# PaCkAgE DaTaStReAm gobject-introspection 1 21677 # end of header 070701000a2809000081a40000000000000000000000014f83d4aa0000013f0000010000010007ffffffffffffffff0000001e00000000gobject-introspection/pkginfoPKG=gobject-introspection NAME=gobject-introspection 1.32.0 SPARC 64bit Solaris 10 VERSION=1.32.0 PSTAMP=10th April 2012 VENDOR=GNOME Project EMAIL=http://live.gnome.org/GObjectIntrospection DESC=GNOME object binding infrastructure ARCH=sparc CATEGORY=utility CLASSES=none BASEDIR=/ ISTATES=S s 1 2 3 RSTATES=S s 1 2 3 070701000a2808000081a40000000000000000000000014f83d4aa0000575c0000010000010007ffffffffffffffff0000001d00000000gobject-introspection/pkgmap: 1 21677 1 d none /usr ? ? ? 1 d none /usr/local ? ? ? 1 d none /usr/local/bin 0755 root root 1 f none /usr/local/bin/g-ir-annotation-tool 0755 root root 1549 65075 1334039713 1 f none /usr/local/bin/g-ir-compiler 0755 root root 402352 54317 1334039712 1 f none /usr/local/bin/g-ir-generate 0755 root root 62864 2885 1334039712 1 f none /usr/local/bin/g-ir-scanner 0755 root root 1542 64128 1334039713 1 d none /usr/local/include 0755 root root 1 d none /usr/local/include/gobject-introspection-1.0 0755 root root 1 f none /usr/local/include/gobject-introspection-1.0/giarginfo.h 0644 root root 2278 43227 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/gibaseinfo.h 0644 root root 3201 39896 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/gicallableinfo.h 0644 root root 3015 20275 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/giconstantinfo.h 0644 root root 1603 62713 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/gienuminfo.h 0644 root root 2009 29300 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/gifieldinfo.h 0644 root root 1903 17341 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/gifunctioninfo.h 0644 root root 2610 11680 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/giinterfaceinfo.h 0644 root root 2822 22962 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/giobjectinfo.h 0644 root root 5273 31507 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/gipropertyinfo.h 0644 root root 1519 60035 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/giregisteredtypeinfo.h 0644 root root 2166 45040 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/girepository.h 0644 root root 6432 61786 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/girffi.h 0644 root root 3142 23498 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/gisignalinfo.h 0644 root root 1534 60005 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/gistructinfo.h 0644 root root 1998 30302 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/gitypeinfo.h 0644 root root 2163 39435 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/gitypelib.h 0644 root root 2050 21982 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/gitypes.h 0644 root root 12249 50977 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/giunioninfo.h 0644 root root 2231 45129 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/givfuncinfo.h 0644 root root 2350 39599 1334039716 1 d none /usr/local/lib 0755 root root 1 d none /usr/local/lib/girepository-1.0 0755 root root 1 f none /usr/local/lib/girepository-1.0/DBus-1.0.typelib 0644 root root 712 25619 1334039716 1 f none /usr/local/lib/girepository-1.0/DBusGLib-1.0.typelib 0644 root root 544 17328 1334039716 1 f none /usr/local/lib/girepository-1.0/GIRepository-2.0.typelib 0644 root root 23628 40652 1334039716 1 f none /usr/local/lib/girepository-1.0/GL-1.0.typelib 0644 root root 948 23782 1334039716 1 f none /usr/local/lib/girepository-1.0/GLib-2.0.typelib 0644 root root 160236 64054 1334039716 1 f none /usr/local/lib/girepository-1.0/GModule-2.0.typelib 0644 root root 1340 63319 1334039716 1 f none /usr/local/lib/girepository-1.0/GObject-2.0.typelib 0644 root root 51164 61258 1334039716 1 f none /usr/local/lib/girepository-1.0/Gio-2.0.typelib 0644 root root 290476 25721 1334039716 1 f none /usr/local/lib/girepository-1.0/cairo-1.0.typelib 0644 root root 1624 14906 1334039716 1 f none /usr/local/lib/girepository-1.0/fontconfig-2.0.typelib 0644 root root 348 8732 1334039716 1 f none /usr/local/lib/girepository-1.0/freetype2-2.0.typelib 0644 root root 420 12209 1334039716 1 f none /usr/local/lib/girepository-1.0/libxml2-2.0.typelib 0644 root root 668 15848 1334039716 1 f none /usr/local/lib/girepository-1.0/xfixes-4.0.typelib 0644 root root 240 6029 1334039716 1 f none /usr/local/lib/girepository-1.0/xft-2.0.typelib 0644 root root 464 11881 1334039716 1 f none /usr/local/lib/girepository-1.0/xlib-2.0.typelib 0644 root root 836 23681 1334039716 1 f none /usr/local/lib/girepository-1.0/xrandr-1.3.typelib 0644 root root 640 21970 1334039716 1 d none /usr/local/lib/gobject-introspection 0755 root root 1 d none /usr/local/lib/gobject-introspection/giscanner 0755 root root 1 f none /usr/local/lib/gobject-introspection/giscanner/__init__.py 0644 root root 1017 20266 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/__init__.pyc 0644 root root 373 22266 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/__init__.pyo 0644 root root 373 22266 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/_giscanner.a 0644 root root 175792 63943 1334039713 1 f none /usr/local/lib/gobject-introspection/giscanner/_giscanner.la 0755 root root 1222 43271 1334039713 1 f none /usr/local/lib/gobject-introspection/giscanner/_giscanner.so 0755 root root 129904 17392 1334039713 1 f none /usr/local/lib/gobject-introspection/giscanner/annotationmain.py 0644 root root 2735 17720 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/annotationmain.pyc 0644 root root 1950 50591 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/annotationmain.pyo 0644 root root 1950 50591 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/annotationparser.py 0644 root root 22775 14213 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/annotationparser.pyc 0644 root root 18222 25987 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/annotationparser.pyo 0644 root root 18151 23762 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/ast.py 0644 root root 34922 55472 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/ast.pyc 0644 root root 38026 33564 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/ast.pyo 0644 root root 37205 63726 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/cachestore.py 0644 root root 5954 54401 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/cachestore.pyc 0644 root root 5280 65118 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/cachestore.pyo 0644 root root 5280 65118 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/codegen.py 0644 root root 4948 49053 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/codegen.pyc 0644 root root 5214 4281 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/codegen.pyo 0644 root root 5154 1297 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/docmain.py 0644 root root 2186 47670 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/docmain.pyc 0644 root root 1538 23910 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/docmain.pyo 0644 root root 1538 23910 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/dumper.py 0644 root root 10631 29987 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/dumper.pyc 0644 root root 8353 61297 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/dumper.pyo 0644 root root 8353 61297 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/gdumpparser.py 0644 root root 21954 59071 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/gdumpparser.pyc 0644 root root 18610 10626 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/gdumpparser.pyo 0644 root root 18473 3866 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/girparser.py 0644 root root 24606 42714 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/girparser.pyc 0644 root root 21525 54079 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/girparser.pyo 0644 root root 21009 27967 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/girwriter.py 0644 root root 24554 41870 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/girwriter.pyc 0644 root root 22165 36295 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/girwriter.pyo 0644 root root 21954 26532 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/introspectablepass.py 0644 root root 9323 37 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/introspectablepass.pyc 0644 root root 7385 7027 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/introspectablepass.pyo 0644 root root 7346 4090 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/libtoolimporter.py 0644 root root 2467 345 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/libtoolimporter.pyc 0644 root root 2278 57495 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/libtoolimporter.pyo 0644 root root 2278 57495 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/maintransformer.py 0644 root root 55890 27344 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/maintransformer.pyc 0644 root root 39799 54525 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/maintransformer.pyo 0644 root root 39675 49363 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-C-class.tmpl 0644 root root 1517 60158 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-C-default.tmpl 0644 root root 309 25670 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-C-enum.tmpl 0644 root root 361 30034 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-C-function.tmpl 0644 root root 2277 58359 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-C-namespace.tmpl 0644 root root 611 51310 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-C-property.tmpl 0644 root root 464 39451 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-C-record.tmpl 0644 root root 362 30190 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-C-signal.tmpl 0644 root root 461 38983 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-C-vfunc.tmpl 0644 root root 864 7684 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-Python-class.tmpl 0644 root root 2109 49124 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-Python-default.tmpl 0644 root root 289 23764 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-Python-enum.tmpl 0644 root root 588 49151 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-Python-function.tmpl 0644 root root 2199 52581 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-Python-namespace.tmpl 0644 root root 560 46522 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-Python-property.tmpl 0644 root root 679 57965 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-Python-record.tmpl 0644 root root 353 29013 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-Python-signal.tmpl 0644 root root 1581 4907 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-Python-vfunc.tmpl 0644 root root 1447 57820 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallardwriter.py 0644 root root 9924 27033 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallardwriter.pyc 0644 root root 9389 37164 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallardwriter.pyo 0644 root root 9389 37164 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/message.py 0644 root root 6025 16942 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/message.pyc 0644 root root 6730 29928 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/message.pyo 