefer-family=FAMILY connect first to addresses of specified family, one of IPv6, IPv4, or none. --private-key-type=TYPE private key type, PEM or DER. --private-key=FILE private key file. --progress=TYPE select progress gauge type. --protocol-directories use protocol name in directories. --proxy-password=PASS set PASS as proxy password. --proxy-user=USER set USER as proxy username. --random-file=FILE file with random data for seeding the SSL PRNG. --random-wait wait from 0.5*WAIT...1.5*WAIT secs between retrievals. --read-timeout=SECS set the read timeout to SECS. --referer=URL include `Referer: URL' header in HTTP request. --remote-encoding=ENC use ENC as the default remote encoding. --restrict-file-names=OS restrict chars in file names to ones OS allows. --retr-symlinks when recursing, get linked-to files (not dir). --retry-connrefused retry even if connection is refused. --save-cookies=FILE save cookies to FILE after session. --save-headers save the HTTP headers to file. --secure-protocol=PR choose secure protocol, one of auto, SSLv2, SSLv3, and TLSv1. --spider don't download anything. --strict-comments turn on strict (SGML) handling of HTML comments. --user=USER set both ftp and http user to USER. --waitretry=SECONDS wait 1..SECONDS between retries of a retrieval. --wdebug print Watt-32 debug output. %s (env) %s (system) %s (user) %s: certificate common name %s doesn't match requested host name %s. %s: certificate common name is invalid (contains a NUL character). This may be an indication that the host is not who it claims to be (that is, it is not the real %s). in --no-use-server-timestamps don't set the local file's timestamp by the one on the server. -4, --inet4-only connect only to IPv4 addresses. -6, --inet6-only connect only to IPv6 addresses. -A, --accept=LIST comma-separated list of accepted extensions. -B, --base=URL resolves HTML input-file links (-i -F) relative to URL. -D, --domains=LIST comma-separated list of accepted domains. -E, --adjust-extension save HTML/CSS documents with proper extensions. -F, --force-html treat input file as HTML. -H, --span-hosts go to foreign hosts when recursive. -I, --include-directories=LIST list of allowed directories. -K, --backup-converted before converting file X, back up as X.orig. -K, --backup-converted before converting file X, back up as X_orig. -L, --relative follow relative links only. -N, --timestamping don't re-retrieve files unless newer than local. -O, --output-document=FILE write documents to FILE. -P, --directory-prefix=PREFIX save files to PREFIX/... -Q, --quota=NUMBER set retrieval quota to NUMBER. -R, --reject=LIST comma-separated list of rejected extensions. -S, --server-response print server response. -T, --timeout=SECONDS set all timeout values to SECONDS. -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION. -V, --version display the version of Wget and exit. -X, --exclude-directories=LIST list of excluded directories. -a, --append-output=FILE append messages to FILE. -b, --background go to background after startup. -c, --continue resume getting a partially-downloaded file. -d, --debug print lots of debugging information. -e, --execute=COMMAND execute a `.wgetrc'-style command. -h, --help print this help. -i, --input-file=FILE download URLs found in local or external FILE. -k, --convert-links make links in downloaded HTML or CSS point to local files. -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite). -m, --mirror shortcut for -N -r -l inf --no-remove-listing. -nH, --no-host-directories don't create host directories. -nd, --no-directories don't create directories. -np, --no-parent don't ascend to the parent directory. -nv, --no-verbose turn off verboseness, without being quiet. -o, --output-file=FILE log messages to FILE. -p, --page-requisites get all images, etc. needed to display HTML page. -q, --quiet quiet (no output). -r, --recursive specify recursive download. -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). -v, --verbose be verbose (this is the default). -w, --wait=SECONDS wait SECONDS between retrievals. -x, --force-directories force creation of directories. Issued certificate has expired. Issued certificate not yet valid. Self-signed certificate encountered. Unable to locally verify the issuer's authority. eta %s (%s bytes) (unauthoritative) [following]%d redirections exceeded. %s %s (%s) - %s saved [%s/%s] %s (%s) - %s saved [%s] %s (%s) - Connection closed at byte %s. %s (%s) - Data connection: %s; %s (%s) - Read error at byte %s (%s).%s (%s) - Read error at byte %s/%s (%s). %s (%s) - written to stdout %s[%s/%s] %s (%s) - written to stdout %s[%s] %s ERROR %d: %s. %s URL: %s %2d %s %s has sprung into existence. %s request sent, awaiting response... %s: %s, closing control connection. %s: %s: Failed to allocate %ld bytes; memory exhausted. %s: %s: Failed to allocate enough memory; memory exhausted. %s: %s: Invalid boolean %s; use `on' or `off'. %s: %s: Invalid byte value %s %s: %s: Invalid header %s. %s: %s: Invalid number %s. %s: %s: Invalid progress type %s. %s: %s: Invalid restriction %s, use [unix|windows],[lowercase|uppercase],[nocontrol],[ascii]. %s: %s: Invalid time period %s %s: %s: Invalid value %s. %s: %s:%d: unknown token "%s" %s: %s:%d: warning: %s token appears before any machine name %s: %s; disabling logging. %s: Cannot read %s (%s). %s: Cannot resolve incomplete link %s. %s: Couldn't find usable socket driver. %s: Error in %s at line %d. %s: Invalid --execute command %s %s: Invalid URL %s: %s %s: No certificate presented by %s. %s: Syntax error in %s at line %d. %s: The certificate of %s has been revoked. %s: The certificate of %s hasn't got a known issuer. %s: The certificate of %s is not trusted. %s: Unknown command %s in %s at line %d. %s: WGETRC points to %s, which doesn't exist. %s: Warning: Both system and user wgetrc point to %s. %s: aprintf: text buffer is too big (%ld bytes), aborting. %s: cannot stat %s: %s %s: cannot verify %s's certificate, issued by %s: %s: corrupt time-stamp. %s: illegal option -- `-n%c' %s: invalid option -- '%c' %s: missing URL %s: no certificate subject alternative name matches requested host name %s. %s: option '%c%s' doesn't allow an argument %s: option '--%s' doesn't allow an argument %s: option '--%s' requires an argument %s: option '-W %s' doesn't allow an argument %s: option '-W %s' is ambiguous %s: option '-W %s' requires an argument %s: option requires an argument -- '%c' %s: unable to resolve bind address %s; disabling bind. %s: unable to resolve host address %s %s: unknown/unsupported file type. %s: unrecognized option '%c%s' %s: unrecognized option '--%s' '(no description)(try:%2d), %s (%s) remaining, %s remaining-k can be used together with -O only if outputting to a regular file. ==> CWD not needed. ==> CWD not required. Already have correct symlink %s -> %s Authorization failed. Bad port numberBind error (%s). Can't be verbose and quiet at the same time. Can't timestamp and not clobber old files at the same time. Cannot back up %s as %s: %s Cannot convert links in %s: %s Cannot get REALTIME clock frequency: %s Cannot initiate PASV transfer. Cannot open %s: %sCannot open cookies file %s: %s Cannot parse PASV response. Cannot specify both --ask-password and --password. Cannot specify both --inet4-only and --inet6-only. Cannot specify both -k and -O if multiple URLs are given, or in combination with -p or -r. See the manual for details. Cannot write to %s (%s). Compile: Connecting to %s:%d... Connecting to %s|%s|:%d... Continuing in background, pid %d. Continuing in background, pid %lu. Continuing in background. Control connection closed. Conversion from %s to %s isn't supported Converted %d files in %s seconds. Converting %s... Cookie coming from %s attempted to set domain to %s Copyright (C) 2009 Free Software Foundation, Inc. Could not seed PRNG; consider using --random-file. Creating symlink %s -> %s Data transfer aborted. Directories: Directory Disabling SSL due to encountered errors. Download quota of %s EXCEEDED! Download: ERRORERROR: Cannot open directory %s. ERROR: Redirection (%d) without location. Encoding %s isn't valid Error closing %s: %s Error in proxy URL %s: Must be HTTP. Error in server greeting. Error in server response, closing control connection. Error initializing X509 certificate: %s Error matching %s against %s: %s Error parsing certificate: %s Error parsing proxy URL %s: %s. Error writing to %s: %s FTP options: Failed reading proxy response: %s Failed to unlink symlink %s: %s Failed writing HTTP request: %s. File File %s already there; not retrieving. File %s already there; not retrieving. File %s exists. File `%s' already there; not retrieving. File has already been retrieved. Found %d broken link. Found %d broken links. Found no broken links. GNU Wget %s built on %s. GNU Wget %s, a non-interactive network retriever. Giving up. HTTP options: HTTPS (SSL/TLS) options: HTTPS support not compiled inIPv6 addresses not supportedIncomplete or invalid multibyte sequence encountered Index of /%s on %s:%dInvalid IPv6 numeric addressInvalid PORT. Invalid dot style specification %s; leaving unchanged. Invalid host nameInvalid name of the symlink, skipping. Invalid user nameLast-modified header invalid -- time-stamp ignored. Last-modified header missing -- time-stamps turned off. Length: Length: %sLicense GPLv3+: GNU GPL version 3 or later . This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. Link Link: Loading robots.txt; please ignore errors. Locale: Location: %s%s Logged in! Logging and input file: Logging in as %s ... Login incorrect. Mail bug reports and suggestions to . Malformed status lineMandatory arguments to long options are mandatory for short options too. No URLs found in %s. No certificate found No data received. No errorNo headers, assuming HTTP/0.9No matches on pattern %s. No such directory %s. No such file %s. No such file %s. No such file or directory %s. Not descending to %s as it is excluded/not-included. Not sure Output will be written to %s. POST data file %s missing: %s Password for user %s: Password: Please send bug reports and questions to . Proxy tunneling failed: %sRead error (%s) in headers. Recursion depth %d exceeded max. depth %d. Recursive accept/reject: Recursive download: Rejecting %s. Remote file does not exist -- broken link!!! Remote file exists and could contain further links, but recursion is disabled -- not retrieving. Remote file exists and could contain links to other resources -- retrieving. Remote