0644 root root 6730 29928 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/odict.py 0644 root root 1380 47279 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/odict.pyc 0644 root root 1455 10544 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/odict.pyo 0644 root root 1455 10544 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/scannermain.py 0644 root root 18675 34980 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/scannermain.pyc 0644 root root 14877 23684 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/scannermain.pyo 0644 root root 14877 23684 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/shlibs.py 0644 root root 4946 9991 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/shlibs.pyc 0644 root root 3006 30523 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/shlibs.pyo 0644 root root 3006 30523 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/sourcescanner.py 0644 root root 8687 61015 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/sourcescanner.pyc 0644 root root 11226 5289 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/sourcescanner.pyo 0644 root root 11172 1442 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/testcodegen.py 0644 root root 5139 56602 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/testcodegen.pyc 0644 root root 3421 46376 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/testcodegen.pyo 0644 root root 3382 43947 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/transformer.py 0644 root root 36400 50415 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/transformer.pyc 0644 root root 30065 40747 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/transformer.pyo 0644 root root 29924 34586 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/utils.py 0644 root root 4560 42172 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/utils.pyc 0644 root root 4129 43390 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/utils.pyo 0644 root root 4129 43390 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/xmlwriter.py 0644 root root 6059 8868 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/xmlwriter.pyc 0644 root root 6201 53338 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/xmlwriter.pyo 0644 root root 6086 47417 1334039715 1 f none /usr/local/lib/libgirepository-1.0.a 0644 root root 737128 12356 1334039712 1 f none /usr/local/lib/libgirepository-1.0.la 0755 root root 1346 53173 1334039712 1 s none /usr/local/lib/libgirepository-1.0.so=libgirepository-1.0.so.1.0.0 1 s none /usr/local/lib/libgirepository-1.0.so.1=libgirepository-1.0.so.1.0.0 1 f none /usr/local/lib/libgirepository-1.0.so.1.0.0 0755 root root 498272 12398 1334039712 1 d none /usr/local/lib/pkgconfig 0755 root root 1 f none /usr/local/lib/pkgconfig/gobject-introspection-1.0.pc 0644 root root 628 58097 1334039716 1 f none /usr/local/lib/pkgconfig/gobject-introspection-no-export-1.0.pc 0644 root root 591 54622 1334039716 1 d none /usr/local/share 0755 root root 1 d none /usr/local/share/aclocal 0755 root root 1 f none /usr/local/share/aclocal/introspection.m4 0644 root root 3550 14345 1334039716 1 d none /usr/local/share/gir-1.0 0755 root root 1 f none /usr/local/share/gir-1.0/DBus-1.0.gir 0644 root root 1185 26843 1334039716 1 f none /usr/local/share/gir-1.0/DBusGLib-1.0.gir 0644 root root 797 385 1334039716 1 f none /usr/local/share/gir-1.0/GIRepository-2.0.gir 0644 root root 158846 44039 1334039716 1 f none /usr/local/share/gir-1.0/GL-1.0.gir 0644 root root 1122 23974 1334039716 1 f none /usr/local/share/gir-1.0/GLib-2.0.gir 0644 root root 1746701 53770 1334039716 1 f none /usr/local/share/gir-1.0/GModule-2.0.gir 0644 root root 5450 32159 1334039716 1 f none /usr/local/share/gir-1.0/GObject-2.0.gir 0644 root root 561848 49085 1334039716 1 f none /usr/local/share/gir-1.0/Gio-2.0.gir 0644 root root 2965491 49570 1334039716 1 f none /usr/local/share/gir-1.0/cairo-1.0.gir 0644 root root 2894 37779 1334039716 1 f none /usr/local/share/gir-1.0/fontconfig-2.0.gir 0644 root root 620 49555 1334039716 1 f none /usr/local/share/gir-1.0/freetype2-2.0.gir 0644 root root 768 60870 1334039716 1 f none /usr/local/share/gir-1.0/libxml2-2.0.gir 0644 root root 938 10158 1334039716 1 f none /usr/local/share/gir-1.0/xfixes-4.0.gir 0644 root root 361 29297 1334039716 1 f none /usr/local/share/gir-1.0/xft-2.0.gir 0644 root root 745 59386 1334039716 1 f none /usr/local/share/gir-1.0/xlib-2.0.gir 0644 root root 2325 52501 1334039716 1 f none /usr/local/share/gir-1.0/xrandr-1.3.gir 0644 root root 808 3372 1334039716 1 d none /usr/local/share/gobject-introspection-1.0 0755 root root 1 f none /usr/local/share/gobject-introspection-1.0/Makefile.introspection 0644 root root 7026 55434 1334039715 1 f none /usr/local/share/gobject-introspection-1.0/gdump.c 0644 root root 14770 50019 1334039715 1 d none /usr/local/share/gobject-introspection-1.0/tests 0755 root root 1 f none /usr/local/share/gobject-introspection-1.0/tests/everything.c 0644 root root 18770 45254 1334039718 1 f none /usr/local/share/gobject-introspection-1.0/tests/everything.h 0644 root root 5697 61358 1334039718 1 f none /usr/local/share/gobject-introspection-1.0/tests/gimarshallingtests.c 0644 root root 107450 54619 1334039718 1 f none /usr/local/share/gobject-introspection-1.0/tests/gimarshallingtests.h 0644 root root 39589 47686 1334039718 1 f none /usr/local/share/gobject-introspection-1.0/tests/regress.c 0644 root root 80584 21100 1334039718 1 f none /usr/local/share/gobject-introspection-1.0/tests/regress.h 0644 root root 28917 7364 1334039718 1 d none /usr/local/share/gtk-doc 0755 root root 1 d none /usr/local/share/gtk-doc/html 0755 root root 1 d none /usr/local/share/gtk-doc/html/gi 0755 root root 1 f none /usr/local/share/gtk-doc/html/gi/annotation-glossary.html 0644 root root 2828 38074 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIArgInfo.html 0644 root root 26337 5173 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIBaseInfo.html 0644 root root 39432 49821 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GICallableInfo.html 0644 root root 25556 52384 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIConstantInfo.html 0644 root root 8275 48350 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIEnumInfo.html 0644 root root 15143 28489 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIFieldInfo.html 0644 root root 17306 4486 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIFunctionInfo.html 0644 root root 22195 33535 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIInterfaceInfo.html 0644 root root 34310 46149 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIObjectInfo.html 0644 root root 65977 906 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIPropertyInfo.html 0644 root root 9131 59019 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIRegisteredTypeInfo.html 0644 root root 10864 15406 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GISignalInfo.html 0644 root root 8893 35398 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIStructInfo.html 0644 root root 18077 29457 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GITypeInfo.html 0644 root root 26443 42573 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIUnionInfo.html 0644 root root 22291 53548 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIVFuncInfo.html 0644 root root 12410 64710 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-ffi.html 0644 root root 1815 21254 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-gierrordomaininfo.html 0644 root root 2459 11248 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-gir-reference.html 0644 root root 10901 4570 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-gir.html 0644 root root 1776 18216 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-girepository.html 0644 root root 67690 26724 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-girffi.html 0644 root root 16531 33903 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-gtypelib.html 0644 root root 93168 25238 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-libgirepository.html 0644 root root 1811 22001 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-overview.html 0644 root root 2768 37816 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-repository-structs.html 0644 root root 4696 22289 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-struct-hierarchy.html 0644 root root 3544 37371 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-typelib.html 0644 root root 1770 18079 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi.devhelp2 0644 root root 42359 42030 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/girepository.html 0644 root root 5209 2640 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/glib.html 0644 root root 1842 24797 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/home.png 0644 root root 654 8089 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/index.html 0644 root root 5514 31633 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/index.sgml 0644 root root 42722 39776 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/left.png 0644 root root 459 49669 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/overview.png 0644 root root 112776 44664 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/right.png 0644 root root 472 50613 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/style.css 0644 root root 5184 22070 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/up.png 0644 root root 406 41501 1334039717 1 d none /usr/local/share/man 0755 root root 1 d none /usr/local/share/man/man1 0755 root root 1 f none /usr/local/share/man/man1/g-ir-compiler.1 0644 root root 1418 53528 1334039716 1 f none /usr/local/share/man/man1/g-ir-generate.1 0644 root root 737 61952 1334039716 1 f none /usr/local/share/man/man1/g-ir-scanner.1 0644 root root 5052 52527 1334039716 1 i checkinstall 785 2565 1334039722 1 i pkginfo 319 25797 1334039722 07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!070701000a2809000081a40000000000000000000000014f83d4aa0000013f0000010000010007ffffffffffffffff0000000800000000pkginfoPKG=gobject-introspection NAME=gobject-introspection 1.32.0 SPARC 64bit Solaris 10 VERSION=1.32.0 PSTAMP=10th April 2012 VENDOR=GNOME Project EMAIL=http://live.gnome.org/GObjectIntrospection DESC=GNOME object binding infrastructure ARCH=sparc CATEGORY=utility CLASSES=none BASEDIR=/ ISTATES=S s 1 2 3 RSTATES=S s 1 2 3 070701000a2808000081a40000000000000000000000014f83d4aa0000575c0000010000010007ffffffffffffffff0000000700000000pkgmap: 1 21677 1 d none /usr ? ? ? 1 d none /usr/local ? ? ? 