file exists but does not contain any link -- not retrieving. Remote file exists. Remote file is newer than local file %s -- retrieving. Remote file is newer, retrieving. Remote file no newer than local file %s -- not retrieving. Removed %s. Removing %s since it should be rejected. Removing %s. Resolving %s... Retrying. Reusing existing connection to %s:%d. Saving to: %s Scheme missingServer error, can't determine system type. Server file no newer than local file %s -- not retrieving. Skipping directory %s. Spider mode enabled. Check if remote file exists. Startup: Symlinks not supported, skipping symlink %s. Syntax error in Set-Cookie: %s at position %d. Temporary failure in name resolutionThe certificate has expired The certificate has not yet been activated The certificate's owner does not match hostname %s The server refuses login. The sizes do not match (local %s) -- retrieving. The sizes do not match (local %s) -- retrieving. This version does not have support for IRIs To connect to %s insecurely, use `--no-check-certificate'. Try `%s --help' for more options. Unable to delete %s: %s Unable to establish SSL connection. Unhandled errno %d Unknown authentication scheme. Unknown errorUnknown hostUnknown system errorUnknown type `%c', closing control connection. Unsupported listing type, trying Unix listing parser. Unsupported scheme %sUnterminated IPv6 numeric addressUsage: %s NETRC [HOSTNAME] Usage: %s [OPTION]... [URL]... Using %s as listing tmp file. WARNINGWARNING: combining -O with -r or -p will mean that all downloaded content will be placed in the single file you specified. WARNING: timestamping does nothing in combination with -O. See the manual for details. WARNING: using a weak random seed. Warning: wildcards not supported in HTTP. Wgetrc: Will not retrieve dirs since depth is %d (max %d). Write failed, closing control connection. Wrote HTML-ized index to %s [%s]. Wrote HTML-ized index to %s. `connected. couldn't connect to %s port %d: %s done. done. done. failed: %s. failed: No IPv4/IPv6 addresses for host. failed: timed out. idn_decode failed (%d): %s idn_encode failed (%d): %s ignoredlocale_to_utf8: locale is unset memory exhaustednothing to do. time unknown unspecifiedProject-Id-Version: GNU wget 1.12-pre7 Report-Msgid-Bugs-To: bug-wget@gnu.org POT-Creation-Date: 2011-09-13 10:17+0200 PO-Revision-Date: 2010-08-09 23:23+0200 Last-Translator: Marcel Telka Language-Team: Slovak Language: sk MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8-bit Plural-Forms: nplurals=3; plural= (n==1) ? 1 : (n>=2 && n<=4) ? 2 : 0; Tento súbor je už kompletne prenesený; netreba nič robiť. %*s[ preskakujem %sK ] %s prijaté, presmerovávam výstup do %s. %s prijatých. Pôvodným autorom tohoto programu je Hrvoje Nikšić REST zlyhal, začínam odznova. --ask-password pýtať sa na heslá. --auth-no-challenge poslať informáciu o základnom overení totožnosti HTTP bez počiatočného čakania na výzvu servera. --bind-address=ADRESA zviazať s ADRESOU (názov hostiteľa alebo IP) na miestnom hostiteľovi. --ca-certificate=SÚBOR súbor s balíkom CA. --ca-directory=ADR adresár, kde je uložený hašovaný zoznam CA. --certificate-type=TYP typ certifikátu klienta, PEM alebo DER. --certificate=SÚBOR súbor certifikátu klienta. --connect-timeout=SEKUNDY nastaviť časový limit spojenia na SEKUNDY. --content-disposition dodržať hlavičku Content-Disposition pri voľbe miestnych názvov súborov (EXPERIMENTÁLNE). --cur-dirs=POČET ignorovať POČET vzdialených častí názvu adresára. --default-page=NÁZOV Zmeniť názov predvolenej stránky (štandardne je to `index.html'.). --delete-after odstrániť miestne súbory po ich stiahnutí. --dns-timeout=SEKUNDY nastaviť časový limit DNS vyhľadávania na SEKUNDY. --egd-file=SÚBOR súbor s pomenovaním EGD zásuvky s náhodnými dátami. --exclude-domains=ZOZNAM čiarkou oddelený zoznam odmietnutých domén. --follow-ftp nasledovať FTP odkazy z HTML dokumentov. --follow-tags=ZOZNAM čiarkou oddelený zoznam nasledovaných HTML značiek. --ftp-password=HESLO nastaviť ftp heslo na HESLO. --ftp-stmlf Použiť formát Stream_LF pre všetky binárne súbory FTP. --ftp-user=POUŽÍVATEĽ nastaviť ftp používateľa na POUŽÍVATEĽ. --header=REŤAZEC vložiť REŤAZEC do hlavičky. --http-password=HESLO nastaviť http heslo na HESLO. --http-user=POUŽÍVATEĽ nastaviť http používateľa na POUŽÍVATEĽ. --ignore-case ignorovať veľkosť písmen pri porovnávaní súborov/adresárov. --ignore-length ignorovať pole `Content-Length' v hlavičke. --ignore-tags=ZOZNAM čiarkou oddelený zoznam ignorovaných HTML značiek. --keep-session-cookies načítať a uložiť koláčiky sedenia (nie trvalé). --limit-rate=RÝCHLOSŤ obmedziť rýchlosť sťahovania na RÝCHLOSŤ. --load-cookies=SÚBOR načítať koláčiky zo SÚBORu pred sedením. --local-encoding=KÓD použiť KÓD ako ako miestne kódovanie pre IRI. --max-redirect maximum povolených presmerovaní na stránku. --no-cache nepovoliť dočasne uložené dáta na serveri. --no-check-certificate noverovať certifikát servera. --no-cookies nepoužívať koláčiky. --no-dns-cache zakázať dočasné ukladanie DNS vyhľadávania. --no-glob pri FTP vypnúť používanie divokých znakov v názvoch súborov. --no-http-keep-alive zakázať HTTP keep-alive (trvalé spojenia). --no-iri vypnúť podporu IRI. --no-passive-ftp zakázať "pasívny" režim prenosu. --no-proxy explicitne vypnúť proxy. --no-remove-listing neodstraňovať súbory `.listing'. --password=HESLO nastaviť ftp a http heslo na HESLO. --post-data=REŤAZEC použiť POST metódu; poslať REŤAZEC ako dáta. --post-file=SÚBOR použiť POST metódu; poslať obsah SÚBORu. --prefer-family=RODINA pripájať sa najskôr k adresám zadanej rodiny, jedno z IPv6, IPv4 alebo none. --private-key-type=TYP typ súkromného kľúča, PEM alebo DER. --private-key=SÚBOR súbor súkromného kľúča. --progress=TYP zvoliť typ zobrazenia postupu. --protocol-directories použiť názov protokolu v adresároch. --proxy-password=HESLO nastaviť HESLO ako heslo proxy. --proxy-user=POUŽÍVATEĽ nastaviť POUŽÍVATEĽa ako používateľa proxy. --random-file=SÚBOR súbor s náhodnými dátami, pre spustenie SSL PRNG. --random-wait počkať od 0,5 × POČKAŤ ... 1,5 × POČKAŤ sekúnd medzi sťahovaniami. --read-timeout=SEKUNDY nastaviť časový limit čítania na SEKUNDY. --referer=URL zahrnúť hlavičku `Referer: URL' do HTTP požiadavky. --remote-encoding=KÓD použiť KÓD ako predvolené vzdialené kódovanie. --restrict-file-names=OS obmedziť znaky v názvoch súborov na tie, ktoré povoľuje OS. --retr-symlinks pri rekurzii získať spojené súbory (nie adresáre). --retry-connrefused pokús sa znova, aj keď bolo spojenie odmietnuté. --save-cookies=SÚBOR uložiť koláčiky do SÚBORu po sedení. --save-headers uložiť HTTP hlavičky do súboru. --secure-protocol=PR vybrať bezpečný protokol, jeden z auto, SSLv2, SSLv3 alebo TLSv1. --spider nesťahovať nič. --strict-comments zapnúť striktné (SGML) spracovávanie HTML komentárov. --user=POUŽÍVATEĽ nastaviť ftp a http používateľov na POUŽÍVATEĽ. --waitretry=SEKÚND počkať 1..SEKÚND medzi pokusmi o sťahovanie. --wdebug vytlačiť ladiaci výstup Watt-32. %s (prostredie) %s (systém) %s (používateľ) %s: bežný názov %s v certifikáte sa nezhoduje s požadovaným názvom hostiteľa %s. %s: bežný názov v certifikáte je neplatný (obsahuje znak NUL). To môže byť znamením toho, že hostiteľ nie je tým, za koho sa vydáva (to znamená, nie je to reálne %s). za --no-use-server-timestamps nenastavovať časové značky miestnych súborov podľa toho ako sú na serveri. -4, --inet4-only pripájať sa len na adresy IPv4. -6, --inet6-only pripájať sa len na adresy IPv6. -A, --accept=ZOZNAM čiarkou oddelený zoznam akceptovaných prípon. -B, --base=URL prevedie HTML odkazy vstupného súboru (-i -F) relatívne k URL. -D, --domains=ZOZNAM čiarkou oddelený zoznam akceptovaných domén. -E, --html-extension uložiť HTML/CSS dokumenty so správnou príponou. -F, --force-html spracovať vstupný súbor ako HTML. -H, --span-hosts prejsť na cudzích hostiteľov pri rekurzii. -I, --include-directories=ZOZNAM zoznam povolených adresárov. -K, --backup-converted pred konverziou súboru X, zazálohovať ho ako X.orig. -K, --backup-converted pred konverziou súboru X, zazálohovať ho ako X_orig. -L, --relative nasledovať len relatívne odkazy. -N, --timestamping nesťahovať opäť súbory, iba ak sú novšie ako miestne. -O, --output-document=SÚBOR zapísať dokumenty do SÚBORu. -P, --directory-prefix=PREDP uložiť súbory do PREDP/... -Q, --quota=ČÍSLO nastaviť limit sťahovania na ČÍSLO. -R, --reject=ZOZNAM čiarkou oddelený zoznam odmietnutých prípon. -S, --server-response vytlačiť odpoveď servera. -T, --timeout=SEKUNDY nastaviť všetky hodnoty časových limitov na SEKUNDY. -U, --user-agent=AGENT identifikovať sa ako AGENT namiesto Wget/VERZIA. -V, --version zobraziť verziu programu Wget a skončiť. -X, --exclude-directories=ZOZNAM zoznam vynechaných adresárov. -a, --append-output=SÚBOR pridať správy do SÚBORu. -b, --background prejsť do pozadia po spustení. -c, --continue obnoviť získavanie čiastočne stiahnutého súboru. -d, --debug vytlačiť množstvo ladiacich informácií. -e, --execute=PRÍKAZ vykonať príkaz štýlu .wgetrc. -h, --help vytlačiť túto pomoc. -i, --input-file=SÚBOR stiahnuť URL, ktoré sa nachádzajú v miestnom alebo externom SÚBORe. -k, --convert-links zmeniť odkazy v stiahnutých HTML a CSS tak, aby ukazovaly na miestne súbory. -l, --level=ČÍSLO maximálna hĺbka rekurzie (inf alebo 0 pre nekonečno). -m, --mirror skratka pre -N -r -l inf --no-remove-listing. -nH, --no-host-directories nevytvárať adresáre hostiteľa. -nd, --no-directories nevytvárať adresáre. -np, --no-parent nevystupovať do rodičovského adresára. -nv, --no-verbose vypnúť táravosť bez toho, aby bolo ticho. -o, --output-file=SÚBOR zaznamenať správy do SÚBORu. -p, --page-requisites získaž všetky obrázky, atď. potrebné pre zobrazenie HTML stránky. -q, --quiet potichu (bez výstupu). -r, --recursive nastaviť rekurzívne sťahovanie. -t, --tries=ČÍSLO nastaviť počet opakovaní na ČÍSLO (0 neobmedzene). -v, --verbose byť táravý (toto je štandard). -w, --wait=SEKUNDY počkať SEKUNDY medzi sťahovaniami. -x, --force-directories vynútiť vytváranie adresárov. Vydanému certifikátu vypršala platnosť. Vydaný certifikát je ešte neplatný. Vyskytol sa certifikát podpísaný samým sebou. Nie je možné miestne overiť autoritu vydavateľa. odh %s (%s bajtov) (nie je smerodajné) [nasledujem]Prekročený limit %d presmerovaní. %s %s (%s) - %s uložené [%s/%s] %s (%s) - %s uložený [%s] %s (%s) - Spojenie uzatvorené na bajte %s. %s (%s) - Dátové spojenie: %s; %s (%s) - Chyba pri čítaní na bajte %s (%s).