1 d none /usr/local/bin 0755 root root 1 f none /usr/local/bin/g-ir-annotation-tool 0755 root root 1549 65075 1334039713 1 f none /usr/local/bin/g-ir-compiler 0755 root root 402352 54317 1334039712 1 f none /usr/local/bin/g-ir-generate 0755 root root 62864 2885 1334039712 1 f none /usr/local/bin/g-ir-scanner 0755 root root 1542 64128 1334039713 1 d none /usr/local/include 0755 root root 1 d none /usr/local/include/gobject-introspection-1.0 0755 root root 1 f none /usr/local/include/gobject-introspection-1.0/giarginfo.h 0644 root root 2278 43227 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/gibaseinfo.h 0644 root root 3201 39896 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/gicallableinfo.h 0644 root root 3015 20275 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/giconstantinfo.h 0644 root root 1603 62713 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/gienuminfo.h 0644 root root 2009 29300 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/gifieldinfo.h 0644 root root 1903 17341 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/gifunctioninfo.h 0644 root root 2610 11680 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/giinterfaceinfo.h 0644 root root 2822 22962 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/giobjectinfo.h 0644 root root 5273 31507 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/gipropertyinfo.h 0644 root root 1519 60035 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/giregisteredtypeinfo.h 0644 root root 2166 45040 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/girepository.h 0644 root root 6432 61786 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/girffi.h 0644 root root 3142 23498 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/gisignalinfo.h 0644 root root 1534 60005 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/gistructinfo.h 0644 root root 1998 30302 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/gitypeinfo.h 0644 root root 2163 39435 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/gitypelib.h 0644 root root 2050 21982 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/gitypes.h 0644 root root 12249 50977 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/giunioninfo.h 0644 root root 2231 45129 1334039716 1 f none /usr/local/include/gobject-introspection-1.0/givfuncinfo.h 0644 root root 2350 39599 1334039716 1 d none /usr/local/lib 0755 root root 1 d none /usr/local/lib/girepository-1.0 0755 root root 1 f none /usr/local/lib/girepository-1.0/DBus-1.0.typelib 0644 root root 712 25619 1334039716 1 f none /usr/local/lib/girepository-1.0/DBusGLib-1.0.typelib 0644 root root 544 17328 1334039716 1 f none /usr/local/lib/girepository-1.0/GIRepository-2.0.typelib 0644 root root 23628 40652 1334039716 1 f none /usr/local/lib/girepository-1.0/GL-1.0.typelib 0644 root root 948 23782 1334039716 1 f none /usr/local/lib/girepository-1.0/GLib-2.0.typelib 0644 root root 160236 64054 1334039716 1 f none /usr/local/lib/girepository-1.0/GModule-2.0.typelib 0644 root root 1340 63319 1334039716 1 f none /usr/local/lib/girepository-1.0/GObject-2.0.typelib 0644 root root 51164 61258 1334039716 1 f none /usr/local/lib/girepository-1.0/Gio-2.0.typelib 0644 root root 290476 25721 1334039716 1 f none /usr/local/lib/girepository-1.0/cairo-1.0.typelib 0644 root root 1624 14906 1334039716 1 f none /usr/local/lib/girepository-1.0/fontconfig-2.0.typelib 0644 root root 348 8732 1334039716 1 f none /usr/local/lib/girepository-1.0/freetype2-2.0.typelib 0644 root root 420 12209 1334039716 1 f none /usr/local/lib/girepository-1.0/libxml2-2.0.typelib 0644 root root 668 15848 1334039716 1 f none /usr/local/lib/girepository-1.0/xfixes-4.0.typelib 0644 root root 240 6029 1334039716 1 f none /usr/local/lib/girepository-1.0/xft-2.0.typelib 0644 root root 464 11881 1334039716 1 f none /usr/local/lib/girepository-1.0/xlib-2.0.typelib 0644 root root 836 23681 1334039716 1 f none /usr/local/lib/girepository-1.0/xrandr-1.3.typelib 0644 root root 640 21970 1334039716 1 d none /usr/local/lib/gobject-introspection 0755 root root 1 d none /usr/local/lib/gobject-introspection/giscanner 0755 root root 1 f none /usr/local/lib/gobject-introspection/giscanner/__init__.py 0644 root root 1017 20266 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/__init__.pyc 0644 root root 373 22266 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/__init__.pyo 0644 root root 373 22266 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/_giscanner.a 0644 root root 175792 63943 1334039713 1 f none /usr/local/lib/gobject-introspection/giscanner/_giscanner.la 0755 root root 1222 43271 1334039713 1 f none /usr/local/lib/gobject-introspection/giscanner/_giscanner.so 0755 root root 129904 17392 1334039713 1 f none /usr/local/lib/gobject-introspection/giscanner/annotationmain.py 0644 root root 2735 17720 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/annotationmain.pyc 0644 root root 1950 50591 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/annotationmain.pyo 0644 root root 1950 50591 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/annotationparser.py 0644 root root 22775 14213 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/annotationparser.pyc 0644 root root 18222 25987 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/annotationparser.pyo 0644 root root 18151 23762 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/ast.py 0644 root root 34922 55472 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/ast.pyc 0644 root root 38026 33564 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/ast.pyo 0644 root root 37205 63726 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/cachestore.py 0644 root root 5954 54401 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/cachestore.pyc 0644 root root 5280 65118 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/cachestore.pyo 0644 root root 5280 65118 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/codegen.py 0644 root root 4948 49053 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/codegen.pyc 0644 root root 5214 4281 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/codegen.pyo 0644 root root 5154 1297 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/docmain.py 0644 root root 2186 47670 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/docmain.pyc 0644 root root 1538 23910 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/docmain.pyo 0644 root root 1538 23910 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/dumper.py 0644 root root 10631 29987 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/dumper.pyc 0644 root root 8353 61297 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/dumper.pyo 0644 root root 8353 61297 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/gdumpparser.py 0644 root root 21954 59071 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/gdumpparser.pyc 0644 root root 18610 10626 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/gdumpparser.pyo 0644 root root 18473 3866 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/girparser.py 0644 root root 24606 42714 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/girparser.pyc 0644 root root 21525 54079 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/girparser.pyo 0644 root root 21009 27967 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/girwriter.py 0644 root root 24554 41870 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/girwriter.pyc 0644 root root 22165 36295 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/girwriter.pyo 0644 root root 21954 26532 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/introspectablepass.py 0644 root root 9323 37 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/introspectablepass.pyc 0644 root root 7385 7027 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/introspectablepass.pyo 0644 root root 7346 4090 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/libtoolimporter.py 0644 root root 2467 345 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/libtoolimporter.pyc 0644 root root 2278 57495 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/libtoolimporter.pyo 0644 root root 2278 57495 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/maintransformer.py 0644 root root 55890 27344 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/maintransformer.pyc 0644 root root 39799 54525 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/maintransformer.pyo 0644 root root 39675 49363 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-C-class.tmpl 0644 root root 1517 60158 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-C-default.tmpl 0644 root root 309 25670 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-C-enum.tmpl 0644 root root 361 30034 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-C-function.tmpl 0644 root root 2277 58359 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-C-namespace.tmpl 0644 root root 611 51310 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-C-property.tmpl 0644 root root 464 39451 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-C-record.tmpl 0644 root root 362 30190 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-C-signal.tmpl 0644 root root 461 38983 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-C-vfunc.tmpl 0644 root root 864 7684 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-Python-class.tmpl 0644 root root 2109 49124 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-Python-default.tmpl 0644 root root 289 23764 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-Python-enum.tmpl 0644 root root 588 49151 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-Python-function.tmpl 0644 root root 2199 52581 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-Python-namespace.tmpl 0644 root root 560 46522 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-Python-property.tmpl 0644 root root 679 57965 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-Python-record.tmpl 0644 root root 353 29013 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-Python-signal.tmpl 0644 root root 1581 4907 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallard-Python-vfunc.tmpl 0644 root root 1447 57820 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallardwriter.py 0644 root root 9924 27033 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallardwriter.pyc 0644 root root 9389 37164 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/mallardwriter.pyo 0644 root root 9389 37164 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/message.py 0644 root root 6025 16942 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/message.pyc 0644 root root 6730 29928 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/message.pyo 0644 root root 6730 29928 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/odict.py 0644 root root 1380 47279 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/odict.pyc 0644 root root 1455 10544 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/odict.pyo 0644 root root 1455 10544 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/scannermain.py 0644 root root 18675 34980 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/scannermain.pyc 0644 root root 14877 23684 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/scannermain.pyo 0644 root root 14877 23684 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/shlibs.py 0644 root root 4946 9991 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/shlibs.pyc 0644 root root 3006 30523 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/shlibs.pyo 0644 root root 3006 30523 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/sourcescanner.py 0644 root root 8687 61015 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/sourcescanner.pyc 0644 root root 11226 5289 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/sourcescanner.pyo 0644 root root 11172 1442 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/testcodegen.py 0644 root root 5139 56602 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/testcodegen.pyc 0644 root root 3421 46376 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/testcodegen.pyo 0644 root root 3382 43947 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/transformer.py 0644 root root 36400 50415 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/transformer.pyc 0644 root root 30065 40747 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/transformer.pyo 0644 root root 29924 34586 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/utils.py 0644 root root 4560 42172 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/utils.pyc 0644 root root 4129 43390 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/utils.pyo 0644 root root 4129 43390 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/xmlwriter.py 0644 root root 6059 8868 1334039714 1 f none /usr/local/lib/gobject-introspection/giscanner/xmlwriter.pyc 0644 root root 6201 53338 1334039715 1 f none /usr/local/lib/gobject-introspection/giscanner/xmlwriter.pyo 0644 root root 6086 47417 1334039715 1 f none /usr/local/lib/libgirepository-1.0.a 0644 root root 737128 12356 1334039712 1 f none /usr/local/lib/libgirepository-1.0.la 0755 root root 1346 53173 1334039712 1 s none /usr/local/lib/libgirepository-1.0.so=libgirepository-1.0.so.1.0.0 1 s none /usr/local/lib/libgirepository-1.0.so.1=libgirepository-1.0.so.1.0.0 1 f none /usr/local/lib/libgirepository-1.0.so.1.0.0 0755 root root 498272 12398 1334039712 1 d none /usr/local/lib/pkgconfig 0755 root root 1 f none /usr/local/lib/pkgconfig/gobject-introspection-1.0.pc 0644 root root 628 58097 1334039716 1 f none /usr/local/lib/pkgconfig/gobject-introspection-no-export-1.0.pc 0644 root root 591 54622 1334039716 1 d none /usr/local/share 0755 root root 1 d none /usr/local/share/aclocal 0755 root root 1 f none /usr/local/share/aclocal/introspection.m4 0644 root root 3550 14345 1334039716 1 d none /usr/local/share/gir-1.0 0755 root root 1 f none /usr/local/share/gir-1.0/DBus-1.0.gir 0644 root root 1185 26843 1334039716 1 f none /usr/local/share/gir-1.0/DBusGLib-1.0.gir 0644 root root 797 385 1334039716 1 f none /usr/local/share/gir-1.0/GIRepository-2.0.gir 0644 root root 158846 44039 1334039716 1 f none /usr/local/share/gir-1.0/GL-1.0.gir 0644 root root 1122 23974 1334039716 1 f none /usr/local/share/gir-1.0/GLib-2.0.gir 0644 root root 1746701 53770 1334039716 1 f none /usr/local/share/gir-1.0/GModule-2.0.gir 0644 root root 5450 32159 1334039716 1 f none /usr/local/share/gir-1.0/GObject-2.0.gir 0644 root root 561848 49085 1334039716 1 f none /usr/local/share/gir-1.0/Gio-2.0.gir 0644 root root 2965491 49570 1334039716 1 f none /usr/local/share/gir-1.0/cairo-1.0.gir 0644 root root 2894 37779 1334039716 1 f none /usr/local/share/gir-1.0/fontconfig-2.0.gir 0644 root root 620 49555 1334039716 1 f none /usr/local/share/gir-1.0/freetype2-2.0.gir 0644 root root 768 60870 1334039716 1 f none /usr/local/share/gir-1.0/libxml2-2.0.gir 0644 root root 938 10158 1334039716 1 f none /usr/local/share/gir-1.0/xfixes-4.0.gir 0644 root root 361 29297 1334039716 1 f none /usr/local/share/gir-1.0/xft-2.0.gir 0644 root root 745 59386 1334039716 1 f none /usr/local/share/gir-1.0/xlib-2.0.gir 0644 root root 2325 52501 1334039716 1 f none /usr/local/share/gir-1.0/xrandr-1.3.gir 0644 root root 808 3372 1334039716 1 d none /usr/local/share/gobject-introspection-1.0 0755 root root 1 f none /usr/local/share/gobject-introspection-1.0/Makefile.introspection 0644 root root 7026 55434 1334039715 1 f none /usr/local/share/gobject-introspection-1.0/gdump.c 0644 root root 14770 50019 1334039715 1 d none /usr/local/share/gobject-introspection-1.0/tests 0755 root root 1 f none /usr/local/share/gobject-introspection-1.0/tests/everything.c 0644 root root 18770 45254 1334039718 1 f none /usr/local/share/gobject-introspection-1.0/tests/everything.h 0644 root root 5697 61358 1334039718 1 f none /usr/local/share/gobject-introspection-1.0/tests/gimarshallingtests.c 0644 root root 107450 54619 1334039718 1 f none /usr/local/share/gobject-introspection-1.0/tests/gimarshallingtests.h 0644 root root 39589 47686 1334039718 1 f none /usr/local/share/gobject-introspection-1.0/tests/regress.c 0644 root root 80584 21100 1334039718 1 f none /usr/local/share/gobject-introspection-1.0/tests/regress.h 0644 root root 28917 7364 1334039718 1 d none /usr/local/share/gtk-doc 0755 root root 1 d none /usr/local/share/gtk-doc/html 0755 root root 1 d none /usr/local/share/gtk-doc/html/gi 0755 root root 1 f none /usr/local/share/gtk-doc/html/gi/annotation-glossary.html 0644 root root 2828 38074 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIArgInfo.html 0644 root root 26337 5173 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIBaseInfo.html 0644 root root 39432 49821 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GICallableInfo.html 0644 root root 25556 52384 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIConstantInfo.html 0644 root root 8275 48350 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIEnumInfo.html 0644 root root 15143 28489 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIFieldInfo.html 0644 root root 17306 4486 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIFunctionInfo.html 0644 root root 22195 33535 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIInterfaceInfo.html 0644 root root 34310 46149 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIObjectInfo.html 0644 root root 65977 906 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIPropertyInfo.html 0644 root root 9131 59019 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIRegisteredTypeInfo.html 0644 root root 10864 15406 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GISignalInfo.html 0644 root root 8893 35398 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIStructInfo.html 0644 root root 18077 29457 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GITypeInfo.html 0644 root root 26443 42573 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIUnionInfo.html 0644 root root 22291 53548 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-GIVFuncInfo.html 0644 root root 12410 64710 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-ffi.html 0644 root root 1815 21254 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-gierrordomaininfo.html 0644 root root 2459 11248 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-gir-reference.html 0644 root root 10901 4570 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-gir.html 0644 root root 1776 18216 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-girepository.html 0644 root root 67690 26724 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-girffi.html 0644 root root 16531 33903 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-gtypelib.html 0644 root root 93168 25238 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-libgirepository.html 0644 root root 1811 22001 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-overview.html 0644 root root 2768 37816 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-repository-structs.html 0644 root root 4696 22289 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-struct-hierarchy.html 0644 root root 3544 37371 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi-typelib.html 0644 root root 1770 18079 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/gi.devhelp2 0644 root root 42359 42030 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/girepository.html 0644 root root 5209 2640 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/glib.html 0644 root root 1842 24797 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/home.png 0644 root root 654 8089 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/index.html 0644 root root 5514 31633 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/index.sgml 0644 root root 42722 39776 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/left.png 0644 root root 459 49669 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/overview.png 0644 root root 112776 44664 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/right.png 0644 root root 472 50613 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/style.css 0644 root root 5184 22070 1334039717 1 f none /usr/local/share/gtk-doc/html/gi/up.png 0644 root root 406 41501 1334039717 1 d none /usr/local/share/man 0755 root root 1 d none /usr/local/share/man/man1 0755 root root 1 f none /usr/local/share/man/man1/g-ir-compiler.1 0644 root root 1418 53528 1334039716 1 f none /usr/local/share/man/man1/g-ir-generate.1 0644 root root 737 61952 1334039716 1 f none /usr/local/share/man/man1/g-ir-scanner.1 0644 root root 5052 52527 1334039716 1 i checkinstall 785 2565 1334039722 1 i pkginfo 319 25797 1334039722 070701000a28ed000041ed0000000000000000000000024f83d4aa000000000000010000010007ffffffffffffffff0000000800000000install070701000a28ee000081ed0000000000000000000000014f83d4aa000003110000010000010007ffffffffffffffff0000001500000000install/checkinstall#!/bin/sh # expected_bits="64" expected_release="5.10" expected_platform="sparc" # release=`uname -r` platform=`uname -p` bits=`isainfo -b` # if [ ${platform} != ${expected_platform} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_platform} architecture\n" echo "\tAborting installation.\n\n\n" exit 1 fi if [ ${release} != ${expected_release} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_release} machine\n" echo "\tAborting installation.\n\n\n" exit 1 fi if [ ${bits} != ${expected_bits} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_bits} bit machine\n" echo "\tYour machine is running a ${bits} bit O.S. currently\n" echo "\tAborting installation.\n\n\n" exit 1 fi exit 0 070701000a280a000041ed0000000000000000000000034f83d4aa000000000000010000010007ffffffffffffffff0000000500000000root070701000a280b000041ed0000000000000000000000034f83d4aa000000000000010000010007ffffffffffffffff0000000900000000root/usr070701000a280c000041ed0000000000000000000000064f83d4aa000000000000010000010007ffffffffffffffff0000000f00000000root/usr/local070701000a280d000041ed0000000000000000000000024f83d4aa000000000000010000010007ffffffffffffffff0000001300000000root/usr/local/bin070701000a2811000081ed0000000000000000000000014f83d4a1000006060000010000010007ffffffffffffffff0000002000000000root/usr/local/bin/g-ir-scanner#!/usr/local/bin/python # -*- Mode: Python -*- # GObject-Introspection - a framework for introspecting GObject libraries # Copyright (C) 2008 Johan Dahlin # # This program is free software; you can redistribute it and/or # modify it under the terms of the GNU General Public License # as published by the Free Software Foundation; either version 2 # of the License, or (at your option) any later version. # # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA # 02110-1301, USA. # import os import sys import __builtin__ __builtin__.__dict__['DATADIR'] = "/usr/local/share" if 'GI_SCANNER_DEBUG' in os.environ: def on_exception(exctype, value, tb): print "Caught exception: %r %r" % (exctype, value) import pdb pdb.pm() sys.excepthook = on_exception srcdir = os.getenv('UNINSTALLED_INTROSPECTION_SRCDIR', None) if srcdir is not None: path = srcdir else: # This is a private directory, we don't want to pollute the global # namespace. path = os.path.join('/usr/local/lib', 'gobject-introspection') sys.path.insert(0, path) from giscanner.scannermain import scanner_main sys.exit(scanner_main(sys.argv)) 070701000a280e000081ed0000000000000000000000014f83d4a10000060d0000010000010007ffffffffffffffff0000002800000000root/usr/local/bin/g-ir-annotation-tool#!