%s (%s) - Chyba pri čítaní na bajte %s/%s (%s). %s (%s) - zapísané na štandardný výstup %s[%s/%s] %s (%s) - zapísané na štandardný výstup %s[%s] %s CHYBA %d: %s. %s URL: %s %2d %s %s bol odpružený do existencie. %s požiadavka odoslaná, čakám na odpoveď... %s: %s, uzatváram riadiace spojenie. %s: %s: Zlyhalo vyžiadanie %ld bajtov; pamäť je vyčerpaná. %s: %s: Zlyhalo vyžiadanie dostatočnej pamäte; pamäť je vyčerpaná. %s: %s: Neplatná logická hodnota %s; použite `on' alebo `off'. %s: %s: Neplatná hodnota bajtu %s. %s: %s: Neplatná hlavička %s. %s: %s: Neplatné číslo %s. %s: %s: Neplatný typ postupu %s. %s: %s: Neplatné obmedzenie %s, použite [unix|windows],[lowercase|uppercase],[nocontrol],[ascii]. %s: %s: Neplatný časový interval %s %s: %s: Neplatná hodnota %s. %s: %s:%d: neznámy token "%s" %s: %s:%d: upozornenie: token %s je uvedený pred akýmkoľvek názvom počítača %s: %s; vypínam protokolovanie. %s: Nemožno prečítať %s (%s). %s: Nemôžem rozložiť neúplný odkaz %s. %s: Nemôžem nájsť použiteľný ovládač soketov. %s: Chyba v %s na riadku %d. %s: Neplatný príkaz --execute %s %s: Neplatné URL %s: %s %s: %s neprezentoval certifikát. %s: Chyba syntaxe v %s na riadku %d. %s: Certifikát %s bol zrušený. %s: Certifikát %s nedostal známeho vydavateľa. %s: Certifikát %s nie je dôveryhodný. %s: Neznámy príkaz %s v %s na riadku %d. %s: WGETRC ukazuje na %s a ten neexistuje. %s: Upozornenie: Systémový aj používateľov súbor wgetrc úkazujú na %s. %s: aprintf: pamäť na text je príliš veľká (%ld bajtov), predčasne ukončujem. %s: volanie `stat %s' skončilo s chybou: %s %s: nie je možné overiť certifikát pre %s, vydaný %s: %s: časové značka súboru je porušená. %s: neprípustná voľba -- `-n%c' %s: neplatná voľba -- '%c' %s: chýba URL %s: žiadny alternatívny názov predmetu v certifikáte sa nezhoduje s požadovaným názvom hostiteľa %s. %s: voľba '%c%s' nepodporuje parameter %s: voľba '--%s' nepodporuje parameter %s: voľba '--%s' vyžaduje parameter %s: voľba '-W %s' nepodporuje parameter %s: voľba '-W %s' je nejednoznačná %s: voľba '-W %s' vyžaduje parameter %s: voľba vyžaduje parameter -- '%c' %s: nepodarilo sa previesť adresu zviazania %s; deaktivujem zviazanie. %s: nepodarilo sa previesť adresu hostiteľa %s %s: neznámy/nepodporovaný typ súboru. %s: neznáma voľba '%c%s' %s: neznáma voľba '--%s' “(bez popisu)(pokus:%2d), ostáva %s (%s), ostáva %s-k môže byť použité spolu s -O len ak je výstup do bežného súboru. ==> CWD nie je potrebné. ==> CWD nie je potrebné. Korektný symbolický odkaz %s -> %s už existuje. Autorizácia zlyhala. Zlé číslo portuChyba pri operácii "bind" (%s). Nie je možné byť uhovorený a byť ticho zároveň. Nie je možné používať časové značky a nemazať pritom staré súbory. Nemôžem zálohovať %s ako %s: %s Nemôžem previesť odkazy v %s: %s Nepodarilo sa získať frekvenciu hodín reálneho času: %s Nemožno iniciovať prenos príkazom PASV. Nepodarilo sa otvoriť %s: %sNedokážem otvoriť súbor s cookie %s: %s Nemôžem analyzovať odpoveď na PASV. Nemožno zadať naraz --ask-password aj --password. Nemožno zadať naraz --inet4-only aj --inet6-only. Nemožno zadať naraz -k aj -O ak sú zadané viaceré URL, alebo v kombinácii s -p alebo -r. Podrobnosti nájdete v príručke. Nemožno zapísať do %s (%s). Kompilácia: Pripájam sa k %s:%d... Pripájam sa k %s|%s|:%d... Pokračujem v behu na pozadí, pid %d. Pokračujem v behu na pozadí, pid %lu. Pokračujem v behu na pozadí. Riadiace spojenie uzatvorené. Konverzia z %s do %s nie je podporovaná Skonvertovaných %d súborov za %s sekúnd. Konvertujem %s... Koláčiky prichádzajúce z %s sa pokúsili nastaviť doménu na %s Copyright © 2009 Free Software Foundation, Inc. Nemôžem inicializovať PRNG; zvážte použitie --random-file. Vytváram symbolický odkaz %s -> %s Prenos dát bol predčasne ukončený. Adresáre: Adresár Deaktivujem SSL z dôvodu výskytu chýb. Limit objemu stiahnutych dát %s PREKROČENÝ! Sťahovanie: CHYBACHYBA: Nepodarilo sa otvoriť adresár %s. CHYBA: Presmerovanie (%d) bez udanej novej adresy. Kódovanie %s nie je platné Chyba pri zatváraní %s: %s Chyba v proxy URL %s: Musí byť HTTP. Úvodná odpoveď servera je chybná. Server odpovedal chybne, uzatváram riadiace spojenie. Chyba pri inicializácii certifikátu X509: %s Chyba pri hľadaní zhody %s s %s: %s Chyba pri analýze certifikátu: %s Chyba pri analýze proxy URL %s: %s Chyba pri zápise do %s: %s FTP voľby: Zlyhalo čítanie odpovede z proxy: %s Nebolo možné odstrániť symbolický odkaz %s: %s Požiadavku HTTP nebolo možné odoslať: %s. Súbor Súbor %s je už tam, nebudem ho prenášať. Súbor %s je už tam, nebudem ho prenášať. Súbor %s existuje. Súbor `%s' je už tam, nebudem ho prenášať. Súbor už bol prenesený. Nájdených %d poškodených odkazov. Nájdený %d poškodený odkaz. Nájdené %d poškodené odkazy. Neboli nájdené poškodené odkazy. GNU Wget %s zostavený na %s. GNU Wget %s, program pre neinteraktívne sťahovanie súborov. Vzdávam to. HTTP voľby: Voľby HTTPS (SSL/TLS): Podpora pre HTTPS nie je zakompilovanáIPv6 adresy nie sú podporovanéVyskytla sa nekompletná alebo neplatná viacbajtová postupnosť Obsah /%s na %s:%dNeplatná číselná adresa IPv6Neplatný PORT. Neplatná bodková špecifikácia %s; ponechávam nezmenené. Neplatný názov hostiteľaNeplatný názov symoblického odkazu, preskakujem. Neplatné meno používateľaHlavička Last-modified je neplatná -- ignorujem časové značky. Hlavička Last-modified chýba -- nebudú sa používať časové značky. Dĺžka: Dĺžka: %sLicencia GPLv3+: GNU GPL verzia 3 alebo novšia . Toto je slobodný softvér: môžete ho ľubovoľne meniť a distribuovať. BEZ ZÁRUKY v rozsahu povolenom zákonom. Sym. odkaz Odkaz: Načítavam robots.txt. Chybové hlásenia ignorujte, prosím. Národné prostredie: Presmerované na: %s%s Prihlásený! Zaznamenávanie a vstupný súbor: Prihlasujem sa ako %s ... Chyba pri prihlásení. Správy o chybách a návrhy na vylepšenie zasielajte na adresu (iba anglicky). Komentáre k slovenskému prekladu zasielajte na adresu . Odpoveď servera má skomolený stavový riadokParametre povinné pri dlhých voľbách sú povinné aj pre skrátené voľby. V %s neboli nájdené URL. Certifikát nenájdený Neboli prijaté žiadne dáta. Bez chybyBez hlavičiek, predpokladám HTTP/0.9Vzoru %s nič nezodpovedá. Adresár %s neexistuje. Súbor %s neexistuje. Súbor %s neexistuje. Súbor alebo adresár %s neexistuje. Nezostupujem do %s, pretože je vylúčený/nezačlenený. Neznámy typ Výstup bude zapísaný do %s. Chýba POST dátový súbor %s: %s Heslo pre používateľa %s: Heslo: Hlásenia o chybách a otázky zasielajte, prosím, na adresu (iba anglicky). Komentáre k slovenskému prekladu zasielajte na adresu . Tunelovanie proxy zlyhalo: %sChyba (%s) pri čítaní hlavičiek. Hĺbka rekurzie %d prekročila maximálnu hĺbku %d. Rekurzívne akceptovanie/odmietnutie: Rekurzívne sťahovanie: Odmietam %s. Vzdialený súbor neexistuje -- poškodený odkaz!!! Vzdialený súbor existuje a mohol by obsahovať ďalšie odkazy, ale rekurzia nie je povolená -- neprenášam. Vzdialený súbor existuje a mohol by obsahovať odkazy na iné zdroje -- prenášam. Vzdialený súbor, ale neobsahuje žiadne odkazy -- neprenášam. Vzdialený súbor existuje. Vzdialený súbor je novší ako miestny súbor %s -- prenášam. Vzdialený súbor je novší, prenášam. Vzdialený súbor nie je novší ako miestny súbor %s -- neprenášam. Odstránené %s. Odstraňujem %s, pretože by mal byť odmietnutý. Odstraňujem %s. Prevádzam %s na IP adresu... Skúšam znova. Používam existujúce spojenie s %s:%d. Ukladám do: %s Chýba schémy %sChyba servera, nie je možné zistiť typ systému. Súbor na serveri nie je novší ako miestny súbor %s -- neprenášam. Preskakujem adresár %s. Povolený režim pavúka. Skontrolujte, či vzdialený súbor existuje. Spustenie: Symbolické odkazy nie sú podporované, preskakujem symbolický odkaz %s. Chyba syntaxe v Set-Cookie: %s na pozícii %d. Dočasné zlyhanie pri prevode názvuCertifikátu vypršala platnosť Certifikát ešte nebol aktivovaný Majiteľ certifikátu sa nezhoduje s názvom hostiteľa %s Server odmieta prihlásenie. Veľkosti se nezhodujú (miestny %s) -- prenášam. Veľkosti se nezhodujú (miestny %s) -- prenášam. Táto verzia nemá podporu pre IRI Na nie bezpečné pripojenie k %s použite `--no-check-certificate'. Príkaz `%s --help' vypíše viac volieb. Nemôžem zmazať %s: %s Nepodarilo sa nadviazať SSL spojenie. Nespracované errno %d Neznámy spôsob autentifikácie. Neznáma chybaNeznámy hostiteľNeznáma systémová chybaNeznámy typ `%c', uzatváram riadiace spojenie. Nepodporovaný typ výpisu, skúša sa unixový parser. Nepodporovaná schéma %sNeukončená číselná adresa pre IPv6Použitie: %s NETRC [NÁZOV_POČÍTAČA] Použitie: %s [VOĽBA]... [URL]... Použiť %s ako dočasný súbor zoznamu. UPOZORNENIEUPOZORNENIE: kombinácia -O s -r alebo -p bude znamenať, že celý stiahnutý obsah bude umiestnený do jedného vami zadaného súboru. UPOZORNENIE: označovanie časovou značkou nerobí nič, ak je kombinované s -O. Podrobnosti nájdete v návode. UPOZORNENIE: používané slabé spúšťacie zrnko pre náhodné čísla. Upozornenie: HTTP nepodporuje žolíkové znaky. Wgetrc: Nebudem prenášať adresáre, pretože sme už v hĺbke %d (maximum je %d). Nemôžem zapísať dáta, uzatváram riadiace spojenie. Výpis adresára v HTML formáte bol zapísaný do %s [%s]. Výpis adresára v HTML formáte bol zapísaný do %s. „pripojené. nemôžem sa pripojiť k %s port %d: %s hotovo. hotovo.hotovo. zlyhalo: %s. zlyhalo: Hostiteľ nemá IPv4/IPv6 adresy. zlyhalo: časový limit vypršal. idn_decode zlyhalo (%d): %s idn_encode zlyhalo (%d): %s ignorovanélocale_to_utf8: národné prostredie je nenastavené pamäť vyčerpanániet čo robiť. čas neznámy neudané0707010005a6d1000041ed0000000000000000000000034fa8aa6600000000000000b500010002ffffffffffffffff0000002200000000root/usr/local/share/locale/pt_BR0707010005a6d2000041ed0000000000000000000000024fa8aa6600000000000000b500010002ffffffffffffffff0000002e00000000root/usr/local/share/locale/pt_BR/LC_MESSAGES0707010005a6d3000081a40000000000000000000000014fa8a70c0000bf44000000b500010002ffffffffffffffff0000003600000000root/usr/local/share/locale/pt_BR/LC_MESSAGES/wget.mol 0!:1!l!(!!;!%!7"S"Q#>`#M#E#93$Bm$$MC%}%I&EY&M&M&I;'O'9'N(5^(@(:(6)NG)E)N)N+*>z*F*I+FJ+<+I+2,>K,@,Q,7-DU-<->-I.M`.K..>/2/=/D90;~0;0P0XG1?1N1I/2Qy2N2F3Ca3>3~3:c4M4E4Q2595 555I56666At7A7P7rI8M8O 97Z9G9@9I:Ie:?:s::c;;;@;P<8l<D<J<A5=Aw=6=;=M,>Bz>>>,>L)?sv?M?K8@A@<@IAHMA3ANA0B8JBOB?BBCAVC"C$C'C3DF<wF/FFGG";Gb^GGGG=HYHuH'H(HH!HI$7I#\I,I5I*I)J.8J6gJ;JJ2J%K>K\KxKMK,K,L'1L-YL L(L(L7L&2M#YM}MMMM MMMFMDNYN'pNNNN-N<NWtWWW7WW'X(X4:X8oXX XX YY*YYY YYZZ8.ZgZJ}ZZZZ[[.