/usr/local/bin/python # -*- Mode: Python -*- # GObject-Introspection - a framework for introspecting GObject libraries # Copyright (C) 2008 Johan Dahlin # # This program is free software; you can redistribute it and/or # modify it under the terms of the GNU General Public License # as published by the Free Software Foundation; either version 2 # of the License, or (at your option) any later version. # # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA # 02110-1301, USA. # import os import sys import __builtin__ __builtin__.__dict__['DATADIR'] = "/usr/local/share" if 'GI_SCANNER_DEBUG' in os.environ: def on_exception(exctype, value, tb): print "Caught exception: %r %r" % (exctype, value) import pdb pdb.pm() sys.excepthook = on_exception srcdir=os.getenv('UNINSTALLED_INTROSPECTION_SRCDIR', None) if srcdir is not None: path = srcdir else: # This is a private directory, we don't want to pollute the global # namespace. path = os.path.join('/usr/local/lib', 'gobject-introspection') sys.path.insert(0, path) from giscanner.annotationmain import annotation_main sys.exit(annotation_main(sys.argv)) 070701000a2810000081ed0000000000000000000000014f83d4a00000f5900000010000010007ffffffffffffffff0000002100000000root/usr/local/bin/g-ir-generateELF+6@@8@@@Xffhh/usr/lib/sparcv9/ld.so.1 !"#$(*+-./012468:<=?ACDEFHIJKLMOPQSTWY]^`bcefhjklnopqruvwxyz|~  %&'),3579;>@BGNRUVXZ[\_adgimst{}#=@YrP@`0G a wH wx@4K`k`  f   6`7E`dr +;[`h@@  #`8?_ v   !' @@K@pu"` +@@ Wl!H@  `E@_@v@`@  '` @ } 8P     `  ` % e@ F a    @   @   :` S n  `   p  % C@ g   @   ` ` 2 ; Y n w {    `   $EMe{  `  r4@:g_interface_info_get_n_properties_PROCEDURE_LINKAGE_TABLE_g_interface_info_get_signalg_object_info_get_signalg_arg_info_is_optionalg_signal_info_get_flags__environ_lockg_object_info_get_n_propertiesg_base_info_is_deprecatedg_slist_lengthg_irepository_get_shared_libraryg_vfunc_info_get_flagsg_union_info_get_fieldg_irepository_get_n_infosg_object_info_get_class_structg_object_info_get_n_interfacesg_struct_info_get_n_fields_finig_field_info_get_flags_environg_type_initg_fprintfg_arg_info_is_caller_allocatesg_interface_info_get_n_methodsg_arg_info_may_be_nullg_callable_info_get_return_typeg_type_info_get_array_typeg_interface_info_get_n_signalsg_registered_type_info_get_type_init_etext__xargcg_arg_info_get_closureg_object_info_get_constant_start_exitg_base_info_iterate_attributesg_strv_lengthg_irepository_get_dependenciesg_slice_allocg_base_info_unrefg_type_info_get_param_typeg_type_info_get_tagg_freeg_interface_info_get_n_constantsg_irepository_get_versiong_object_info_get_vfunc__1cG__CrunMdo_exit_code6F_v_g_slist_prependg_callable_info_get_caller_ownsg_object_info_get_get_value_function_GLOBAL_OFFSET_TABLE_fcloseg_interface_info_get_iface_structg_value_info_get_valueg_object_info_get_ref_functiong_type_info_get_interfaceg_assertion_messageg_base_info_get_typeatexitg_callable_info_may_return_nullg_type_info_is_pointer_DYNAMICg_constant_info_get_typeg_enum_info_get_valueg_strdup_printfg_callable_info_iterate_return_attributesg_base_info_get_namespaceg_typelib_new_from_mapped_file__iobg_markup_vprintf_escapedg_printerrg_object_info_get_set_value_function_endg_function_info_get_symbolg_object_info_get_n_methodsg_logg_object_info_get_fundamentalg_log_set_always_fatalg_slice_free1_get_exit_frame_monitorfopeng_object_info_get_fieldg_type_tag_to_stringg_typelib_check_sanityg_base_info_get_nameg_union_info_get_methodg_struct_info_get_methodg_object_info_get_abstract__fsr_init_valueg_object_info_get_parentg_property_info_get_ownership_transferg_option_context_parseg_interface_info_get_n_prerequisitesg_irepository_get_defaultg_irepository_get_infog_object_info_get_n_constantsg_struct_info_get_sizeg_union_info_get_n_methodsg_struct_info_get_n_methodsg_property_info_get_typeg_arg_info_is_skipg_assertion_message_exprg_struct_info_is_foreigng_registered_type_info_get_type_nameg_enum_info_get_error_domaing_interface_info_get_method___errnog_vfunc_info_get_invokerg_interface_info_get_vfuncg_arg_info_get_directiong_field_info_get_typeg_object_info_get_propertyg_object_info_get_unref_functiong_object_info_get_n_fieldsg_interface_info_get_propertyg_irepository_prepend_search_pathg_callable_info_get_n_argsfflushg_strerrorg_mapped_file_newg_strfreevg_option_context_newg_irepository_get_c_prefixg_type_info_is_zero_terminatedg_enum_info_get_n_valuesg_object_info_get_n_vfuncsg_slist_delete_linkg_union_info_get_discriminator_offsetg_option_context_add_main_entriesg_property_info_get_flagsg_object_info_get_n_signals___Argvg_type_info_get_array_lengthg_interface_info_get_constantg_union_info_get_discriminator_typeg_callable_info_get_argg_callable_info_skip_returnstrcmpg_constant_info_get_valueg_interface_info_get_prerequisiteg_assertion_message_cmpstrg_irepository_load_typelibg_interface_info_get_n_vfuncsg_strdupg_union_info_is_discriminatedg_arg_info_get_scope_lib_versiong_strcmp0g_arg_info_is_return_valueg_strsplitg_field_info_get_offsetg_arg_info_get_typeg_object_info_get_methodg_union_info_get_sizeg_struct_info_is_gtype_structg_type_info_get_array_fixed_size__xargvg_vfunc_info_get_offsetg_field_info_get_sizeg_object_info_get_interfaceg_arg_info_get_ownership_transferg_arg_info_get_destroyg_union_info_get_n_fieldsg_struct_info_get_field_edatagir_writer_writeg_function_info_get_flagsfputsg_union_info_get_discriminatorlibc.so.1SUNW_0.7SUNWprivate_1.1libgirepository-1.0.so.1libm.so.2libgio-2.0.so.0libgmodule-2.0.so.0libsocket.so.1libresolv.so.2libgobject-2.0.so.0libgthread-2.0.so.0libglib-2.0.so.0libiconv.so.2libpcre.so.1libz.solibcurses.so.1libpthread.so.1libthread.so.1librt.so.1libintl.so.8libffi.so.5libdl.so.1/usr/local/libY =(c Nql(G1 =,$P V@~`_x|N F@a`&(-Q H@` 2i z@6`<WE;+ ?@U`*) :@I`%Dr A@`3>y @`q! @h`L k @d`jfY8 C@u`B o @^`gZO]t 9@J`4vTM @`s0c "@7``mw @`p. @` eXS n@{`'}/  @b`R [`+p (@ "``+p (@ r``+p '@ rcp, @`+p '' \H tH+``+p )' -`-#h `?-#h =--%#h #h#0@z`+p  @s#`*p ' Z#x `*p ' Z#@_@@ @_@e㽰A@cwg'w 'wwנ 'ww`]! `\@Otwwנww7wg@A @G@M`]@Pw@T_@W_ǀh `]!`]@RH _׀h _\ h_ס?`,0@I\@`_ס?`,0\o _\ h}w_ǡ?`,0\@@; h` ]_ǡ?`,0\@_\ @3 H_Ǡ`< ,0\@h_߀hH  @'@h`(]_ǡ?`,0\@_\ @ H@@ w@h `0]_\ @ H_GӒ@@ Ք_Ǡ`< ,0\@h_߀h`]!`8]@@" @’H `_ǡ?`,0\o >0w @@_@t!<,@ $w@w_@\ _ @ wwwwwww@__@\ @@0A@b<www_\`h\  4  H`@]̐@ %`,$`_`H]@\`* `P]_@_\ _@@_t A@a4www_\ h`X]`]``]@ f_ \`\ \`@@_t _@h@_ @@ H`X]`]`h]`p] ls@vs 4  H_`x]@C\`* `]_ @QH_`]I3@w_0w @w_t`t`w@@@A@bww_\ h`X]`]`]@ _\ h@_\ `] h@ _t @w__ @@A@aԮww@_ H`]@_@_ @@D0A@aDwwww_@_@ې@ H _`]@_@_`]@_@ A@`wwwww_`]h_____`]^0A@c@w'wH&_`]D_`]<_`]4`X]`] @rG O, < !!?D@$DdA@bԮwwww7_@Q_'@V_'G〥`H#_`] GӀHa]Hwa]w_`]__`]6`H`H_`]_`]@&G@_`]`Hpw_a]HH$a]Hwa ]Hwa(]HwH@_ O, < #b _D_h_`]~_@ @_'π H_a0]m@_'ˀ H_a8]`@_H_a@]U__G@_a]`H@_w_`]W__aH]__`]@_ǁ`H$_`]=_aP]_@ @@h__@@_`]e`H$_`]_aX]_@e @@h__@@z_`]@`H._`]_a`]_@@ @@h__@@U_@2 __@K_`]`H_`]_ah]_`]ap]@7@`X]ax]!R@՘|A@`wwwa]\r`\r`\r`\r`_@H Ǡ_a]t_a]_Q__a]_@OA@ cwwwa]\r`\r`\r`\r`_@ԖH Ǡ_a]2_a]___a]g_@OA@ bwwwww@_w@_'@_'@_'_a]_`]_GӠ H_a]GӠ H_a]GπH_a]_:_@__瀤h_a]@__@__@.@_`]_D`H Gˀ Ha]@@@wh @ H__@_H__g@_h@@@_a]A@ `wwww__@4_w_a]_@3__@7_H_a]4@4_H_a])______a]z@$_ H_a]- @_H_@@_a]_`]@-@@_H"H1@Hb]Hwb]w_a]_H_b]H@ H , < #`_D@H_a]@H_b]@H_b ]HH+_b(]H#_b0]H_b8]H@ː H , < #`_D@ H _b@]@@c@ H _bH]@@T@H_a]I_̒@w_5__a]@ɐ`@>_@O(_a]@_߁0A@ cwwww@_@<_w@_w@_'â@ ` ' `HbP]H `HbX]Hb`]__bh]__Ǣ@`H _bp]H  `H_bx]GÀH_b]GH_b]__]__ A@ a<wwww@ _@__b]_`]@H_b]__(__b]A@ `\wwww@ _w@_'@_w@_w@ _ H_b]j_b]H_H_b]\_`]:__׀@h _b]_/@GˀH_b]%@_'ǀH_b]__@_: '_D`H Hb]@@_'ÀH_b]@_@_' H/ @_H_@__@@ o@@_O @_H_@__@@ Y@@~_O_A@ atwwww@ _w@x_w@%__b]b]@q_ת_a]_@@ W@H_b]___b] A@ `d@wwwwH_b]_^D _b]_UL _b]_L _b]_CT _b]_: _b]_1D _c]_ '_b]_\ _c]_\ _c]_ (; [_c]_ ;[_`]_\ `X]c]"@ 3@ 7_"  O, < #bȠD@(Lp(LpA@ awwww@ _w@ 4_'_c ]_`]_@ }__c(]_@ {__&_`]___ __c ]@ A@ `twwww@ _w@ _'@ _w@ _w@ ?_w@ _ H _c0]mH_c8]e_`]C__πh _b]_8_ǀh_c@].GÀH_b]$__ @ _H_@ __a@@ @@ _O_A@bwwww@ %_w@ _@ o__cH]_`]_׀@H_b]`H _cP]H `H _cX]H  `H_c`] H_ch] H_cp] H_cx] @H_c]__3__cH]A@`wwww@ _w@ l_@ _'@ n_@ s_w_c]v_`]T_GˀH_b]J H_c]@`H _c]6H  `H_c]* H_b] _c]@_π@h _c]@ B@ ____c]`A@bwwww@ _w@ _@ i__c]_`]_׀@H_b] H_a] H_a] H_c] H_c]@ _S__(_@ _w___c]A@`̮wwww@ _w@ _'@ _'@ _'@ _w@ _w_c]_`]c_@ _w@h _c]_ߒ@@ _@ _w@h _c]_ϒ@@ _GH_c]9_b]_2_GH_c](@ x_wǀh_c]@ s_wǀh_`]@ n_wǀh_`]@ i_wǀh_`]GÀH_b]_m_@ W_ H' @ Q_H!_@ S_`]_aH]_U@_`]#@ U@@ 2_O @ <_H_@ >__@@ >@@ +_O @ 5_H_@ 7__@@ (@@ %_O @ /_H_@ 1__@@ @@ _O @ )_H_@ +__p@@@@ _O @ #_H_@ %__@@@@ _O @ _H_@ __@@А@@ _O_c]A@cDwwww@O_w@ _'@ _w@ _w_` ])_`(]___@ _wǀ@h _c]_@@_GÀH_b]_n_@ _ H# @ _H_@ ̒_`0]_aH]_V@_@Z@ @ _O @ _H_@ __@@D@ @ _O @ _H_@ __@@.@ @ _O @ _H_@ __@@@ @ _O @ _H_@ __@@@ @ _O @ _H_@ __@@@ @ _O_` ]A@cwwww@k_w@_'@_w@_w_`8]E_`]#__׀@h _`@]_@GˀH_b]@ V_: '_D`H Hb]@__@ I_H @ L_'@ Q__`H]_`P]G__Ԓ@_`H]6@h@ @ =_H_@ ?_@ Cw__͒@@S@_h@M@ "_O @ 4_H_@ 6__@@7@@ $_O_`8]СA@`ܮwww''@$w_@h`] H1wG뀤H `X]_@G@Hw@+@w_``]@ w߀h`]!`h]@ _@ B @@Ȕ@_@__ߺG" `p]>`x]U@`]4@_@ _wπ@h0 '\`h*_Gۡ,0\@`]@ ϔ w`]3@`]_\`\`@`]h@@ _Gۢ '_ϡ<`,0\o__@ w_@ w_@ Ēw`]@`]_@_h`]@۔_h`]@є_@ ' H^'_G@ H>@@HI@@HC@F@H=@j@H7@4@H1@@H+@@H%@n@H`]@@ @@H@"  O, < #`_ԠD@@Gנ GO'`]Ɛ@`x]@@,D\\tPPxml_end_elementxml_closewrite_ownership_transferwrite_type_infowrite_constant_valueno input files failed to read '%s': %sfailed to create typelib '%s': %sfailed to load typelib: %swarning, %d modules omitted shlibhandle typelib embedded in shliboutputoutput fileFILEincludedirinclude directories in GIR search pathallshow all available information> %*s<%sgirepository/girwriter.cxml->stack != NULLname == elem->name==%*s /> xml->stack == NULLFound unresolved type '%s' '%s' %s.%s %s="" transfer-ownership="none" transfer-ownership="container" transfer-ownership="full"type name="%s"anynonearrayGLib.ArrayGLib.PtrArrayGLib.ByteArray length="%d" fixed-size="%d" zero-terminated="1"name name="GLib.List" name="GLib.SList" name="GLib.HashTable" name="GLib.Error"Unhandled type tag %d attribute name="%s" value="%s"field readable="0" writable="1" bits="%d" branch="offset="%d"return-value allow-none="1" skip="1"parametersparameter direction="out" caller-allocates="%s"10 direction="inout" retval="1" optional="1" scope="call" scope="async" scope="notified" closure="%d" destroy="%d"constructormethodfunction name="%s" c:identifier="%s" type="setter" type="getter" deprecated="1" throws="1"callbackglib:boxed glib:name="%s"record glib:type-name="%s" glib:get-type="%s" glib:is-gtype-struct="1" size="%d" foreign="1"member%li%d%hi%hu%i%u%lu%fconstant value="enumerationbitfield glib:error-domain="%s"glib:signal when="FIRST" when="LAST" when="CLEANUP" no-recurse="1" detailed="1" action="1" no-hooks="1"virtual-method must-chain-up="1" override="always" override="never" offset="%d" invoker="%s"property construct="1" construct-only="1"classparentglib:type-struct abstract="1" glib:fundamental="1" glib:unref-function="%s" glib:ref-function="%s" glib:set-value-function="%s" glib:get-value-function="%s"implementsinterface name="%s" glib:type-name="%s" glib:get-type="%s"prerequisiteunion type-name="%s" get-type="%s"discriminator offset="%d" type="%s-%swfailed to open '%s': %s repository version="1.0" xmlns="http://www.gtk.org/introspection/core/1.0" xmlns:c="http://www.gtk.org/introspection/c/1.0" xmlns:glib="http://www.gtk.org/introspection/glib/1.0"-include name="%s" version="%s"namespace shared-library="%s" c:prefix="%s"unknown info type %d wxxx(xPxpyHyPyXy`yyyyyywywyzz z(z0z8zXzxwzzzzzzzzz{{ {8{@{X{p{{w{{{{{|||(|8|H|X|h|x|||||||}}}0}@}P}`}h}x}}}}}}}~~~8~X~h~x~~~~~~~~w~~~~(8HXhx 0HPXp 0hx (@P0o0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0ow`0oo0og0o_0oW0oO0oG 0o?@0o7`0o/0o'0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0ow`0oo0og0o_0oW0oO0oG 0o?@0o7`0o/0o'0o0o0o0o 0o@0o`0o0o0o0o0o 0o 0o @0o `0o 0o 0o 0o 0o 0o 0o @0ow `0oo 0og 0o_ 0oW 0oO 0oG 0o? @0o7 `0o/ 0o' 0o 0o 0o 0o 0o @0o `0o 0o 0o 0o 0o 0o 0o @0o `0o 0o 0o 0o 0o0o 0o@0ow`0oo0og0o_0oW0oO0oG 0o?@0o7`0o/0o'0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0ow`0oo0og0o_0oW0oO0oG 0o?@0o7`0o/| (5=L\kvY wx wx@  o o'o@(P( p oo`xxxoxxxxyy y@Xx@'( (8(P 6 wx w w whH`f#x@Sham w|m w  w x x x(( xP  xpHm w ;` 0[ ?$u @D~ y w  @p AH0 y( Ax z z  B  z( z0 Bx z8  zX  zx  w  Cp& z, z2 z8 z> zD zJ zP zV z\ {b { h {8n {@t {Xz {p { { w D  { { J  K { { { | | |(  Ld [l3 V(G |8M |HS |XY |h_ |xe |(k |q |w |} | | | } } }0 }@ O` }P }` }h }x  } } } } T` } }  } ~ ~( ~8 # ~X) ~h/ WA ~xG ~M Y^ ~d ~j ~p ~v ~| ~ ~ w ~ ~ ] ~ ~  ^  ( 8 H X h x  `   $ * 0 6 bG M  S 0Y dm Hs Py X p          fp   08 h l x x     o      # )  / 5 ; A G (M @S PYn@P@<V`e  ' w-DHS wxMYc@``  7 f > F ] x 6  `  `       ' H b z   ` h @ @ , C b | `        + U o   @ @      = T b"` z  @     E!H%6O@v`@@@3O`h@{` 8P  -H`aw`@) 0@;MX@m` `7 Qmpu@@)Kf`` w 0`D ]s  & =`Wov r@.libs/g-ir-generatecrti.scrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptr__crt_scratchvalues-Xa.cDrodata.rodatagenerate.cBbss.bssDdata.dataDpicdata.picdata.L27.L28.L31.L48.L61.L70.L77girwriter.cxml_element_newxml_element_freexml_printf.L44.L45.L46xml_start_element.L59.L60.L69.L73.L74.L76.L50xml_end_elementxml_end_element_uncheckedxml_open.L101.L92xml_closexml_free.L125check_unresolved.L134.L135write_type_name.L142.L143write_type_name_attribute.L153.L155.L157.L147write_ownership_transfer.L171.L172.L175.L177.L186.L191.L193.L195.L202.L205.L208.L212.L216.L222.L228.L234.L236.L166write_type_info.L246.L251.L252write_attributes.L260write_return_value_attributes.L272.L275.L278.L281.L284.L289write_field_infowrite_constant_valuewrite_callback_info.L302.L305.L308.L311.L316.L321.L324.L326.L328.L334.L337.L342.L344.L346.L350.L353write_callable_info.L365.L369.L371.L372.L375.L379.L382.L385write_function_info.L392.L403.L404.L406.L409.L414.L418.L421write_struct_info.L440.L441write_value_info.L453.L457.L459.L461.L463.L466.L468.L447.L483.L484write_constant_info.L493.L495.L500write_enum_info.L514.L519.L523.L527.L530.L533.L536.L539write_signal_info.L546.L551.L554.L558.L561.L564write_vfunc_info.L571.L580.L583write_property_info.L590.L593.L596.L599.L602.L605.L608.L611.L614.L623write_object_info.L661.L662.L673write_interface_info.L706.L709.L717.L718write_union_info.L742.L744.L747.L748.L749.L750.L757.L758.L759.L762.L765.L768.L789crtn.s_END__START_g_interface_info_get_n_properties_PROCEDURE_LINKAGE_TABLE_g_interface_info_get_signalg_object_info_get_signalg_arg_info_is_optionalg_signal_info_get_flags__environ_lockg_object_info_get_n_propertiesg_base_info_is_deprecatedg_slist_lengthg_irepository_get_shared_libraryg_vfunc_info_get_flagsg_union_info_get_fieldg_irepository_get_n_infosg_object_info_get_class_structg_object_info_get_n_interfacesg_struct_info_get_n_fields_finig_field_info_get_flags_environg_type_initg_fprintfg_arg_info_is_caller_allocatesg_interface_info_get_n_methodsg_arg_info_may_be_nullg_callable_info_get_return_typeg_type_info_get_array_typeg_interface_info_get_n_signalsg_registered_type_info_get_type_init_etext__xargcg_arg_info_get_closureg_object_info_get_constant_start_exitg_base_info_iterate_attributesg_strv_lengthg_irepository_get_dependenciesg_slice_allocg_base_info_unrefg_type_info_get_param_typeg_type_info_get_tagg_freeg_interface_info_get_n_constantsg_irepository_get_versiong_object_info_get_vfunc__1cG__CrunMdo_exit_code6F_v_g_slist_prependg_callable_info_get_caller_ownsg_object_info_get_get_value_function_GLOBAL_OFFSET_TABLE_fcloseg_interface_info_get_iface_structg_value_info_get_valueg_object_info_get_ref_functiong_type_info_get_interfaceg_assertion_messageg_base_info_get_typeatexitg_callable_info_may_return_nullg_type_info_is_pointer_DYNAMICg_constant_info_get_typeg_enum_info_get_valueg_strdup_printfg_callable_info_iterate_return_attributesg_base_info_get_namespaceg_typelib_new_from_mapped_file__iobg_markup_vprintf_escapedg_printerrg_object_info_get_set_value_function_endg_function_info_get_symbolg_object_info_get_n_methodsg_logg_object_info_get_fundamentalg_log_set_always_fatalg_slice_free1_get_exit_frame_monitorfopeng_object_info_get_fieldg_type_tag_to_stringg_typelib_check_sanityg_base_info_get_nameg_union_info_get_methodg_struct_info_get_methodg_object_info_get_abstract__fsr_init_valueg_object_info_get_parentg_property_info_get_ownership_transferg_option_context_parseg_interface_info_get_n_prerequisitesg_irepository_get_defaultg_irepository_get_infog_object_info_get_n_constantsg_struct_info_get_sizeg_union_info_get_n_methodsg_struct_info_get_n_methodsg_property_info_get_typeg_arg_info_is_skipg_assertion_message_exprg_struct_info_is_foreigng_registered_type_info_get_type_nameg_enum_info_get_error_domaing_interface_info_get_method___errnog_vfunc_info_get_invokerg_interface_info_get_vfuncg_arg_info_get_directiong_field_info_get_typeg_object_info_get_propertyg_object_info_get_unref_functiong_object_info_get_n_fieldsg_interface_info_get_propertyg_irepository_prepend_search_pathg_callable_info_get_n_argsfflushg_strerrorg_mapped_file_newg_strfreevg_option_context_newg_irepository_get_c_prefixg_type_info_is_zero_terminatedg_enum_info_get_n_valuesg_object_info_get_n_vfuncsg_slist_delete_linkg_union_info_get_discriminator_offsetg_option_context_add_main_entriesg_property_info_get_flagsg_object_info_get_n_signals___Argvg_type_info_get_array_lengthg_interface_info_get_constantg_union_info_get_discriminator_typeg_callable_info_get_argg_callable_info_skip_returnstrcmpg_constant_info_get_valueg_interface_info_get_prerequisiteg_assertion_message_cmpstrg_irepository_load_typelibg_interface_info_get_n_vfuncsg_strdupg_union_info_is_discriminatedg_arg_info_get_scope_lib_versiong_strcmp0g_arg_info_is_return_valueg_strsplitg_field_info_get_offsetg_arg_info_get_typeg_object_info_get_methodg_union_info_get_sizeg_struct_info_is_gtype_structg_type_info_get_array_fixed_size__xargvg_vfunc_info_get_offsetg_field_info_get_sizeg_object_info_get_interfaceg_arg_info_get_ownership_transferg_arg_info_get_destroyg_union_info_get_n_fieldsg_struct_info_get_field_edatagir_writer_writeg_function_info_get_flagsfputsg_union_info_get_discriminatoranotate anotate 7( 7,7w x"7w#7w$7wanotate anotate @(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stat.h 1.12 10/01/15 SMI@(#)stat_impl.h 1.4 03/12/04 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)stat.h 1.12 10/01/15 SMI@(#)stat_impl.h 1.4 03/12/04 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.500tools/generate.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -DGIREPO_DEFAULT_SEARCH_PATH='"/usr/local/lib"' -I./girepository -I/usr/local/include -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c tools/generate.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0girepository/girwriter.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -I/usr/local/include -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/girwriter.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0:.$ toolsgenerate.c6, girepositorygirwriter.c DD% DD%.interp.hash.dynsym.dynstr.SUNW_version.rela.got.rela.data.rela.plt.text.init.fini.rodata.rodata1.dynamic.picdata.bss.symtab.strtab.annotate.comment.debug_info.debug_line.debug_abbrev.shstrtabXX xxt P"@@o''0-B( ( 7B(8(8BB(P(P@L66@ RwxwxXww^ww\fww n2hhG o<HH`x@ % oܐ0 :|, 070701000a280f000081ed0000000000000000000000014f83d4a0000623b00000010000010007ffffffffffffffff0000002100000000root/usr/local/bin/g-ir-compilerELF+d`@@8@@@X##((@0@@D(D(/usr/lib/sparcv9/ld.so.1  "#$%'*+,/12467:;?ABDEGIJKLNOQRSUWYZ\^_`adefghijkmostxz{}~     !"#%'()*+,-/123458:=>?@ABCDEFGIKLNOQUVYZ[\]^`abceimoqrstuvwxz{}~ !&()-.03589<=>@CFHMPTVX[]bclnpqruvwy| $&.0679;<HJMPRSTWX_dfghjklnpy| hl |7 `dB R He <~C`  @  ? 0 5: )7 ? }DV c 0Hs 0 FT ۘ ( ǰT I8 x H hx  l(+7`E mV; ] %dy @h"D j(@ tP}A  8@  H 5@7 utLZX (<T ] hTo  (4  L Xl P 7 d@: @;& >6 o IBO@l ty ,=5 xl   9A9> / (C @UG] k4u= 5@? ( v<Z` "8| 8 b?`1 QPD S 7h<\Hh9}8   0pA` < 8,A  0 X&=- ?P? <Z9 j \  0B  4 (?  sP7# x7 lV@d m 1 Rp 0 h@ d`:; 4C b`X  X( $ 4 57 L  k Ő w4  SXP  l A  x  @t    ˜ >   7  M6 Y  { # I   <`   |       Zh :@   > . <   BF Q6 s@  cp !F      D@ B  nx  ' ) X J 5x S ( g 8   C@  ϰ B`  Sd  GP  :`   ! (( 4@ H "d a GpH p  { JHl 6`   6 8  %Hl     " - !P@KXPK @T  j <y 8 > 6 86 ^   8l  X%5 9 0PH @X d (8q q  B? < P RI 8 0+ ŐCA nDW Hq H<< }< H\  p<HA@ ( P% g3;I  ` w9`    #PC  tlG( H@ Ԉ ~8p ` <\<#A:  S sb k`u   @pC H X @ p iH\ ( vT x'A8  H İ b Pv8  (P H?@ B@=@K H t-= ACF ]@ Fo @:= 4   H k8 hh! x4=5`F \O  <\ 8g< | X x p X? ;8  Zd ӸT 9) B87@O Hh  a $| P= 6@;4 $` 0D ( (HD(!;- X98`E ̰dQ pha;`h T@s P up\ 0d X<   t@@ p(8  Ǡ  5C= hPBW PoHw<~=`>@9@ ?  9 8 (  eG , ? ؈G Hh^ Hn  v  I\ ZX4 x p<@    0X h# l>>O xd7 h< j (  ;@ I Ql P (: < 4N6e  ,t &P: =>` d0d  >7 4@`, P`; = HG5N `q5z pfch_config_set_hashfuncs_gi_typelib_hash_builder_newbmz_searchhash_state_dumpgraph_neighbors_itcmph_config_set_mphf_fdvfprintfhash_state_copybmz_loadffi_type_uint16brz_search_packedg_slist_freeselect_generatehash_state_destroyg_strerrorg_assertion_message_exprjenkins_hash_packedg_option_context_freecompressed_seq_destroymixh10h11h12graph_vertex_idvqueue_insertchd_ph_dumpfch_dumpcmph_config_set_hashfuncsbuffer_entry_destroychd_ph_packgraph_obtain_critical_nodesfch_destroygraph_destroyfch_calc_bcompressed_rank_generateg_log_set_default_handler_g_ir_module_newmemcpychd_ph_config_set_hashfuncsselect_query_packed_get_exit_frame_monitorbdz_ph_destroybmz_config_destroycmph_packcmph_io_nlnkfile_adapterg_slice_alloc0buffer_manager_newg_fprintfg_markup_parse_context_end_parsecompressed_rank_pack__xargvbmz8_newchd_search_packedbrz_config_set_mphf_fdchd_config_set_bjenkins_state_copychd_config_destroychm_config_newhash_state_packed_sizeg_type_initchm_search_packedstrcmpcompressed_seq_loadg_malloc0bdz_packed_size_g_ir_module_fatalfreadg_markup_parse_context_parsecmph_destroyselect_initg_get_system_data_dirsbmz8_packed_sizecmph_config_set_bjenkins_state_destroyg_string_append_printfmallocg_list_prependg_hash_table_lookup_extended_g_ir_node_freecompressed_seq_dumpbmz_search_packed___Argvcompressed_rank_destroyg_ascii_tableg_strdupvfch_buckets_is_emptyfopenatoi_GLOBAL_OFFSET_TABLE_compressed_rank_query_packedg_list_append__xargcbdz_config_set_bbrz_destroychm_packg_markup_error_quarkchm_config_destroyhash_state_newbdz_loadincludedirsg_hash_table_foreachg_strdup_vprintffch_buckets_get_nbucketsbmz_packed_sizeg_hash_table_iter_initbrz_config_set_memory_availabilitychd_loadg_strrstrvqueue_destroyselect_packed_sizestrcpybdz_search_packedjenkins_hash_vector_packedg_string_appendcmph_config_set_keys_per_bin_g_ir_node_can_have_memberchd_config_set_hashfuncsfeofchd_packed_sizegraph_next_neighborg_strcmp0_g_ir_node_type_to_stringcompressed_rank_loadg_logcmph_config_destroycompressed_seq_get_space_usageg_list_concatbmz_dump_g_ir_node_build_typelibchm_newhash_state_packchd_destroy_startg_string_append_cg_typelib_new_from_memoryselect_next_query_packed__dtoulchm_destroycmph_config_set_verbosity_g_ir_parser_newg_option_context_parsecmph_io_nlfile_adapter_destroybmz8_searchg_strdup_printfbdz_ph_config_destroybdz_ph_search_packedg_string_free_g_ir_node_get_sizeselect_packffi_type_voidg_str_hash__cmph_loadg_str_has_prefixcmph_io_nlnkfile_adapter_destroygraph_ncritical_nodesg_file_move_g_ir_node_param_direction_string_etextno_initgraph_contains_edgestrtoulljenkins_state_loadfch_buckets_destroycmph_search_packedselect_dump_endg_realloc_gi_typelib_hash_