[I[a[s[[5[ [[\'\ >\=I\\\+\\]]-)]bW]N]E ^O^8e^"^;^ ^) _ 4_B_ S_&____+_<_ `2%` X`-b`/`$``+a3.aba1}a2a,a;b"Kbnb$bbb b bb/c6@cwc!cccc d|dXd#d* e7e3@e*te"eee e#eff !f +f)8fbfvfff ffff ggIhi-)iWi?fi$i8ijj=3kPqkKkElQTllOemmP;n|nx ooKpNp8pq:qEq@ r;KrrN s~XszsCRtOtOtP6uGuGu1vEIvv~w;wNwB%xChxMxMxQHyyC7z:{zMzK{<P{D{x{K|w|yE}N}~~vFNE R2vEzفDT[т-CCƄ} | }CPIFiA3C҉DL[?)~iQ;:Fv9Hz@GC-GsuSkJE 9PAJ̐E];ߑ@\=F%El-ғ/C0t }!ДԔ' !3*U.40&96M'7A=&(d&#-ؗi,p!(H 1$R6w?( 4+T'&7Ϛ,/4,dQK&/FV%"Ü'f//(0&@)g+\9>T)) !N01:;NvDš- F8/5Ϣ6J<Jң(a'Ѥ("&B1i(ĥ4ץ2 N?&) ߦ 0#, P[,`*#ܧ+ ?@' #ɨ%.'=2e( -Ω.+/Aq=!ʪ G Ucs">ϫ&DZX3Ӭ>'Cf 7 "#F];yWԯ!,"Nq 4)Ͱ&##B1f< ձ.0KLS#&IJ4! BW1ggMCO;)@ U0b0ʵ A%FgFʶH#3l)ʷ%?G3e4)θG&@"g6-޹ 9<VO!!$F0e^ 29R3H,|'ѽ ս1 # -6:qþ)̾27R*tI Mn]XmAj.E O#Zv/^11[4+dETZi)}\" fo%:5c3|!gF+J@(' 9L3K$LwN8lGp>zn60C\B^K,wmh9Q_pb[SB@k}=2*?q7u4 za#xQFhSrb_dTJ Y]2!O{Ri;H eel&kP),tD85gMy-UIC0> W?<&(|VHsfU~~'aq{ -X:.6`y%"o`rGAWsY VN<=c/vD jxu $;P The file is already fully retrieved; nothing to do. %*s[ skipping %sK ] %s received, redirecting output to %s. %s received. Originally written by Hrvoje Niksic . REST failed, starting from scratch. --ask-password prompt for passwords. --auth-no-challenge send Basic HTTP authentication information without first waiting for the server's challenge. --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host. --ca-certificate=FILE file with the bundle of CA's. --ca-directory=DIR directory where hash list of CA's is stored. --certificate-type=TYPE client certificate type, PEM or DER. --certificate=FILE client certificate file. --connect-timeout=SECS set the connect timeout to SECS. --content-disposition honor the Content-Disposition header when choosing local file names (EXPERIMENTAL). --cut-dirs=NUMBER ignore NUMBER remote directory components. --default-page=NAME Change the default page name (normally this is `index.html'.). --delete-after delete files locally after downloading them. --dns-timeout=SECS set the DNS lookup timeout to SECS. --egd-file=FILE file naming the EGD socket with random data. --exclude-domains=LIST comma-separated list of rejected domains. --follow-ftp follow FTP links from HTML documents. --follow-tags=LIST comma-separated list of followed HTML tags. --ftp-password=PASS set ftp password to PASS. --ftp-stmlf Use Stream_LF format for all binary FTP files. --ftp-user=USER set ftp user to USER. --header=STRING insert STRING among the headers. --http-password=PASS set http password to PASS. --http-user=USER set http user to USER. --ignore-case ignore case when matching files/directories. --ignore-length ignore `Content-Length' header field. --ignore-tags=LIST comma-separated list of ignored HTML tags. --keep-session-cookies load and save session (non-permanent) cookies. --limit-rate=RATE limit download rate to RATE. --load-cookies=FILE load cookies from FILE before session. --local-encoding=ENC use ENC as the local encoding for IRIs. --max-redirect maximum redirections allowed per page. --no-cache disallow server-cached data. --no-check-certificate don't validate the server's certificate. --no-cookies don't use cookies. --no-dns-cache disable caching DNS lookups. --no-glob turn off FTP file name globbing. --no-http-keep-alive disable HTTP keep-alive (persistent connections). --no-iri turn off IRI support. --no-passive-ftp disable the "passive" transfer mode. --no-proxy explicitly turn off proxy. --no-remove-listing don't remove `.listing' files. --password=PASS set both ftp and http password to PASS. --post-data=STRING use the POST method; send STRING as the data. --post-file=FILE use the POST method; send contents of FILE. --prefer-family=FAMILY connect first to addresses of specified family, one of IPv6, IPv4, or none. --private-key-type=TYPE private key type, PEM or DER. --private-key=FILE private key file. --progress=TYPE select progress gauge type. --protocol-directories use protocol name in directories. --proxy-password=PASS set PASS as proxy password. --proxy-user=USER set USER as proxy username. --random-file=FILE file with random data for seeding the SSL PRNG. --random-wait wait from 0.5*WAIT...1.5*WAIT secs between retrievals. --read-timeout=SECS set the read timeout to SECS. --referer=URL include `Referer: URL' header in HTTP request. --remote-encoding=ENC use ENC as the default remote encoding. --restrict-file-names=OS restrict chars in file names to ones OS allows. --retr-symlinks when recursing, get linked-to files (not dir). --retry-connrefused retry even if connection is refused. --save-cookies=FILE save cookies to FILE after session. --save-headers save the HTTP headers to file. --secure-protocol=PR choose secure protocol, one of auto, SSLv2, SSLv3, and TLSv1. --spider don't download anything. --strict-comments turn on strict (SGML) handling of HTML comments. --user=USER set both ftp and http user to USER. --waitretry=SECONDS wait 1..SECONDS between retries of a retrieval. --wdebug print Watt-32 debug output. %s (env) %s (system) %s (user) %s: certificate common name %s doesn't match requested host name %s. %s: certificate common name is invalid (contains a NUL character). This may be an indication that the host is not who it claims to be (that is, it is not the real %s). in --no-use-server-timestamps don't set the local file's timestamp by the one on the server. -4, --inet4-only connect only to IPv4 addresses. -6, --inet6-only connect only to IPv6 addresses. -A, --accept=LIST comma-separated list of accepted extensions. -B, --base=URL resolves HTML input-file links (-i -F) relative to URL. -D, --domains=LIST comma-separated list of accepted domains. -E, --adjust-extension save HTML/CSS documents with proper extensions. -F, --force-html treat input file as HTML. -H, --span-hosts go to foreign hosts when recursive. -I, --include-directories=LIST list of allowed directories. -K, --backup-converted before converting file X, back up as X.orig. -K, --backup-converted before converting file X, back up as X_orig. -L, --relative follow relative links only. -N, --timestamping don't re-retrieve files unless newer than local. -O, --output-document=FILE write documents to FILE. -P, --directory-prefix=PREFIX save files to PREFIX/... -Q, --quota=NUMBER set retrieval quota to NUMBER. -R, --reject=LIST comma-separated list of rejected extensions. -S, --server-response print server response. -T, --timeout=SECONDS set all timeout values to SECONDS. -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION. -V, --version display the version of Wget and exit. -X, --exclude-directories=LIST list of excluded directories. -a, --append-output=FILE append messages to FILE. -b, --background go to background after startup. -c, --continue resume getting a partially-downloaded file. -d, --debug print lots of debugging information. -e, --execute=COMMAND execute a `.wgetrc'-style command. -h, --help print this help. -i, --input-file=FILE download URLs found in local or external FILE. -k, --convert-links make links in downloaded HTML or CSS point to local files. -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite). -m, --mirror shortcut for -N -r -l inf --no-remove-listing. -nH, --no-host-directories don't create host directories. -nd, --no-directories don't create directories. -np, --no-parent don't ascend to the parent directory. -nv, --no-verbose turn off verboseness, without being quiet. -o, --output-file=FILE log messages to FILE. -p, --page-requisites get all images, etc. needed to display HTML page. -q, --quiet quiet (no output). -r, --recursive specify recursive download. -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). -v, --verbose be verbose (this is the default). -w, --wait=SECONDS wait SECONDS between retrievals. -x, --force-directories force creation of directories. Issued certificate has expired. Issued certificate not yet valid. Self-signed certificate encountered. Unable to locally verify the issuer's authority. eta %s (%s bytes) (unauthoritative) [following]%d redirections exceeded. %s %s (%s) - %s saved [%s/%s] %s (%s) - %s saved [%s] %s (%s) - Connection closed at byte %s. %s (%s) - Data connection: %s; %s (%s) - Read error at byte %s (%s).%s (%s) - Read error at byte %s/%s (%s). %s (%s) - written to stdout %s[%s/%s] %s (%s) - written to stdout %s[%s] %s ERROR %d: %s. %s URL: %s %2d %s %s has sprung into existence. %s request sent, awaiting response... %s: %s, closing control connection. %s: %s: Failed to allocate %ld bytes; memory exhausted. %s: %s: Failed to allocate enough memory; memory exhausted. %s: %s: Invalid boolean %s; use `on' or `off'. %s: %s: Invalid byte value %s %s: %s: Invalid header %s. %s: %s: Invalid number %s. %s: %s: Invalid progress type %s. %s: %s: Invalid restriction %s, use [unix|windows],[lowercase|uppercase],[nocontrol],[ascii]. %s: %s: Invalid time period %s %s: %s: Invalid value %s. %s: %s:%d: unknown token "%s" %s: %s:%d: warning: %s token appears before any machine name %s: %s; disabling logging. %s: Cannot read %s (%s). %s: Cannot resolve incomplete link %s. %s: Couldn't find usable socket driver. %s: Error in %s at line %d. %s: Invalid --execute command %s %s: Invalid URL %s: %s %s: No certificate presented by %s. %s: Syntax error in %s at line %d. %s: The certificate of %s has been revoked. %s: The certificate of %s hasn't got a known issuer. %s: The certificate of %s is not trusted. %s: Unknown command %s in %s at line %d. %s: WGETRC points to %s, which doesn't exist. %s: Warning: Both system and user wgetrc point to %s. %s: aprintf: text buffer is too big (%ld bytes), aborting. %s: cannot stat %s: %s %s: cannot verify %s's certificate, issued by %s: %s: corrupt time-stamp. %s: illegal option -- `-n%c' %s: invalid option -- '%c' %s: missing URL %s: no certificate subject alternative name matches requested host name %s. %s: option '%c%s' doesn't allow an argument %s: option '--%s' doesn't allow an argument %s: option '--%s' requires an argument %s: option '-W %s' doesn't allow an argument %s: option '-W %s' is ambiguous %s: option '-W %s' requires an argument %s: option requires an argument -- '%c' %s: unable to resolve bind address %s; disabling bind. %s: unable to resolve host address %s %s: unknown/unsupported file type. %s: unrecognized option '%c%s' %s: unrecognized option '--%s' '(no description)(try:%2d), %s (%s) remaining, %s remaining-k can be used together with -O only if outputting to a regular file. ==> CWD not needed. ==> CWD not required. Already have correct symlink %s -> %s Authorization failed. Bad port numberBind error (%s). Can't be verbose and quiet at the same time. Can't timestamp and not clobber old files at the same time. Cannot back up %s as %s: %s Cannot convert links in %s: %s Cannot get REALTIME