builder_packg_slist_find_custombuffer_manager_open__environ_lockg_option_context_add_main_entriesg_markup_parse_context_freechm_packed_size_environcmph_io_struct_vector_adapter_destroy_g_irnode_init_statschd_ph_load__assert_g_ir_module_freechd_ph_config_set_keys_per_bin_gi_typelib_hash_builder_destroybdz_dumpfch_buckets_get_key_gi_typelib_hash_builder_preparecmph_io_byte_vector_adapterrandbrz_config_newrewindbdz_ph_config_set_hashfuncschd_ph_searchffi_type_uint64g_list_lengthfch_buckets_get_keylengthfch_config_destroyg_file_get_contentsbdz_config_set_hashfuncschd_ph_destroyvqueue_newchd_ph_search_packed_gi_typelib_hash_builder_add_stringfcloseg_slice_free1chd_ph_config_destroycmph_io_byte_vector_adapter_destroycmph_io_vector_adapter_destroyfch_searchbdz_config_destroycmph_namesbrz_pack_g_ir_node_add_memberselect_destroygraph_clear_edgesg_hash_table_destroycheck_primalityg_file_testg_log_default_handlervqueue_is_emptyg_option_context_newchm_loadcmph_searchbrz_config_set_hashfuncsg_file_new_for_pathgraph_del_edgebrz_packed_sizeselect_loadselect_query_g_ir_module_add_include_modulechd_dumpgraph_edge_idfgetsstrstrjenkins_state_packed_sizeg_list_delete_linkhash_state_loadbdz_ph_config_newmnameg_typelib_validatevqueue_removebuffer_entry_read_keycompressed_rank_query_g_ir_parser_set_includescmph_config_set_memory_availabilityg_strsplitcompressed_seq_init_g_ir_node_cmpjenkins_hash_vector_ffi_type_uint8inputg_malloc_ncmph_config_set_graphsizejenkins_state_packbdz_ph_searchg_hash_table_new_fullbuffer_manager_destroycmph_io_vector_adapterg_printerr__cmph_dumpcmph_sizebdz_newcallocbmz_config_set_hashfuncsoutputcmph_packed_sizebrz_newcompressed_seq_generatechm_searchchd_ph_newg_type_tag_to_stringg_hash_table_iter_nextfch_buckets_get_max_sizebmz_config_newbdz_ph_packed_sizehash_vectorcmph_config_new_g_ir_parser_freefloorgraph_printdebugchd_newcmph_newgraph_node_is_criticalmain_g_irnode_dump_statscompressed_rank_packed_sizehash_get_typeg_str_has_suffix_g_ir_find_nodebuffer_entry_get_capacitybmz8_config_destroyg_typelib_free_g_ir_write_stringfch_search_packedshlibg_markup_parse_context_get_positiong_str_equalg_hash_table_insertcmph_hash_namescompressed_seq_querycompressed_seq_packg_hash_table_lookupceilbrz_config_set_tmp_dirg_string_insert_cbuffer_entry_newg_hash_table_newg_hash_table_size_fini_PROCEDURE_LINKAGE_TABLE_bmz8_dumpcmph_io_struct_vector_adapter_g_ir_parser_parse_filecompressed_rank_initbrz_loadchd_config_set_keys_per_bin___errnochm_dumpjenkins_hashbrz_searchg_list_insert_sortedbrz_config_destroycmph_config_set_algocompressed_rank_get_space_usageg_set_errorbdz_search__1cG__CrunMdo_exit_code6F_v___fsr_init_valuelogged_levelsbrz_config_set_bfch_config_newg_log_set_always_fatalfch_buckets_print_g_ir_node_compute_offsetsbmz_packgi_type_tag_get_ffi_typebdz_lookup_tableg_clear_errorg_strfreev_exitchd_ph_config_newchd_search_g_ir_node_get_full_sizebrz_config_set_algo_DYNAMICg_list_sortbmz_destroyg_list_freefch_calc_p1fch_packed_sizememsetbdz_ph_newbuffer_entry_openbmz_newfch_calc_p2fch_buckets_newvqueue_printbmz8_config_set_hashfuncsg_string_truncatebuffer_entry_set_capacityg_string_newbmz8_packgraph_newbuffer_manager_read_keysprintffch_buckets_insert__dtou_gi_typelib_hash_searchverbosestrtodg_list_copy__iobg_slist_free_1g_list_lastchd_config_newg_ascii_strtoll__config_destroyg_hash_table_replacefch_loadfch_buckets_get_indexes_sorted_by_sizebdz_ph_loadbmz8_search_packedfch_newselect_get_space_usagegraph_is_cyclic_g_ir_parser_parse_string_g_ir_module_build_typelibchd_ph_packed_sizecmph_io_nlfile_adapter_edataatexitfch_packcompressed_rank_dumpjenkins_state_dumpbmz8_destroybmz8_loadcompressed_seq_packed_sizeg_build_filenamefch_buckets_get_sizeg_irepository_prepend_search_pathcmph_config_set_tmp_dirbdz_ph_pack_lib_versionbdz_config_newffi_type_uint32strchr__config_newinclude_cwdchm_config_set_hashfuncsbrz_dumpbmz8_config_newg_assertion_messageselect_next_queryg_typelib_check_sanitygraph_add_edgechd_ph_config_set_bstrlenbdz_packg_slist_prependbdz_ph_dump_gi_typelib_hash_builder_get_buffer_sizeg_strndupg_strv_lengthcompressed_seq_query_packedg_markup_parse_context_new_g_ir_node_newbdz_destroyfwritejenkins_state_newffi_type_pointerg_strdupchd_packlibm.so.2SUNW_1.1libc.so.1SUNW_0.7SUNWprivate_1.1libgirepository-1.0.so.1libgio-2.0.so.0libgmodule-2.0.so.0libsocket.so.1libresolv.so.2libgobject-2.0.so.0libgthread-2.0.so.0libglib-2.0.so.0libiconv.so.2libpcre.so.1libz.solibcurses.so.1libpthread.so.1libthread.so.1librt.so.1libintl.so.8libffi.so.5libdl.so.1/usr/local/lib =' =( Nq3p3,3`3HT3|3@=3X33h338 3G L 44\4455 5@W5`B55.55G66 6@Z6`666677 7@S7`!77|7;788 '8@,8`d888f8q9K9 r9@~9`9P99M9e:: :@:`:=::8:;?; #;@;`g;b;;;[<< F<@<`<z<<[<=9= 2=@.=`{=o=X=U=F>> >@}>`>>>N>? ? X?@+?``?J???y@@ 5@@o@`@C@/@@A#A lA@A`iAALA)ABB vB@-B`BBBBwBRC3C  C@C`CCCCuD& [`+p @ "b``+p @ rbX`+p @ rc, @`+p ' \耥 t+``+p ) -`-# `?-# =--%# ##0@ʐ`+p  @Ð `*p  Z# `*p  Z# @@؏@۔@@A@`wwww ap]\ h a] wϸH>w_@h `]ap]\ @@Hap]@\ @w`]@@w`]@@ha]!` ]@B @@@@HI_\`\` @w_\ ha]!`(]@kB @@@tH+ap]\ h@@h__Ϡ @}sHa]!`0]_\ @@N@tH @w@u@'G<  A@adww'wwGa]D @H ___@[@A@`ܮw'w@Nw`H]@Q`@]@S@V@@\@?\a]$`ax]D H a]D  a]$`a]D H a]D  a]$`@= `8]@@ah]\ h a]!`P]@H a(]\ h a(]@*\ H' '`X]@' @-a(]\ h a(]\ \ ha(]\ >,0@\@a(]\ >,0\o@#Twa(]@#\ _ah]\ \ @Gܔ׺ha]!``]ah]\ \ _@_\ H[ `h]@ג `p]@ђ a]\ h_`h@ta]@\ w``x]_`@ @m@@@h `]_`@ H@@H `]_`_\ @ H/HH  @`]@  = wwwwߐ H@@_w`@_@t`_瀤h@Hw`t`@_ߠ@t t t (t 0t 8wװ@w_@\ _\ (h@_ _ o_@i\ (_@f\ 0_@k\ 8_@h\ @_ H@lwwwA@bww'ww@Z_w`]@\@ H`]@@X_\ 0h`]@V@_@[\ 0h_ w_\ @h@@D_ h`]@;@_ o_\ 0h`]@-@`]_\ \`\`_`@3_ϐ@@8 @ 0www_w\ 8@_@_@@$0www_w\ @@__@ @0A@`www_\ 0@__r0_\ 8`]@_\ @`]@_www_ \ '۪ ]`ۺ@\w_` $`_  '`__ ]`@_ ('`__ _ @_ ('`  ' A@c,wwwwwwwϠ '_w_w_w_w_w\` `]@54  ww_w_w `": ': :  A@b$ww''_w``@G H`]`]`]@e  ` HG$`$``O`]`] @Rwww_@Ewϸ_ ' 5H__`5` 6@ 6B 6D 6F 6H 6J 6L 6P 6R 6N 6T 6V 6X <6Z (6\ (6^  ?'&` 'Ӏ Hwg$ $  'Ӡ 'Ӏ  O$``w@'_\ ( h'^w_\ @2 .h a ]@˒ HH!a(]@ @@__wh _\`$ \`w_o@_@WO'_E H] (w _4  ! ,@ 4_@0_$ _\ @(_HL$ '@'_E`_5  % `,4`% ]`@ _$ '  8@T_w'w/_w7_w?'GwO_'@ T_?wG&@f_Ha0]$@@Z_$ @;H_ w^'_ oW'_`]@!wa8]@  @'& NL'_h^wW__W@ۚ^oa@]@ @_L" (w@w߀h aH]_\ @ޒ H@@_@__w@A@awaP]r aX]r a`]r ah]r ap]r ax]r @A@`wa]aX]\ aP]\ ah]\ a`]\  @sa]ax]\ ap]\ @u 0A@`$w'Haa]Hka]Hfa]Haa]H\a]HWa]HRa]HMa]HHa]HCa]H>a]H9a]H4a]H/a]H*b]H%b]H b]Hb]Hb ]HG"  O* : "0? B @ 4$pLtH\8` A@aԮ@w'wHe `@Hn `@Hh @Hb @H\ h@HV X@HP `@}HJ H@wHD X@qH> P@kH8 X@eH2 8@_H, @@YH& 0@SH  h@MHb(]G@k HG$  O, < !"?D@G'`_w`'`a8]a]aH]aH]@O@t w$$llDt<T,\0A@c w_h4H_@_`@_`H_`P_`Xh_ _ o@5_`XH_@_`_`p_`x@_`@_`H _@_`_`XH_@_`_`PH_@_`_`Xh_ _ o@ _`X_``H_@_`@_`@_`Hh_ _ o@_`H_`PH_@m_`_`@_`8H_@d_`@b_`8@`_`@@^_`H@\_`P@Z_`X@X_``@V_`p@T_`h_`xh@N_ _ o@_`x_`hp_ _ o@_`H_@7\ H_@2_`@0_`0@._`8@,_`@_`HhT_ _ o@_`H_`PhH_ _ o@_`PHu_@_`@ _`0@ _`8_`Hh3_ _ o@_`HH`_@_`@_`8@_`@_`Ph_ _ o@j_`PHK_@_`@_`8_`0HB_@_`@_`(H;_@_`@_`@@_`H_``_`0h_ _ o_`8h_ _ oHb(]_D @ H_D $  O, < #a@D_@$\ @_,,Xxxhd8 A@awHHи Hθ H̸ Hʸ _@i^x: 'ߡ<` @ ?$@@, <  << ^@h 7 _`@_`@oH_@L^: 'ߡ<` @ ?$@@, <  (< ^@h 7 _`@_`@oH_ ^H@h 7 _`@_`@o^P@h 7 _`@_`@oHtHr _ ^P@h 7 _`@_`@oHb_ ^H@h 7 _`@_`@oHRHP HN HL _ ^8@h 4 j@H?H= H; _ (^0@h 7 Z_`@_`@o^8@h 7 N_`@_`@oHb0]_D  @@H_D $  O, < #cDb8]_D` @@5@4 $$$<hx,4$,4p www_w__G` '`@G`  ?@'`G`@ꄐ  ?@'`A@awww_h_@h bH]\`@鏒 HbP]_D` @遖@H!_ '@J_   ? '_ X@h Gۣ4 __`@'_`@oGۣ4 __ P@H'_ '@*_   ? < 'ۣ< @"_ H  ?@'_ X@h Gۣ4 __`@'_`@oGۣ4 __ P@H'_ '_ h@  ? 'Gۣ4 __ X@H'_ 'DH`Hm`HjbX]@*@ @ HM '_ p@h  4 _[@'HNG۠ HJ'G۠ < '_ ph4`_G'H:G۠ < '_ ph4`_7'_ x@h Gۡ4 _,@'HG۠ H'b`]G H@ HG H$  O, < #b_DH`_@Z_ x'נ <'_ hh@q  ? <'_ p@h G@f@  ?'G_@^\   ?@< 'ۣ< @V_ 8  ?@< '_ @h <`@J  ?@'_ H@h G@?@  ?'_ P@h G@4@  ?'_ X@h G@)@  ?'_ `@h G@@  ?'GGס<` @ ?$@@, '_ @h Gۣ4 __`@'_`@oH_@_ 'נ ('_@\   ? (< 'ۣ< @_ 8  ?@< 'ۣ< @_ @  ?@< 'Gס<` @ ?$@@, '_ @h Gۣ4 _Y_`@'_`@oH_ '@_   ? < '_ 0h<`@贐  ?@< 'ۣ< @_ 8  ?@'_ @@h G@衐@  ?'_ H@h Gۣ4 _ _`@'_`@o_ P@h Gۣ4 __`@'_`@oH` '_@x\   ? HV'_ '@n_   ? < '_ 8h <`@b  ?@'_ @@h G@W@  ?'_ P@h Gۣ4 __`@'_`@oH%_ '@=_   ? < '_ 0h<`@1  ?@< 'ۣ< @)_ 8  ?@'_ H@h Gۣ4 __`@'_`@oH_ '@_   ? < 'ۣ4 __ P@H'_ '@_   ? '_ X@h Gۣ4 _}_`@'_`@oGۣ4 _r_ `@H'_ '@_   ? '_ H@h Gۣ4 _]_`@'_`@oGۣ4 _R_ P@H'_ '@_   ? < 'ۢ\`8h 5 _<H'ۡ5 _5\`@'H_ '@_   ? < 'ۣ< @_ 8  ?@< 'ۣ4 __ 0@Ho'_ '@_   ? < 'ۣ< @_ (  ?@H]'_ ('@u_   ? (< '_ @h <`@i  ?@'_ H@h G@^@  ?'_ 0@h Gۣ4 __`@'_`@o_ 8@h Gۣ4 __`@'_`@oHb`]_D @b H_D $  O, < #b_D_\ hbp]Hbx]_\ hHwb]w_\ hb]Hwb]wbh]___D`Gې @ss@s_\ b@]@枔G'4 ld @   H @w_?7@4 0ww_E _E`HH ?HH ] @}]`?`0A@ނadwwHH H _B H * :  ̐? B  ?`((( (( (( ((((((((0A@ނ`|www_@hb]b]b] @g#_hb]b]b] @T#H8__ _aX]@hw __ H_aX]@]w H__ P_aX]@Rw P__ 0_aX]@Gw 0b]_D @ HD` H  O OO H  O OOOO0A@݂bTww_B`,HB`(Hb]H b]Hb]@@w_@ w@w_@ w@w_@ے@?HH0A@݂`̮ww_b]@? HH _b]@4 HH  _hH  ? A@݂` wwww_\ w_hb]c]b]@$@_ hb]c]b]@ϔ$_b]@q @': ' H c]@$ H]( h4'_ wG H_D` H"\`(@h_`@Ð@ HH_\ G$ < ,0@_@ H _瀤@hG4`_H:w_ G' o'G H' w@9_`_t (@5_`_r`@!]((t`_瀤h@\`: _4`_wc]_`_`@Ē H _?4 c]_@Ȑ@_w߰0ww 7__?/p04004  ww_\ @E_ HH__\ 0@h_`_ @7_ HH_w߀hH_`@o@A@܂`wwwww_b]@䒔 @H: 'À H_w_H w_\ _ w_ w_\ (@h_`]@_ HHw_`@o@;_w߰ w'w?_\ @h_`DGH 7 \@_瀢 H_`@o7< '< < A@ۂb<wwww_E H`H`H_D (Hc(]Hwc0]w_c ]_@D H_א@@`HE lHN_] p__c8]@_D`\H _c@]@D``H D`dH_cH]@D`h_D`XHD`\HcX]Hwc`]w_cP]@__ch]@_D (H_c(]@H4H _cp]@H)H _cx]@H_c]@_\ ph_c]@__\ pV__c]@`H;_] Ӕw׀@hD` H_c]@~\`(_\ H wc]_\ @ _\ w_D (Hc(]Hwc]w_c ]_@Z_ǁ`H _c]@W_\ ph_c]@L__\ p__c]@A_D H`H _c]@4_\ ph_c]@)__\ p__c]@`H+_c]@_\ ph_c]@__\ p__cX]@__\ x__c]@`H?_c]@_\ h4_c]@ '_\ \ hG〤 H_cX]@__\ G,0@\@G '_\ <`,0\o_c]@w'wwww_w_\ h ]w]w_DGH_` 4`____@&_\ @r_t _o@w'_@>\ _t pA@قbwWwwwww_\`w\`w\`(w_ '_ '_hb]`H]b]@r%f_\ hHwc]w_\ hc]Hwc]wc]___QD  @@ಘ_\ 0@h _\` 2h H'Ӡ 'GӀH_\ 0@#__t 0_@R__  Hb]`H]c]@%y_ _"`_@\ _t  _@\ @_H a$` _w__`w` $`E H H H _ -  !?< @ % _D(4 ,  ?%  ? % DH4  ?HE% @w_P__@೒ wwap]\  ap]t`_@_wwoh_$`@_wH#ax]\  ax]t`__w_ @|_ _H$`__ @wg_D( ,  ! ,@5  !,@ 5 DH ,  !< @5 DX ,  ?5 D\ ,  ?5 Dd ,  ?ߠ5 Dl ,  ?5  ? 5  4 ,00400HD`H5 4 ,00400HDhH5 !?#5 _  'c  # _\ p__cH__`wg` $`_D`( ,  ?, ? ,D`H  ?, ,_\`_gH4 __ wg ? , ? ,_E H  ?, , 4  'c  # ] p__gcHe__ wg ? , ? ,_E H  ?, , 4  'c  # ] p__Bc_\ x__c;_H9__ wg ` ? ,` ` ? ,`_D H  ` ?,` ,` 4`  H% b`]_D H@ H_D H$  O, < # a_WDH _w__ w\_@ __$``_E ( ,  ?,E , ,  ?, ? , ,`E 4 HH4`!?#4`_`8] h_ ` ?ߠ ,` $ _ "] ___H_  ` ?ߠ ,`_ "]`@___H _w__w $] _@ >__$  _E`(4 ,  !<,@% E`84 ,  !,@% E`<4 ,  !,@% E`@4 ,  !,@% E`D4 ,  !,@% E`H4 ,  !,@% E`L4 ,  !,@%  %,@ % ]`P___J_H F__ w_`w_w`'{_@\ X'w_` $`_ Gw,0 < @&  _5  _D ( , + ,@5_D 0`?'s Gs , `,4`_D 4 , !,@5_D 8 , !,@5_D < , !,@5_D @ ,  75_D D ,  ;5 < 5_\ __@ ~_$ _\ H__@ v__$`{$` _\ _@S\ P_t  _\ P@\ @_$` _\ P  Hb]`H]c]@G&m{_\ P$``]_\ H@ݣ _\ P\ X__{__ _\ PD < , ! ,@4_\ PD D , !,@4_\ PD H , !,@4_\ PD @ , !,@4 0 4Gw5 { '{_\ Xw_h{_\ wg_g___W@_\ w_oHL__ w_`w_w`'{_@\ X'w_` $`_Gw,0 < @" _4  _D ( ,  ! ,@5  %,@ 5 _\ _@__$`{$`_\ P\ X__{ __ _\ PD < , ! ,@4_\ PD D , !,@4_\ PD H , !,@4 0 4Gw5 { '{_\ Xw_h{_\ wo_o___і@_\ w_oH__ w_`w_w`'{_@h\ X'w_` $`_Gw,0 < @"__D ( , ! ,@4_D , , !,@4_D 0 , !,@4_D 4 , !,@4_D 8 ,  74_D < ,  ;4_D @ ,  =4_D D ,  >4 ? 4 ? 4 ? 4 4_\ _@__$`{$` _\ _@\ `_t  _\ `@ݛ\ @_$` _\ `  Hb]`H]`]@Ɣ&{_\ `$`_\ `\ X__{"__ _\ `D < , ! ,@4_\ `D D , !,@4_\ `D H , !,@4 0 4Gw5 { '{_\ Xw_h{_\ wo_o___@_\ w_oH__ w_`w_w`'{_@\ H'w_` $`_Gw,0 < @"_\ _@___%  ! ,@ 4!,@ 4!,@ 4!,@ 4_D < ,  74 8 4_\ @h$_ w'sH`]_\ @_\ @ۂ H_ 4`< #, !? 5 D, ,  != @5 _\ __@Y__% _ 0\h !,@ 4\__@F__$ _\ 8__@>__H $  %`,4`% % _\ @@h ___@)@_H$ _$  _4` 4`_\ Hw_h_\ w_ ` 4`____h__\ w_o_\ Pw_h_\ w_ ` 4`____L__\ w_oHA__ w_w 4``E`( ,  !,@5 E`0 ,  !,@5 E`, ,  ! ,@5  %,@ 5 ]`_@__$ _\ 8__@__$ _\ @__@__$ _\ H@h ___@@_$ $_\ P@h ___@@_$ (_\ X@h ___@@_$ ,_\ `@h ___@w@_$ 0_\ hh_#_H4  _4`_\ ph__H4  _4` _4` 4` 4` 4` 4` 4` 4` _` <$`_\ xw_h_ ` 4`__\ __`4` $`_\ w_o_@\ w_`  ?