clock frequency: %s Cannot initiate PASV transfer. Cannot open %s: %sCannot open cookies file %s: %s Cannot parse PASV response. Cannot specify both --ask-password and --password. Cannot specify both --inet4-only and --inet6-only. Cannot specify both -k and -O if multiple URLs are given, or in combination with -p or -r. See the manual for details. Cannot write to %s (%s). Compile: Connecting to %s:%d... Connecting to %s|%s|:%d... Continuing in background, pid %d. Continuing in background, pid %lu. Continuing in background. Control connection closed. Conversion from %s to %s isn't supported Converted %d files in %s seconds. Converting %s... Cookie coming from %s attempted to set domain to %s Copyright (C) 2009 Free Software Foundation, Inc. Could not seed PRNG; consider using --random-file. Creating symlink %s -> %s Data transfer aborted. Directories: Directory Disabling SSL due to encountered errors. Download quota of %s EXCEEDED! Download: ERRORERROR: Cannot open directory %s. ERROR: Redirection (%d) without location. Encoding %s isn't valid Error closing %s: %s Error in proxy URL %s: Must be HTTP. Error in server greeting. Error in server response, closing control connection. Error initializing X509 certificate: %s Error matching %s against %s: %s Error parsing certificate: %s Error parsing proxy URL %s: %s. Error writing to %s: %s FTP options: Failed reading proxy response: %s Failed to unlink symlink %s: %s Failed writing HTTP request: %s. File File %s already there; not retrieving. File %s already there; not retrieving. File %s exists. File `%s' already there; not retrieving. File has already been retrieved. Found %d broken link. Found %d broken links. Found no broken links. GNU Wget %s built on %s. GNU Wget %s, a non-interactive network retriever. Giving up. HTTP options: HTTPS (SSL/TLS) options: HTTPS support not compiled inIPv6 addresses not supportedIncomplete or invalid multibyte sequence encountered Index of /%s on %s:%dInvalid IPv6 numeric addressInvalid PORT. Invalid dot style specification %s; leaving unchanged. Invalid host nameInvalid name of the symlink, skipping. Invalid user nameLast-modified header invalid -- time-stamp ignored. Last-modified header missing -- time-stamps turned off. Length: Length: %sLicense GPLv3+: GNU GPL version 3 or later . This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. Link Link: Loading robots.txt; please ignore errors. Locale: Location: %s%s Logged in! Logging and input file: Logging in as %s ... Login incorrect. Mail bug reports and suggestions to . Malformed status lineMandatory arguments to long options are mandatory for short options too. No URLs found in %s. No certificate found No data received. No errorNo headers, assuming HTTP/0.9No matches on pattern %s. No such directory %s. No such file %s. No such file %s. No such file or directory %s. Not descending to %s as it is excluded/not-included. Not sure Output will be written to %s. POST data file %s missing: %s Password for user %s: Password: Please send bug reports and questions to . Proxy tunneling failed: %sRead error (%s) in headers. Recursion depth %d exceeded max. depth %d. Recursive accept/reject: Recursive download: Rejecting %s. Remote file does not exist -- broken link!!! Remote file exists and could contain further links, but recursion is disabled -- not retrieving. Remote file exists and could contain links to other resources -- retrieving. Remote file exists but does not contain any link -- not retrieving. Remote file exists. Remote file is newer than local file %s -- retrieving. Remote file is newer, retrieving. Remote file no newer than local file %s -- not retrieving. Removed %s. Removing %s since it should be rejected. Removing %s. Resolving %s... Retrying. Reusing existing connection to %s:%d. Saving to: %s Scheme missingServer error, can't determine system type. Server file no newer than local file %s -- not retrieving. Skipping directory %s. Spider mode enabled. Check if remote file exists. Startup: Symlinks not supported, skipping symlink %s. Syntax error in Set-Cookie: %s at position %d. Temporary failure in name resolutionThe certificate has expired The certificate has not yet been activated The certificate's owner does not match hostname %s The server refuses login. The sizes do not match (local %s) -- retrieving. The sizes do not match (local %s) -- retrieving. This version does not have support for IRIs To connect to %s insecurely, use `--no-check-certificate'. Try `%s --help' for more options. Unable to delete %s: %s Unable to establish SSL connection. Unhandled errno %d Unknown authentication scheme. Unknown errorUnknown hostUnknown system errorUnknown type `%c', closing control connection. Unsupported listing type, trying Unix listing parser. Unsupported scheme %sUnterminated IPv6 numeric addressUsage: %s NETRC [HOSTNAME] Usage: %s [OPTION]... [URL]... Using %s as listing tmp file. WARNINGWARNING: combining -O with -r or -p will mean that all downloaded content will be placed in the single file you specified. WARNING: timestamping does nothing in combination with -O. See the manual for details. WARNING: using a weak random seed. Warning: wildcards not supported in HTTP. Wgetrc: Will not retrieve dirs since depth is %d (max %d). Write failed, closing control connection. Wrote HTML-ized index to %s [%s]. Wrote HTML-ized index to %s. `connected. couldn't connect to %s port %d: %s done. done. done. failed: %s. failed: No IPv4/IPv6 addresses for host. failed: timed out. idn_decode failed (%d): %s idn_encode failed (%d): %s ignoredlocale_to_utf8: locale is unset memory exhaustednothing to do. time unknown unspecifiedProject-Id-Version: wget-1.12-pre7 Report-Msgid-Bugs-To: bug-wget@gnu.org POT-Creation-Date: 2011-09-13 10:17+0200 PO-Revision-Date: 2011-06-19 19:24-0300 Last-Translator: Rodolfo Ribeiro Gomes Language-Team: Brazilian Portuguese Language: pt_BR MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=2; plural=(n > 1); O arquivo já foi completamente obtido; não há nada a ser feito. %*s[ ignorando %sK ] %s recebido, redirecionando saída para %s. %s recebido. Escrito originalmente por Hrvoje Niksic . REST falhou, recomeçando do zero. --ask-password pergunta pelas senhas. --auth-no-challenge envia informações de autenticação HTTP básica sem antes aguardar pelo desafio do servidor. --bind-address=ENDEREÇO associa à máquina local o ENDEREÇO (nome de máquina ou número IP). --ca-certificate=ARQUIVO arquivo com o maço de CA's. --ca-directory=DIR diretório onde está a lista de hash das CA's. --certificate-type=TIPO tipo de certificado do client: PEM ou DER. --certificate=ARQUIVO o arquivo de certificado do cliente. --connect-timeout=SEGS define o tempo de espera da conexão como SEGS. --content-disposition honra o cabeçalho Content-Disposition ao escolher os nomes do arquivo local (EXPERIMENTAL). --cut-dirs=QTD ignora QTD componentes do diretório remoto. --default-page=NOME Altera o nome da página padrão (normalmente, ela é "index.html"). --delete-after exclui os arquivos localmente depois de baixá-los. --dns-timeout=SEGUNDOS define o tempo de espera de busca de DNS como SEGUNDOS. --egd-file=ARQUIVO arquivo nomeando o soquete EGD com dados aleatórios. --exclude-domains=LISTA lista separada por vírgulas dos domínios rejeitados. --follow-ftp segue os links FTP dos documentos HTML. --follow-tags=LISTA lista separada por vírgulas das tags HTML permitidas. --ftp-password=SENHA define a senha para FTP. --ftp-stmlf Usa o formato Stream_LF para todos os arquivos binários do FTP. --ftp-user=USUÁRIO define o usuário de FTP. --header=TEXTO insere TEXTO em meio aos cabeçalhos. --http-password=SENHA define a senha a usar para HTTP. --http-user=USUÁRIO define o usuário do HTTP. --ignore-case ignora a maiusculização ao comparar arquivos/ diretórios. --ignore-length ignora o campo de cabeçalho "Content-Length". --ignore-tags=LISTA lista separada por vírgulas das tags HTML ignoradas. --keep-session-cookies carrega e salva os cookies (não permanentes) da sessão. --limit-rate=TAXA limita a taxa de download a TAXA. --load-cookies=ARQUIVO carrega os cookies do ARQUIVO antes da sessão. --local-encoding=COD usa COD como a codificação local para IRIs. --max-redirect máximo redirecionamentos permitido por página. --no-cache desautoriza dados em cache do servidor. --no-check-certificate não valida o certificado do servidor. --no-cookies não usa cookies. --no-dns-cache desabilita o cache da busca de DNS. --no-glob desativa a pesquisa aproximada (glob search) para nomes de arquivo no FTP. --no-http-keep-alive desabilita o "HTTP keep-alive" (para conexões persistentes). --no-iri desativa o suporte a IRI. --no-passive-ftp desabilita o modo de transferência "passivo". --no-proxy desativa explicitamente o proxy. --no-remove-listing não exclui os arquivos ".listing". --password=SENHA define a senha a ser usada para HTTP e FTP. --post-data=TEXTO usa o método POST; envia o TEXTO como dados. --post-file=ARQUIVO usa o método POST; envia o conteúdo de ARQUIVO. --prefer-family=FAMÍLIA conecta primeiro a endereços da família especificada: IPv6, IPv4 ou "none" (nenhum). --private-key-type=TIPO tipo de chave privada: PEM ou DER. --private-key=ARQUIVO arquivo de chave privada. --progress=TIPO seleciona o tipo de indicador de progresso. --protocol-directories usa o nome do protocolo nos diretórios. --proxy-password=SENHA define a senha para o proxy. --proxy-user=USUÁRIO define o nome de usuário do proxy. --random-file=ARQUIVO arquivo com dados aleatórios para semear o SSL PRNG. --random-wait espera de 0,5*ESPERA a 2*ESPERA segundos entre os downloads. --read-timeout=SEGUNDOS define o tempo de espera de leitura como SEGUNDOS. --referer=URL inclui o cabeçalho "Referer: URL" na requisição HTTP. --remote-encoding=COD usa COD como a codificação remota padrão. --restrict-file-names=SO restringe os caracteres nos nomes de arquivos aos que o SO (sistema operacional) permite. --retr-symlinks em uma recursão, obtém arquivos apontados por ligação (não vale para diretórios). --retry-connrefused tenta novamente mesmo se a conexão for recusada. --save-cookies=ARQUIVO salva os cookies no ARQUIVO depois da sessão. --save-headers salva os cabeçalhos HTTP no arquivo. --secure-protocol=PR escolhe entre um protocolo de segurança: auto (automático), SSLv2, SSLv3 e TLSv1. --spider não baixa nada. --strict-comments ativa a manipulação estrita (SGML) dos comentários HTML. --user=USUÁRIO define o usuário para HTTP e FTP. --waitretry=SEGUNDOS espera de 1 a SEGUNDOS entre as tentativas de baixar. --wdebug emite a saída de depuração Watt-32. %s (ambiente) %s (sistema) %s (usuário) %s: o nome comum no certificado %s não coincide com o nome de máquina solicitado %s. %s: o nome comum no certificado é inválido (contém um caractere nulo). Isso pode ser um indício que a máquina não é quem afirma ser, isto é, que ela não é o verdadeiro %s. em --no-use-server-timestamps não ajusta a data/hora do arquivo local pelo do arquivo no servidor. -4, --inet4-only conecta apenas a endereços IPv4. -6, --inet6-only conecta apenas a endereços IPv6. -A, --accept=LISTA lista separada por vírgulas das extensões aceitas. -B, --base=URL resolve os links do arquivo HTML de entrada (-i -F) relativos a URL. -D, --domains=LISTA lista separada por vírgulas dos domínios aceitos. -E, --adjust-extension salva os documentos HTML/CSS com as extensões apropriadas. -F, --force-html trata o arquivo de entrada como HTML. -H, --span-hosts vai para máquinas estrangeiras ao recursar. -I, --include-directories=LISTA lista dos diretórios permitidos. -K, --backup-converted antes de converter o arquivo X, faz uma cópia de de segurança como X.orig. -K, --backup-converted antes de converter o arquivo X, faz uma cópia de de segurança como X_orig. -L, --relative segue apenas links relativos. -N, --timestamping não tentar refazer o download de um arquivo, a menos que ele seja mais novo que o local. -O, --output-document=ARQ escreve os documentos no ARQuivo. -P, --directory-prefix=PREFIXO salva os arquivos em PREFIXO/... -Q, --quota=QUANTIDADE define a cota de download como QUANTIDADE. -R, --reject=LISTA lista separada por vírgulas das extensões rejeitadas. -S, --server-response exibe a resposta do servidor. -T, --timeout=SEGUNDOS define todos os valores de tempo de espera como SEGUNDOS. -U, --user-agent=AGENTE identifica-se como AGENTE em vez de Wget/VERSÃO. -V, --version mostra a versão do Wget e sai. -X, --exclude-directories=LISTA lista dos diretórios excluídos. -a, --append-output=ARQ anexa mensagens ao ARQuivo. -b, --background vai para o plano de fundo depois de iniciar. -c, --continue retoma o download de um arquivo baixado parcialmente. -d, --debug emite muita informações de depuração. -e, --execute=COMANDO executa um comando no estilo ".wgetrc". -h, --help emite esta ajuda. -i, --input-file=ARQ baixa os URLs encontrados no ARQuivo local ou externo. -k, --convert-links faz os links no HTML ou CSS baixado apontarem para os arquivos locais. -l, --level=NÚMERO nível máximo da recursão (inf ou 0 para infinito). -m, --mirror atalho para -N -r -l inf --no-remove-listing. -nH, --no-host-directories não cria diretórios do servidor. -nd, --no-directories não cria diretórios. -np, --no-parent não subir ao diretório-pai. -nv, --no-verbose desativa o detalhamento, sem ser silencioso. -o, --output-file=ARQ envia as mensagens de log para ARQuivo. -p, --page-requisites obtém todas as imagens, etc. necessárias para exibir a página HTML. -q, --quiet silencioso (não emite nada). -r, --recursive especifica como download recursivo. -t, --tries=NÚMERO define o número de tentativas como NÚMERO (0 significa ilimitada). -v, --verbose detalhista (isto é o padrão). -w, --wait=SEGUNDOS espera SEGUNDOS entre as tentativas. -x, --force-directories força a criação de diretórios. Certificado emitido expirou. Certificado emitido ainda não é válido. Foi encontrado um certificado auto-assinado. Não foi possível verificar localmente a autoridade do emissor. TED %s (%s bytes) (sem autoridade) [redirecionando]Excedeu os %d redirecionamentos. %s %s (%s) - %s salvo [%s/%s] %s (%s) - %s salvo [%s] %s (%s) - Conexão fechada no byte %s. %s (%s) - Conexão de dados: %s; %s (%s) - Erro de leitura no byte %s (%s).%s (%s) - Erro de leitura no byte %s/%s (%s). %s (%s) - escrito para a saída padrão %s [%s/%s] %s (%s) - escrito para a saída padrão %s[%s] %s ERRO %d: %s. %s URL: %s %2d %s %s surgiu do nada. A requisição %s foi enviada, aguardando resposta... %s: %s, fechando conexão de controle. %s: %s: Falhou em alocar %ld bytes; memória esgotada. %s: %s: Falhou em alocar memória suficiente; memória esgotada. %s: %s: o valor booleano %s é inválido; use "on" ou "off". %s: %s: O valor de byte %s é inválido %s: %s: O cabeçalho %s é inválido. %s: %s: O número %s é inválido. %s: %s: O tipo de progresso %s é inválido. %s: %s: A restrição %s é inválida; use [unix|windows],[lowercase|uppercase],[nocontrol],[ascii]. %s: %s: O período de tempo %s é inválido %s: %s: O valor %s é inválido. %s: %s:%d: o termo "%s" é desconhecido %s: %s:%d: aviso: o termo %s aparece antes de qualquer nome de máquina %s: %s; desabilitando registro. %s: Não foi possível ler %s (%s). %s: Não foi possível resolver o link incompleto %s. %s: Não foi possível encontrar um driver de soquete usável. %s: Erro em %s na linha %d. %s: O comando --execute %s é inválido %s: O URL %s é inválido: %s. %s: Nenhum certificado apresentado por %s. %s: Erro de sintaxe em %s na linha %d. %s: O certificado de %s foi revogado. %s: O certificado de %s não tem um emissor conhecido. %s: O certificado de %s não é confiável. %s: Comando desconhecido %s em %s na linha %d. %s: WGETRC aponta para %s, que não existe. %s: Aviso: os arquivos wgetrc tanto do sistema como do usuário apontam para %s. %s: aprintf: a memória para texto é muito grande (%ld bytes); abortando. %s: não foi possível acessar %s: %s %s: não foi possível verificar o certificado de %s, emitido por %s: %s: horário (timestamp) corrompido. %s: a opção é ilegal -- "-n%c" %s: a opção é inválida -- "%c" %s: falta o URL %s: o nome alternativo do sujeito do certificado não coincide com o nome de máquina solicitado %s. %s: a opção "%c%s" não aceita argumentos %s: a opção "--%s" não aceita argumentos %s: a opção "%s" exige um argumento %s: a opção "-W %s" não aceita argumentos %s: a opção "-W %s" é ambígua %s: a opção "-W %s" exige um argumento %s: a opção exige um argumento -- "%c" %s: não foi possível resolver endereço de associação %s; desabilitando a associação. %s: não foi possível resolver endereço de máquina %s %s: o tipo de arquivo é desconhecido ou não possui suporte. %s: a opção não é reconhecida "%c%s" %s: a opção não é reconhecida "--%s" ”(sem descrição)(tentativa:%2d), %s (%s) restantes, %s restantes-k pode ser usada juntamente com -O somente se a saída for um arquivo comum. ==> CWD não é necessário. ==> CWD não exigido. Ligação simbólica já está correta %s -> %s A autorização falhou. O número de porta é inválidoErro na associação (%s). Não pode ser "detalhista" e "silencioso" ao mesmo tempo. Não é possível usar as opções "timestamp" e "no clobber" ao mesmo tempo. Não foi possível fazer uma cópia de segurança de %s como %s: %s Não foi possível converter links em %s: %s Não foi possível obter a freqüência do relógio de TEMPO REAL: %s Não é possível iniciar transferência PASV. Não foi possível abrir %s: %sNão foi possível abrir o arquivo de cookies %s: %s Não foi possível entender resposta do comando PASV. Não é possível especificar ao mesmo tempo --ask-password e --password. Não é possível especificar ao mesmo tempo --inet4-only e --inet6-only. Não é possível especificar -k e -O se são fornecidos múltiplos URLs, ou em combinação com -p ou -r. Veja o manual para mais detalhes. Não foi possível escrever em %s (%s). Compilação: Conectando-se a %s:%d... Conectando-se a %s|%s|:%d... Continuando em plano de fundo, pid %d. Continuando em plano de fundo, pid %lu. Continuando em plano de fundo. A conexão de controle está fechada. Não há suporte para a conversão de %s para %s %d arquivos convertidos em %s segundos. Convertendo %s... Cookie vindo de %s tentou designar domínio como %s Copyright (C) 2009 Free Software Foundation, Inc. Não foi possível gerar semente para PRNG; considere o uso de --random-file. Criando ligação simbólica %s -> %s A transferência dos dados foi abortada. Diretórios: Diretório Desabilitando SSL devido aos erros encontrados. EXCEDIDA a cota de download de %s! Download: ERROERRO: Não conseguiu abrir o diretório %s. ERRO: Redirecionamento (%d) sem Location. A codificação %s não é válida Erro ao fechar %s: %s Erro no URL do proxy %s: Tem que ser HTTP. Erro na saudação do servidor. Erro na resposta do servidor, fechando a conexão de controle. Erro ao iniciar o certificado X509: %s Erro ao comparar %s com %s: %s. Erro ao analisar o certificado: %s Erro ao analisar URL do proxy %s: %s Erro ao gravar em %s: %s. Opções FTP: Falhou em ler a resposta do proxy: %s. Falha na remoção da ligação simbólica %s: %s Falhou em enviar requisição HTTP: %s. Arquivo O arquivo %s já existe, não será baixado. O arquivo %s já existe, não será baixado. O arquivo %s existe. O arquivo "%s" já existe, não será baixado. O arquivo já foi obtido. Encontrou %d link quebrado. Encontrou %d links quebrados. Não encontrou links quebrados. GNU Wget %s construído em %s. GNU Wget %s, um programa não interativo para baixar arquivos da rede. Desistindo. Opções HTTP: Opções HTTPS (SSL/TLS): Compilado sem suporte a HTTPSNão há suporte a endereços IPv6Encontrou-se uma sequência multibyte inválida ou incompleta Índice de /%s em %s:%dO endereço IPv6 é inválidoPORT é inválido. Especificação inválida de estilo da ordem de grandeza (dot) %s; mantendo inalterado. O nome de máquina é inválidoNome inválido da ligação simbólica, ignorando. O nome de usuário é inválidoO cabeçalho Last-modified é inválido -- horário ignorado. Está faltando o cabeçalho Last-modified -- horários desligados. Tamanho: Tamanho: %sLicença GPLv3+: GNU GPL versão 3 ou posterior . Este é um software livre: você é livre para alterá-lo e redistribui-lo. Não há GARANTIAS, na extensão máxima permitida por lei. Link Link: Carregando robots.txt; por favor ignore qualquer erro. Localidade: Localização: %s%s Acesso autorizado! Arquivo de entrada e de registro: Acessando como %s ... Identificação incorreta. Relatos de problemas e sugestões para . A linha de status é inválidaArgumentos obrigatórios para opções longas também o são para as opções curtas. Nenhum URL foi encontrado em %s. Nenhum certificado foi encontrado Nenhum dado foi recebido. Nenhum erroNão foram recebidos cabeçalhos, assumindo HTTP/0.9Não há ocorrências para o padrão %s. O diretório %s não foi encontrado. O arquivo %s não foi encontrado. O arquivo %s não foi encontrado. O arquivo ou diretório %s não foi encontrado. Não descendo para %s, pois está excluído/não incluído. Incerto A saída será escrita em %s. O arquivo %s de dados POST está faltando: %s Senha para o usuário %s: Senha: Por favor, envie relatos de problemas e sugestões para . O tunelamento pelo proxy falhou: %sErro de leitura (%s) nos cabeçalhos. Nível de recursão %d excedeu o nível máximo %d. Aceitação/Recusa de recursão: Download recursivo: Rejeitando %s. O arquivo remoto não existe -- link quebrado!!! O arquivo remoto existe e poderia conter mais links, mas a recursão está desabilitada -- ignorando. O arquivo remoto existe e pode conter links para outras fontes -- baixando. O arquivo remoto existe mas não contém link algum -- ignorando. O arquivo remoto existe. O arquivo remoto é mais novo que o local %s -- baixando. O arquivo remoto é mais novo, baixando. O arquivo remoto não é mais novo que o local %s -- ignorando. Removeu %s. Removendo %s já que ele deveria ser rejeitado. Removendo %s. Resolvendo %s... Tentando novamente. Reaproveitando a conexão existente para %s:%d. Salvando em: %s O esquema está faltandoErro do servidor, não foi possível determinar tipo de sistema. O arquivo no servidor não é mais novo que o local %s -- ignorando. Ignorando o diretório %s. O modo aranha está habilitado. Verifique se o arquivo remoto existe. Inicialização: Não há suporte para ligações simbólicas, ignorando a ligação %s. Erro de sintaxe em Set-Cookie: %s na posição %d. Falha temporária na resolução de nomesO certificado expirou O certificado não foi ativado ainda O dono do certificado não coincide com o nome de máquina %s. O servidor recusou o acesso. Os tamanhos não coincidem (local %s) -- baixando. Os tamanhos não coincidem (local %s) -- baixando. Esta versão não oferece suporte a IRIs Para se conectar a %s de forma insegura, use "--no-check-certificate". Tente "%s --help" para mais opções. Não foi possível excluir %s: %s Não foi possível estabelecer conexão segura (SSL). Erro não tratado: errno %d O esquema de autenticação é desconhecido. Erro desconhecidoA máquina é desconhecidaErro desconhecido de sistemaTipo "%c" é desconhecido, fechando a conexão de controle. Sem suporte ao tipo de listagem. Tentando usar interpretador de listagem UNIX. Não há suporte ao esquema %sO endereço IPv6 está incompletoUso: %s NETRC [NOME DA MÁQUINA] Uso: %s [OPÇÃO]... [URL]... Usando %s como arquivo temporário de listagem. AVISOAVISO: combinar -O com -r ou -p significa que todo o conteúdo baixado será colocado em um único arquivo que você especificou. AVISO: a opção --timestamp não faz nada se combinada com -O. Veja o manual para detalhes. AVISO: usando uma semente fraca de aleatoriedade. Aviso: Não há suporte para caracteres coringa no HTTP. Wgetrc: Não serão baixados os diretórios, pois o nível de recursão é %d (máx. %d). Falha de escrita, fechando a conexão de controle. Escrito índice em formato HTML em %s [%s]. Escrito índice em formato HTML em %s. “conectado. não foi possível se conectar a %s porta %d: %s feito. feito. feito. falhou: %s. falha: Não há endereços IPv4/IPv6 para a máquina. falha: o tempo esgostou. idn_decode falhou (%d): %s idn_encode falhou (%d): %s ignoradolocale_to_utf8: localidade não definida memória esgotadanada a ser feito. horário desconhecido não especificada0707010005a688000041ed0000000000000000000000034fa8aa6600000000000000b500010002ffffffffffffffff0000001f00000000root/usr/local/share/locale/da0707010005a689000041ed0000000000000000000000024fa8aa6600000000000000b500010002ffffffffffffffff0000002b00000000root/usr/local/share/locale/da/LC_MESSAGES0707010005a68a000081a40000000000000000000000014fa8a70b0000b42e000000b500010002ffffffffffffffff0000003300000000root/usr/local/share/locale/da/LC_MESSAGES/wget.mol 0!:1!l!(!!;!%!7"S"Q#>`#M#E#93$Bm$$MC%}%I&EY&M&M&I;'O'9'N(5^(@(:(6)NG)E)N)N+*>z*F*I+FJ+<+I+2,>K,@,Q,7-DU-<->-I.M`.K..>/2/=/D90;~0;0P0XG1?1N1I/2Qy2N2F3Ca3>3~3:c4M4E4Q2595 555I56666At7A7P7rI8M8O 97Z9G9@9I:Ie:?:s::c;;;@;P<8l<D<J<A5=Aw=6=;=M,>Bz>>>,>L)?sv?M?K8@A@<@IAHMA3ANA0B8JBOB?BBCAVC"C$C'C3DF<wF/FFGG";Gb^GGGG=HYHuH'H(HH!HI$7I#\I,I5I*I)J.8J6gJ;JJ2J%K>K\KxKMK,K,L'1L-YL L(L(L7L&2M#YM}MMMM MMMFMDNYN'pNNNN-N<NWtWWW7WW'X(X4:X8oXX XX YY*YYY YYZZ8.ZgZJ}ZZZZ[[.[I[a[s[[5[ [[\'\ >\=I\\\+\\]]-)]bW]N]E ^O^8e^"^;^ ^) _ 4_B_ S_&____+_<_ `2%` X`-b`/`$``+a3.aba1}a2a,a;b"Kbnb$bbb b bb/c6@cwc!cccc d|dXd#d* e7e3@e*te"eee e#eff !f +f)8fbfvfff ffff ggBhh+i4i<Ci i6iiwpj<jI%kIok5kOk?lOlx$mBmKmz,nKnNnuBo>oPo<HpBp?p=qFqHqxrOrJrC+sKosPsB tCOt2tAtAutJu@uLv:Mv<vOvHwG^wwE9x1xBxAx?6y?vyzy\1zIztzHM{{y|K|B|A&}yh}-}O~L`~y~F'n~S|@5@vO}NPԂ<%Ib?uubC؄;<؅?LU:N݆L,<yD9:5LpHA0HLy}ƉmDN=8?CxJ6v>75O#KsBA&D0k24ώ -<\`|*$(1.-`($;AK<ʑ# cDȒ>A_%{'ɓ& ($"M0p2)Ԕ))(>R;͕:'B_xV,,%;-a!#$՗@&;*b ӘKQj-˙ߙ/M )n$+" !$A3f3ΛS q!"Ϝ -"&Pw;0ƝLDc | % ۞ ' 4Q%m"4/('D*l ',- D'Q'y)ݡ@$>c3 ̢.25h3-'9;:u Ĥ 5 #;R7hJ!: O"Z!}ԧ&: O!\~ BǨ $0Ar 0lݩOJDߪ/!$5F |% ʫ.٫ *&7Q= ެF-/"],2ƭ#22P(E!%,Rh .A# >_{$|ưRC).00)*Z% ' 0A \ } < 7R*tI Mn]XmAj.E O#Zv/^11[4+dETZi)}\" fo%:5c3|!gF+J@(' 9L3K$LwN8lGp>zn60C\B^K,wmh9Q_pb[SB@k}=2*?q7u4 za#xQFhSrb_dTJ Y]2!O{Ri;H eel&kP),tD85gMy-UIC0> W?<&(|VHsfU~~'aq{ -X:.6`y%"o`rGAWsY VN<=c/vD jxu $;P The file is already fully retrieved; nothing to do. %*s[ skipping %sK ] %s received, redirecting output to %s. %s received. Originally written by Hrvoje Niksic . REST failed, starting from scratch. --ask-password prompt for passwords. --auth-no-challenge send Basic HTTP authentication information without first waiting for the server's challenge. --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host. --ca-certificate=FILE file with the bundle of CA's. --ca-directory=DIR directory where hash list of CA's is stored. --certificate-type=TYPE client certificate type, PEM or DER. --certificate=FILE client certificate file. --connect-timeout=SECS set the connect timeout to SECS. --content-disposition honor the Content-Disposition header when choosing local file names (EXPERIMENTAL). --cut-dirs=NUMBER ignore NUMBER remote directory components. --default-page=NAME Change the default page name (normally this is `index.html'.). --delete-after delete files locally after downloading them. --dns-timeout=SECS set the DNS lookup timeout to SECS. --egd-file=FILE file naming the EGD socket with random data. --exclude-domains=LIST comma-separated list of rejected domains. --follow-ftp follow FTP links from HTML documents. --follow-tags=LIST comma-separated list of followed HTML tags. --ftp-password=PASS set ftp password to PASS. --ftp-stmlf Use Stream_LF format for all binary FTP files. --ftp-user=USER set ftp user to USER. --header=STRING insert STRING among the headers. --http-password=PASS set http password to PASS. --http-user=USER set http user to USER. --ignore-case ignore case when matching files/directories. --ignore-length ignore `Content-Length' header field. --ignore-tags=LIST comma-separated list of ignored HTML tags. --keep-session-cookies load and save session (non-permanent) cookies. --limit-rate=RATE limit download rate to RATE. --load-cookies=FILE load cookies from FILE before session. --local-encoding=ENC use ENC as the local encoding for IRIs. --max-redirect maximum redirections allowed per page. --no-cache disallow server-cached data. --no-check-certificate don't validate the server's certificate. --no-cookies don't use cookies. --no-dns-cache disable caching DNS lookups. --no-glob turn off FTP file name globbing. --no-http-keep-alive disable HTTP keep-alive (persistent connections). --no-iri turn off IRI support. --no-passive-ftp disable the "passive" transfer mode. --no-proxy explicitly turn off proxy. --no-remove-listing don't remove `.listing' files. --password=PASS set both ftp and http password to PASS. --post-data=STRING use the POST method; send STRING as the data. --post-file=FILE use the POST method; send contents of FILE. --prefer-family=FAMILY connect first to addresses of specified family, one of IPv6, IPv4, or none. --private-key-type=TYPE private key type, PEM or DER. --private-key=FILE private key file. --progress=TYPE select progress gauge type. --protocol-directories use protocol name in directories. --proxy-password=PASS set PASS as proxy password. --proxy-user=USER set USER as proxy username. --random-file=FILE file with random data for seeding the SSL PRNG. --random-wait wait from 0.5*WAIT...1.5*WAIT secs between retrievals. --read-timeout=SECS set the read timeout to SECS. --referer=URL include `Referer: URL' header in HTTP request. --remote-encoding=ENC use ENC as the default remote encoding. --restrict-file-names=OS restrict chars in file names to ones OS allows. --retr-symlinks when recursing, get linked-to files (not dir). --retry-connrefused retry even if connection is refused. --save-cookies=FILE save cookies to FILE after session. --save-headers save the HTTP headers to file. --secure-protocol=PR choose secure protocol, one of auto, SSLv2, SSLv3, and TLSv1. --spider don't download anything. --strict-comments turn on strict (SGML) handling of HTML comments. --user=USER set both ftp and http user to USER. --waitretry=SECONDS wait 1..SECONDS between retries of a retrieval. --wdebug print Watt-32 debug output. %s (env) %s (system) %s (user) %s: certificate common name %s doesn't match requested host name %s. %s: certificate common name is invalid (contains a NUL character). This may be an indication that the host is not who it claims to be (that is, it is not the real %s). in --no-use-server-timestamps don't set the local file's timestamp by the one on the server. -4, --inet4-only connect only to IPv4 addresses. -6, --inet6-only connect only to IPv6 addresses. -A, --accept=LIST comma-separated list of accepted extensions. -B, --base=URL resolves HTML input-file links (-i -F) relative to URL. -D, --domains=LIST comma-separated list of accepted domains. -E, --adjust-extension save HTML/CSS documents with proper extensions. -F, --force-html treat input file as HTML. -H, --span-hosts go to foreign hosts when recursive. -I, --include-directories=LIST list of allowed directories. -K, --backup-converted before converting file X, back up as X.orig. -K, --backup-converted before converting file X, back up as X_orig. -L, --relative follow relative links only. -N, --timestamping don't re-retrieve files unless newer than local. -O, --output-document=FILE write documents to FILE. -P, --directory-prefix=PREFIX save files to PREFIX/... -Q, --quota=NUMBER set retrieval quota to NUMBER. -R, --reject=LIST comma-separated list of rejected extensions. -S, --server-response print server response. -T, --timeout=SECONDS set all timeout values to SECONDS. -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION. -V, --version display the version of Wget and exit. -X, --exclude-directories=LIST list of excluded directories. -a, --append-output=FILE append messages to FILE. -b, --background go to background after startup. -c, --continue resume getting a partially-downloaded file. -d, --debug print lots of debugging information. -e, --execute=COMMAND execute a `.wgetrc'-style command. -h, --help print this help. -i, --input-file=FILE download URLs found in local or external FILE. -k, --convert-links make links in downloaded HTML or CSS point to local files. -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite). -m, --mirror shortcut for -N -r -l inf --no-remove-listing. -nH, --no-host-directories don't create host directories. -nd, --no-directories don't create directories. -np, --no-parent don't ascend to the parent directory. -nv, --no-verbose turn off verboseness, without being quiet. -o, --output-file=FILE log messages to FILE. -p, --page-requisites get all images, etc. needed to display HTML page. -q, --quiet quiet (no output). -r, --recursive specify recursive download. -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). -v, --verbose be verbose (this is the default). -w, --wait=SECONDS wait SECONDS between retrievals. -x, --force-directories force creation of directories. Issued certificate has expired. Issued certificate not yet valid. Self-signed certificate encountered. Unable to locally verify the issuer's authority. eta %s (%s bytes) (unauthoritative) [following]%d redirections exceeded. %s %s (%s) - %s saved [%s/%s] %s (%s) - %s saved [%s] %s (%s) - Connection closed at byte %s. %s (%s) - Data connection: %s; %s (%s) - Read error at byte %s (%s).%s (%s) - Read error at byte %s/%s (%s). %s (%s) - written to stdout %s[%s/%s] %s (%s) - written to stdout %s[%s] %s ERROR %d: %s. %s URL: %s %2d %s %s has sprung into existence. %s request sent, awaiting response... %s: %s, closing control connection. %s: %s: Failed to allocate %ld bytes; memory exhausted. %s: %s: Failed to allocate enough memory; memory exhausted. %s: %s: Invalid boolean %s; use `on' or `off'. %s: %s: Invalid byte value %s %s: %s: Invalid header %s. %s: %s: Invalid number %s. %s: %s: Invalid progress type %s. %s: %s: Invalid restriction %s, use [unix|windows],[lowercase|uppercase],[nocontrol],[ascii]. %s: %s: Invalid time period %s %s: %s: Invalid value %s. %s: %s:%d: unknown token "%s" %s: %s:%d: warning: %s token appears before any machine name %s: %s; disabling logging. %s: Cannot read %s (%s). %s: Cannot resolve incomplete link %s. %s: Couldn't find usable socket driver. %s: Error in %s at line %d. %s: Invalid --execute command %s %s: Invalid URL %s: %s %s: No certificate presented by %s. %s: Syntax error in %s at line %d. %s: The certificate of %s has been revoked. %s: The certificate of %s hasn't got a known issuer. %s: The certificate of %s is not trusted. %s: Unknown command %s in %s at line %d. %s: WGETRC points to %s, which doesn't exist. %s: Warning: Both system and user wgetrc point to %s. %s: aprintf: text buffer is too big (%ld bytes), aborting. %s: cannot stat %s: %s %s: cannot verify %s's certificate, issued by %s: %s: corrupt time-stamp. %s: illegal option -- `-n%c' %s: invalid option -- '%c' %s: missing URL %s: no certificate subject alternative name matches requested host name %s. %s: option '%c%s' doesn't allow an argument %s: option '--%s' doesn't allow an argument %s: option '--%s' requires an argument %s: option '-W %s' doesn't allow an argument %s: option '-W %s' is ambiguous %s: option '-W %s' requires an argument %s: option requires an argument -- '%c' %s: unable to resolve bind address %s; disabling bind. %s: unable to resolve host address %s %s: unknown/unsupported file type. %s: unrecognized option '%c%s' %s: unrecognized option '--%s' '(no description)(try:%2d), %s (%s) remaining, %s remaining-k can be used together with -O only if outputting to a regular file. ==> CWD not needed. ==> CWD not required. Already have correct symlink %s -> %s Authorization failed. Bad port numberBind error (%s). Can't be verbose and quiet at the same time. Can't timestamp and not clobber old files at the same time. Cannot back up %s as %s: %s Cannot convert links in %s: %s Cannot get REALTIME clock frequency: %s Cannot initiate PASV transfer. Cannot open %s: %sCannot open cookies file %s: %s Cannot parse PASV response. Cannot specify both --ask-password and --password. Cannot specify both --inet4-only and --inet6-only. Cannot specify both -k and -O if multiple URLs are given, or in combination with -p or -r. See the manual for details. Cannot write to %s (%s). Compile: Connecting to %s:%d... Connecting to %s|%s|:%d... Continuing in background, pid %d. Continuing in background, pid %lu. Continuing in background. Control connection closed. Conversion from %s to %s isn't supported Converted %d files in %s seconds. Converting %s... Cookie coming from %s attempted to set domain to %s Copyright (C) 2009 Free Software Foundation, Inc. Could not seed PRNG; consider using --random-file. Creating symlink %s -> %s Data transfer aborted. Directories: Directory Disabling SSL due to encountered errors. Download quota of %s EXCEEDED! Download: ERRORERROR: Cannot open directory %s. ERROR: Redirection (%d) without location. Encoding %s isn't valid Error closing %s: %s Error in proxy URL %s: Must be HTTP. Error in server greeting. Error in server response, closing control connection. Error initializing X509 certificate: %s Error matching %s against %s: %s Error parsing certificate: %s Error parsing proxy URL %s: %s. Error writing to %s: %s FTP options: Failed reading proxy response: %s Failed to unlink symlink %s: %s Failed writing HTTP request: %s. File File %s already there; not retrieving. File %s already there; not retrieving. File %s exists. File `%s' already there; not retrieving. File has already been retrieved. Found %d broken link. Found %d broken links. Found no broken links. GNU Wget %s built on %s. GNU Wget %s, a non-interactive network retriever. Giving up. HTTP options: HTTPS (SSL/TLS) options: HTTPS support not compiled inIPv6 addresses not supportedIncomplete or invalid multibyte sequence encountered Index of /%s on %s:%dInvalid IPv6 numeric addressInvalid PORT. Invalid dot style specification %s; leaving unchanged. Invalid host nameInvalid name of the symlink, skipping. Invalid user nameLast-modified header invalid -- time-stamp ignored. Last-modified header missing -- time-stamps turned off. Length: Length: %sLicense GPLv3+: GNU GPL version 3 or later . This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. Link Link: Loading robots.txt; please ignore errors. Locale: Location: %s%s Logged in! Logging and input file: Logging in as %s ... Login incorrect. Mail bug reports and suggestions to . Malformed status lineMandatory arguments to long options are mandatory for short options too. No URLs found in %s. No certificate found No data received. No errorNo headers, assuming HTTP/0.9No matches on pattern %s. No such directory %s. No such file %s. No such file %s. No such file or directory %s. Not descending to %s as it is excluded/not-included. Not sure Output will be written to %s. POST data file %s missing: %s Password for user %s: Password: Please send bug reports and questions to . Proxy tunneling failed: %sRead error (%s) in headers. Recursion depth %d exceeded max. depth %d. Recursive accept/reject: Recursive download: Rejecting %s. Remote file does not exist -- broken link!!! Remote file exists and could contain further links, but recursion is disabled -- not retrieving. Remote file exists and could contain links to other resources -- retrieving. Remote file exists but does not contain any link -- not retrieving. Remote file exists. Remote file is newer than local file %s -- retrieving. Remote file is newer, retrieving. Remote file no newer than local file %s -- not retrieving. Removed %s. Removing %s since it should be rejected. Removing %s. Resolving %s... Retrying. Reusing existing connection to %s:%d. Saving to: %s Scheme missingServer error, can't determine system type. Server file no newer than local file %s -- not retrieving. Skipping directory %s. Spider mode enabled. Check if remote file exists. Startup: Symlinks not supported, skipping symlink %s. Syntax error in Set-Cookie: %s at position %d. Temporary failure in name resolutionThe certificate has expired The certificate has not yet been activated The certificate's owner does not match hostname %s The server refuses login. The sizes do not match (local %s) -- retrieving. The sizes do not match (local %s) -- retrieving. This version does not have support for IRIs To connect to %s insecurely, use `--no-check-certificate'. Try `%s --help' for more options. Unable to delete %s: %s Unable to establish SSL connection. Unhandled errno %d Unknown authentication scheme. Unknown errorUnknown hostUnknown system errorUnknown type `%c', closing control connection. Unsupported listing type, trying Unix listing parser. Unsupported scheme %sUnterminated IPv6 numeric addressUsage: %s NETRC [HOSTNAME] Usage: %s [OPTION]... [URL]... Using %s as listing tmp file. WARNINGWARNING: combining -O with -r or -p will mean that all downloaded content will be placed in the single file you specified. WARNING: timestamping does nothing in combination with -O. See the manual for details. WARNING: using a weak random seed. Warning: wildcards not supported in HTTP. Wgetrc: Will not retrieve dirs since depth is %d (max %d). Write failed, closing control connection. Wrote HTML-ized index to %s [%s]. Wrote HTML-ized index to %s. `connected. couldn't connect to %s port %d: %s done. done. done. failed: %s. failed: No IPv4/IPv6 addresses for host. failed: timed out. idn_decode failed (%d): %s idn_encode failed (%d): %s ignoredlocale_to_utf8: locale is unset memory exhaustednothing to do. time unknown unspecifiedProject-Id-Version: wget 1.12-pre7 Report-Msgid-Bugs-To: bug-wget@gnu.org POT-Creation-Date: 2011-09-13 10:17+0200 PO-Revision-Date: 2011-01-09 07:03+0100 Last-Translator: Keld Simonsen Language-Team: Danish Language: da MIME-Version: 1.0 Content-Type: text/plain; charset=iso-8859-1 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=2; plural=(n != 1); Filen er allerede fuldt overfrt; ingen handling ndvendig. %*s[ springer over %sK ] %s modtaget, omdirigerer udskrift til %s. %s modtaget. Oprindeligt skrevet af Hrvoje Niksic . Fejl ved REST, starter forfra. --ask-password bed om adgangskoder. --auth-no-challenge send basal HTTP-autentifikationsinformation