#`_ ___ג .s_`  ?#`_ ___ג  s_`  ?#`_ ___ג s_`  ?#`_ ___ג s_`  ?#`_ ___ג s_`  ?#`_ ___ג s_D _hb]`H]`]@ײ(ZH__ w_w 4``E`, ,  ! ,@5  %,@ 5 ]`_@__$ _\ 8__@__$ _\ @__@__$` _\ ph_8_H4  4` _4` 4` 4` 4` 4` 4`_` ($`_\ w_h_ ` 4`__\ __`4` $`_\ w_o_@\ w_`  ?#`_ ___ג Ts_`  ?#`_ ___ג Fs_`  ?#`_ ___ג 8s_`  ?#`_ ___ג *s_`  ?#`_ ___ג s_LD _hb]`H]`]@(HJ_w__`w` $`E`(4 ,  !<,@%  %,@ % ]`0 h H' '_G4 , !,@$_\ __@__$`_\ 0H$`_w__w ' $ 4``E`( ,  ! ,@5  %,@ 5 ]`_@__$`_ H$` _$` _O\ 8__ H$@ _$` _\ 8__ H,@ _$` _\ 8__ H,@ _$` _\ 8__ H4@ _$` _\ 8__ H4@ _$` _\ 8__ Hu$@ _$` _\ 8__ Hj$@ _$` _\ 8ww__ @w @kHY _$` _\ 8ww__ @w @ZHH _$` _\ 8'__ @ @HH6 _$` _\ 8?w__ @w @7H%_@"\ 8 _ %`_ @_\ 8`@&H_\ 0D H$  H , < # b$_WȠD_ _   ?< @# _\ 0__#Hb]`H](@շH_D $  O, < # bl_WD_\ hbp]Hw`(]w_\ hHw`0]w_\ hb]Hw`8]w` ]____lD`_ _  @sssss@s_ $@_ @$@_H`@]_ _ _ @@s6@ԜsHGӀH _\ 0@@_t 0Tp ,h,,,--D-p--.$.l/<..  d d"'+/4 \*A@̂cwwwwwaP]\  aP]t`a`]\ @_a`]t`_@՟_wπhH*'aX]\  aX]t`ah]\ @_ah]t`___ @Ն_ @_  ?_$`_@@Չ_'۱4 A@̂bww_D`, H\`Hh]w_\ 0h_\ 0h]o@`h hhH #|@h #chH  H)h H" h H #ch H #?ch H  #ch H   H `? '_$`,H `? '_$`,H `? '_$`,H `? '_$`,`P] @kH A@˂cwwwR_H#a`]H.a]H)a]H$a@]H`X]_@RD , @5@H_D ,$  O, < #a@D_ _$` _$` ' < ,,@@TThhA@˂bwwwwww__\`\`wǀh_``]_\ _ʒ ?_$`?_$` Hj'_@HM_wDD_$`D@_HU$`_wDL_$`DH_HL$`_wD_$`D_HC$`_wDT_$`DP_H:$`__V_H;'a]\ _$`a] _H'$``h]__6D  @@Ҙ?_$`?_H$`_D $  O, < #bp_ؠD_D  4H 'Gӱ< T<<A@˂` wwwwww_D(@Ha]HjwDH H$DdH _\pÖ_׀H ?_$`?_$` Hi'_D hGàL@_$`G_$` H]'Ӏ H ____HR'Ӑ@ӛ@wa0]h`p]_א@  ?_$`?_$` H7'a]h`h]__@D H @@?_$`?_$` H'_ǀh`x]`]`]@o!A_\_$`_$` 'Gӱ< A@ʂawwwwww_\ w`]_\ _\ _@\ w_\8ha]\ _$`a] _$` H '_\@__.'@=_G'ӱ< < A@ʂ`twwwwwwנ 'Ϡ 'ˠ '?_$`_whj_\ w_D`H1wGH#__@HGG@$ $< @'GG$< @$''_$`4G@H'Ϡ 'GH?_$`4H,H)Ga] @$ a] $ < @'Ga] HH'a] 'G'Ga]\ @'_\ w_oGGˠ@$ % < 'GH_$`_H$`?_$`?_$`G`?'G'ӱ< < wwwwwנ 'Ϡ 'ˬ ?_$`_瀥@h,]`w_D` H!wH__@HGG$< @$''GG$< @$'H'ˬ ]`@oGGˠ@$ % < 'πH_$`_H$`?_$`?_$``?'G'ӱ< <  A@ɂ`<www'_\ G뀤?H `]_ _\ @X G뀤  "H '< <  A@Ȃc@ww_\ 0@h _\` 2h H H_\ 0@в__t 0HN__F@Ha__^HD@HN__FHHQ__^PLHH>__FHA__^|H.__FPH1_^0TPH_@D`, H#ڐ@HH_D $  O, < #bDܠD@H _\ 0@@_t 0|||<@ @ww@w_\ h@С_\ @h@_`_`@o_ @@ww_\ h@~@__t A@ǂcwwwwwww__`]@ H _____@ ˘E H_`]@ H _____@Q_`]@ H*`]_@_w`]_@_ߢw@h`]@Ð@ H`]]H@R_w]8 @| A@ǂbDwwwww__`]@ϙ H @@ @Ή_`hw`h_`]@ψ H @D` HD`@@A@ǂadwww@@_\ h\ h_ _@9@> HH7@@G@ _ o@]`h_ `]_@@" HH@@+@ _ o`]_@@  HH@@@ www _\ h_?`,0\@@_ H_?`,0H \@`_?`,0\o0A@Ƃc<ww'_D GH`]a]a]@ή!D_D`$G$` A@Ƃbww_\ `h`]a ]a]@Ά!L_\ `^a]G _ @ ^_t``@φw0A@Ƃawww_h`]a8]a(]@P!Za0]_D`\`@ͯ _\ `@[__t `0A@Ƃ`ww  7@6H_7@4,0aX]@?\@ H 7@4,0aX]H@7@ 7@6 O 7@4 h_7@4,0a@]@\@ HHf7@4,0a@] @4  HaX]Hy 0aX]Ht @7@4,0a@] @4  HaX]Hc PaX]H^ `7@4,0a@] @4  HaX]HM paX]HH 7@4,0a@] @4  HaX]H7 aX]H2 `]a`]!@͟H7@4,0a@] @<` H `O`OO`O`OO7@ 7@4 omA@ławwww''w_ @_u`PG߀H_ah]@k H ap]@ww _wπ@h %`,D`%`HD` %`(_@i\`HqwG〤Hm_ax]@DH _a]@; H a]_@ʒ wHRw_a]@)H _a]@  H a]_@˯ wH7w_a]@H _a]@ H a]_@˔ wHw_a]@H _a]@ H a]_@y ww_πh_a]@H _a]@H1_a]@wa]@ͼH %`H %`4 %`(_a]@Hw %`H %`8 %`(_a]@̶wH_a]@͔H_a]@̣w %`H %`< %`(a]@̖Hcw_a]@uH1_a]@̄w %`H %`D %`(a]@wwL` <H`w@̅ >w_"@X@wb]@Ҕ u`@?__wH+ %`H %`@_Hw_ wa ]\ _M ,p84084,0  O`.O`-O`_O`:O_@#%u`_瀤@h_t`E`H H H`]b]b]@"I@_@wװA@Âc\www_@ .h `]_\ H@r_H_@ʒ@_\ X\ 8ߖ@ڒ@H"b]_א @@_a]@В@h@̪@_\ X\ 8ߖ@̺@O@Ő@h_@ʗ@@wA@Âaܮwww_@˵ .h `]_\ H@_H__\ X\ @@ 2h @c@'< < A@Âa www_\ Hb ]@M  "H _\ Hb(]@B  "H _w׀h_G_w_\ X_@@h b0]_D`H@h H b8]_@_ @wA@‚cwwwww'_D  "H`]bX]b@]@̔"bH]__wbP]__w_πh@ H _ǀh H' 'G'ÀH_GH_ْ " _$` G'ױ< < СA@‚bTwwwwwww_b`]@ʜ H_D` H H'___ߖ@ H H'bh]_o_wbp]_h_wbx]_a_wb]_Z_w_h_@ˑ@˗_ϒb]GGbh]_@ s@ːs H^'_h_@u@{_ϒb]GGbp]_@ s@ts HB'_h_@Y@__ϒb]GGbx]_@ s@Xs H&'_\ X܅ @Ȯ_u@ȫ_u0@Ȩ_t`8_h H$`($`(_u_\ X\ (@ʆ_\ Xt ( 'G˱< 㾰A@c4@wwwwwwwwϠ Hq'_b]@ H _b]@ H H' 'GH|'_b]@ɷ  "H 'GH_b]@ɨ H_b]@ɟ H _b]@ɖ H H' 'GHJ'_b]@Ʌ  "H H>'GH _b]@u H H' 'GH)'H'_D  H H  O OOO OO$  O, < !#ؠ?D@GH HF'_B  "H '___* H H4'G_$``]__wb]_ _wb]__wb]__wb]__w_h_@,@2_ϒb]GG`]_@ s@+s H'_b]@ H_h_@@ _ϒb]GGb]_@ s@s H'_hw_\ X. @W_u@T_t`Ht`X_h H$`($`(_b]@ȣ H _b]@Ț H %0_b]@ȏ H H%<%<H%0%4%8%<_b]@| H %_@h `]@n@ H H%D%D_\``h \`X\ (@_\ XH_t (\`p@hwHXt`8HE_\ `\ w_\ @ْ_HKt _\ `\ w_\ H@Β_H@t H_\ `\ w_\ P@Ò_H5t P_\ `\ w_\ 0@ȸ_H*t 0_\ `\ w_\ P@ȭ_Ht P`]b]#@H\D $  O, < #c_wܠD_t 'G˱< |PP,, A@cwwww_haH]w_aH]@ H_$ H$ L_b]@ǻ H_$`H $`L_b]@Ǭ H _$ H$ L_\``\ b]__\ \`H] @s A@aĮwwwww_h @Ȳ_ߒb]@@ȳ H7 aH]@l H_$ DH*$ H_b]@_ H_$`D H$`H_b]@Q H _$ DH$ H@_ߒb]_@@ H  =`㾠A@`dwOwwwwww_b]@  H_D  H Hx'`]__wc]__wc]__wc]__wc]__wc ]__wc(]__wc0]__wc8]__wc@]__wwcH]__wo_hcP]w_\ X0 _t p@W__\`pt @˒ _@h cX]@ƨ@ H$`( $`,_hH $`0`]@Ɩ  "H %0H_@hc`]@Ɔ@ H %( %,H%0 %(%,%0_@h `]@p@ H H%8%8_@h `]@`@ H H%4%4_@h `]@P@ H H%<%<_o@h `]@@@ H H%@%@___H H'_@h ch]@%@ H H!%L_@h cp]@@ H H%L_@h cx]@@ H H%L%L_h@"H'c?'cGc-P_wh@H'_?'_G_-Q@Ć_H/u_\ `\ wW_W\ X@l_WH:t X_\ `\ wW_W\ X@a_WH/t X_\ `\ wW_W\ H@V_WH$t H`]c]$@šH_\ `\ D H  O OOO OO 'G˱< 㾰A@awowwwwwwH H-' H*' H'' H$' H!' H:'_D  H  O OO H OOO OO_c]@R H H'_D  "H`]c]b@]@$____/G'`]__wc]__wc]__wc]_ _wc]__w_h_@9@?_ϒb]GG`]_@ s@8s H'_\ Xe wGH_H t`p_aP]_t @@~__t _@h c]@Ӑ@ H H' 'G_$`(_@h `]@Ŀ@ H H' 'G_$`,_h@֐_H$ 0$`0HN_\ `\ ]@2_Hdu_\ `\ ]@*_H\u_\ `\ ]H@"_HTuH_\ `\ ]P@_HLuP_\ `\ ]0@_u0_h_\ X ww@__wt @__wr`8]`r`0"`(@]8u8H,`]c]%@FH _\ `\ D H  O OO H  O OOOO 'G˱< A@`dwwwwwww`]__ߨwh_@G@M_ϒb]GG`]_@ s@FsH  @¢_t h  =A@cdwwwwwww_c]@ H_D  H_c]@ H_D  H H'____ H Hw'`]__wbp]__wbx]__wc]__wb]__w_h_@@_ϒb]GG`]_@ s@Ŀs H8'_c]@v H_\ X H_\ Xݐ @_u`@_u`0@_u`8@_@t`@_h H$`($`(_ʒ@_\ X\ (@ے@_\ Xt ( 'G˱< 㾰A@`wwwwwwww_c]@* H _D  H H H'_D ` H H'ǀ`H H '`]c]%@____GǀH H'`]__wc]__wc]__wc]__wc]__wc(]__w_h_@@_ϒb]GG`]_@ s@s H\'_\ X" _t p@I_u_@h `]@Ÿ@ H H%8%8_@h `]@@ H H%<%<_@h `]@@ H H%@%@_@h `]@o@ H H%D%D___\ `\ w_\ @_t  'G˱<  A@`Ԯww_c]@Éh_@É @Ä wH._@} A@`$wwwwwww_`]@ H_D  H Hg'`]__w`]__wb]__wb]__w_h_@@_ϒb]GG`]_@ s@s H/'_\ X= @f_uw_t`0_h H$`($`(] b]@S@P_@@\_\ `\ w_\ H@4_t H 'G˱< СA@awwwwwww_`]@ H _D  H  H H H'H H%'à H"'à H'`]`]&,@FH_D  H OOO OO_B'___=GÀH H'`]_'_w`]_ _wb]__w_h_@P@V_ϒb]GG`]_@ s@Os HP'_h_@4@:_ϒb]GG`]_@ s@3s H4'_\ X` @_u`@_@t8_t`p_h H$($(Gǀ H_M@_\ X\ (@^@_\ XH t (_\ `\ w_\ @R@_t  'G˱< A@blwwwwwww_` ]@ H_D` H H'___ߖ@ H H'`]_u_wbp]_n_wbx]_g_w`(]_`_wb]_Y_w_h_@@_ϒb]GG`]_@ s@s Ha'_h_@t@z_ϒb]GGbp]_@ s@ss HE'_h_@X@^_ϒb]GGbx]_@ s@Ws H)'_\ X҄ @_u@_u8@_u@@_t`p_h H$`,$`,_q_\ X\ (@_\ Xt ( 'G˱< 㾐A@c$wOwwwwww_`0]@ H_D` H H&'___ߖ@ H H'`]__w`8]__w`(]__wbp]__wbx]__wb]__w`@]_y_w`H]_r_w`P]_k_w`X]_d_ww``]_]_wo`h]_V_wg_h_[@W@_ϒb]G[GW`]_@ s@s H'_h_[@qW@w_ϒb]G[GWbp]_@ s@ps H'_h"b(]@$H_[@MW@S_ϒb]G[GWbx]_@ s@Ls Hj'_\ Xy w_@___t @___t 8@___t @@___t h@___t`p_h H$`,$`,_@h `]@ߐ@ H H'[ '[G[__$`(_h $`0_h@h__t H_wh@`__t P_oh@X__t X_gh@P__t `_%___\ X\ (@6___\ Xt ( 'G˱< 㾰A@awowwwwwwϠ '_`p]@  "H '_`x]@w  "H 'GH@H_`]@e H H'_D H D` $`\x@#\_t xH:t H( H% H" H H H H H H H  H  H_D  H_D  H '_6  _$ t xt `]__ߦwGHN_] h@hIh_@/@5_ϒb]GG`]_@ s@.s H'`]] H@}@w_@ .h_wh `]_\ H@i_Hw@m_wH@h_w_\ 0_@_ Hu'_\`XhGH Hi'\`ph@_ϒ`]@@  HY'GH HR'GH  w " H " ( " 0_@h`]@@ H _H$$`l_@h`]@u@ H _H$`l_@h`]@e@ H _H$`l_$ l_E`l Hn`]_A_w`]_:_w`]_3_w_ 2h _ \$ D H@\_H'?'G_$``_ 2h `d$ D H@H_H'?'G_% h_@h`]@@  "H _H$`XE \H E dH H'{ '{G{_$`X_D`dH _\ pD H$`(H %`X%`\?%``%`d?%`hH_h_@ @_ϒb]GG`]_@ s@ s H|'ˠ '`]__ߠwh>@ϐ$ w_h L '_$ wG'G *HG '__h L '_$ wG'G *O_aP]@H _`]@HG '_\ pD` H D`,HG H$ '__wD`H H _\`HG 'G H _$`(_\ @__t  'G˱< 0A@`ww_] hm\ DH`H`H`H_ ph _aP]w pH`H\phaP]w p_aP]w xH&_\ pH7vX_\ pH3v@_\ pH/vP_\ pH+v0`]_\ `\ @D `]`]'@͘H_\ pD H  O OOO OO_@C\ _$ t t p0A@bww_\`x\ \ \`h\ FHHHH$@h`]`]`]@r( p\`hH t``]`](@iH-H*@h`]`]`]@M(p\`hHt`x\`hH t``]`](@<_@\ _x\`\ t\`@@_t x@w_D` H @_JB r@_ D`$ $`A@` wwwwwww_`]@  HH _ ! =A@c|wwwwwww_`]@ H_\ `h Ho'`]__߬`]__ߨwh_@@_ϒb]GG`]_@ s@s HE'ˀh_@ڔ@_ϒb]GG`]_@ s@s H*'_뭒 _\``\ w\`p@hD` H\` @$@!_@@-H _\ @@_@@  'G˱< A@a,wwwwwww_`]@R H_D` H Hs'\`X̸ " (" , " 8_t pT cH]_$_ߢw@h `]@*@ H H%@%@c(]_ _ߒw_ϐH H='H#_\ `\ w_H2t`P_\ `\ w_H+t``_\ `\ w_H$t`P`]a](@ؘH_\ `\ D H  O OOO OO 'G˱< A@b̮wwwwwww_a]@ H_D` HH2 @ǒ `]__ߨwh_@Δ@_ϒb]GG`]_@ s@sH  _\ `\ ]x@%@@ux =`㾰A@atwowwwwww_a]@d H _D  H H H'____J H H'`]_4_wa]_-_wa ]_&_wa(]__wa0]__wa8]__wa@]_ _w_h_{@Aw@G_ϒb]G{Gw`]_@ s@@s H'_\ Xm @_u%,%0%4_@h aH]@@ H H%0_aP]@ H H%, %4_@h `]@̐@ H H%8%8_@h `]@@ H H%<%<_@h `]@@ H H%@%@_@h `]@@ H H%D%D_@h `]@@ H H%H%H_\ `\ w_\ @ _t _ 'G˱< 㾰A@aLwowwwwww_aX]@Z H _D  H H H'____@ H H'`]_*_wa`]_#_wah]__wap]__wax]__wa]__wb]__w_h_{@7w@=_ϒb]G{Gw`]_@ s@6s Hy'_\ Xc @_u_@h `]@@ H H%,%,_@ha]@Ґ@ H %0H%4_@ha]@@ H%0 H%4%0%4_@h `]@@ H H%8%8_@h `]@@ H H%<%<_h@H%X!?#%X@,_u@_\ `\ w_\ @_t _ 'G˱< 㾰A@adwwwwwwww_`]@` H_D  H H  H H H'____@ H H'`]_*_wb]_#_w`]__wbp]__wbx]__wa]__wa]__w_h_\ `h_@2@8_ϒb]GG`]_@ s@1s H'_h_h_@@_ϒb]GGbp]_@ s@s Hx'_h_h_@@_ϒb]GGbx]_@ s@s HX'_\ X w_hHwa]w@=__t`_h H$`($`(_@h `]@@ H _$`,_ 2h _$`0@__t 8@__t @_`]@  "H _% 4_\``h \`X\ (@_\ Xt (__ 'G˱< СA@`Ԯwwwwwww_a]@< H_D  H H  H H H}'____ H Hq'`]__wb]__wbp]__wbx]__w_h_\ `h_@#@)_ϒb]GG`]_@ s@"s H4'_\ XO _hHwa]w@n_u`@k_u`@@h_@t`H_h H$`($`(_\``h \`X\ (@E@_\ Xt (_)@ 'G˱< A@b$wwwwwww_a]@ H_D  H HW'`]_o_wax]_h_ߨw_@h_@@_ϒb]GG`]_@ s@s H,'ˀh_@@_ϒb]GGax]_@ s@s H'_@_\ `\ t `@^__\ `\ $ X 'G˱< A@`4wwwwww_\ \ @h*]`w_\ @_瀢 H_\ @_߀ H _\ @__t  Hv'a]__\ @_ߠ Hk']`@oa]_@_ߒw_r\ h a]@_@_ HN'@_a] @@ǔ@&@Ha]_\ @t@@@@ H/'_\ ___@5@w@__πh_@Ҕa]GG_\ @Q@@@@ H '@@_\ @__t  'G۱< СA@awwwwwww_a]D H<a]@w '_\ h_b]_G,0\@_@\G '_<`,0\oGH _@ _Z @$ b]__\ @{ _@ D` "H` D` $`HE H_`]@ H- H2_____vH(_____ HH_____HH_____H_____JH_____HH_____(H_____HH_____˜HH_____˜H_____ HH_____H_____HH~_b]@{ HoE Hk`]_^_wb]_W_ߪw_h_@@_ϒb]GG`]_@ s@sHG@h_@s@y_ϒb]GGb]_@ s@rsH-_@H@^_ϒb ]__@@] ](b(]_@_@@u(' H,_____RH"_____0H_b0]@ H H H_____H_____HH_b8]@ HD` H\`Xh @_ϒb@]@@ H`]__wb]__wbH]__wbP]__w_h_@@_ϒb]GG`]_@ s@sH__h_@@_ϒb]GGb]_@ s@sHD]H@_ H @_ϒbX]_]H@@ ____Xu 0\] t`8t8\] t`@t] w_h ]X_\ _\ w_o@] u ]@]Xu](]Xt` < HAH_____ݘH5_b`]@ H D` H@ H"_____ʘH_bh]@ H9E H5`]__w _h_@@_ϒb]GG`]_@ s@sH]`\ w_\ @^@K@_t H_bp]@ H D` H@ HH_bx]@ HAE H=b]__ߨwh_@@_ϒb]GGb]_@ s@sHb]@n H@_ϒb]_@@ Hv H{_____Hq_____٘HgHA_____H[H5_____HOH)_____HC_____H9H_L $ a H , < #c$_D_\ h!E "H_@(_b]@H b]]@GG_@E " % _\ h_@a]]@GG_\ @\ h8@  X | l  DwwA@bLwwwwwߠ '(p @ww@h_@@ H H '(p @ww@oGH H'_@@_ߒb]_GG_D`D` ss@s 'Gӱ< A@`wwwww__\``h@^ H/\ D H@T H% H@L H H@D H_@T@Z_ߒb]_GGӐ@ @WsH  = wwwww_____Q'ӱ< < A@cTwwwww_b]_@$ H@ _b]__Ò@H@ߒ _b0]__@H@ϒ _bp]__@H@࿒ _b8]__@Hw`X@ஒ _`]__@H@}_`hw`h@ `]@z_ H_`]__g@H@ _b`]__W@H@s `]@R_ H{_b]__?@H@[ @@\``h@O H]b]\D @s @D`H$`; HI\`\ D H0 H> H( H6 H  H. H H& H H H H@ H_@@_ߒb]_GGϐ@ @s`]@_ H_c]__@H@ڒ `]@_ H_c]__@H@’ _`0]__@Hݐ@@߰ `]@_ H_c]__|@H@ߘ `]@w_ H_c]__d@H@߀ _` ]__T@Hߛ@@n `]@M_ Hvb]@E_ Hn___c]c]@sHu@@H _b`]__@Hc@@6 `]@_ H>_c]__@H@ `]@_ H&_c]__@H@ _`]__ڒ@H___@`]@_ H_c]__@H@ܒ _a]__@H___Z@` ]@_ H_a]__@H@޲ _bh]__@H@ޢ `]@_ H_`]__n@H1H޳@@ކ H(@ށ H#@| H`]b]-/@>HG`$  O, < #`p_ǠD`]@=_ H`p]@5_ H `x]@-_ H@`]@!_ HG`5@`]@_ HG`(@` D`$ $`D` H`]b]b]@ؔ-K@D` HD` @b]G`@/ HG` "O, < #`_ǠtD LLTh(l X\$d \L T l  P  wwwwwׁ www__ @h_`_`@o@_ w w XpA@aw'wwwwwwb]7 `\@Ot_w7 '?_ww_wwWa8]a]aH]aH]@wga8]a]aH]@wo 'w_w`]7 @__@_πH(_@@H"@@ '?`]7 @__@_πH_@@H @_O_@\ _t _Oh_gh@~_oh@x@n_W@@_Oh\ Hw_π@h\`h @b]@@ w_ǰA@bܮwwww_b]@aH @_b]@@ HCb]_@ _c]@Nwh@?_H@;  @" /c]@ؐw@h ,`_ה@_瀢HH_____w@m@k__ǰ@0A@a<w @r a8]a]aH]@@t w0A@`www7_\`hc]c]c ] @o N\`@_@ΐ@СA@cww_D`HD`H'\`hc]c8]c ]@Ք `_@\ 7#@Hc]c8]c(]@ c7 4 @ _@\ @H_w@f_64@,0v`@@}O64,0v7@ @@ww@k @__t` $\`hH($ $@ $\`7Hc]c8]c0]@l }_@ \ 2 '  ?_ $  74,0@% _D 'G< 0A@aLww_@hc]c]c@] @ H) D`Hc]c]cH] @ H D`Hc]c]cP] @v H `7@4 СA@`www'_@hc]c]c@] @N D`Hc]c]cH] @; D`Hc]c]cP] @( `Hc]cp]cX]@ _ hc]cp]c`]@ _`_$  w@ \`__`w@N\`'_@a\ @eH1_w_< __@@: @ h@5 H Hc]cp]ch]@a -p040_ߡ54,04@@6O@w_\ h@_t _@\ _ @A@`Ԯwww_ hc]c]cx]@ _ w_@H@: @ @_`@wס74,0@-04004 wwwwwA@cwwc]@@_@ǐ @@h@@@_@ @ @@a]!@@@@@wwwwww www__t _$ ג$@wπhHE?@HH>?_\ _ @נ @@_t \ _ @@ה@@_ @ס: @_$`@נ" L@ O_ @H_\ $`4L` H ,` $ % _ =`www_]_,0_ @_ @@_t \ ,0_ @v@` $`_ < '< < www__``_$  @_t \ `` L4@`@J`` $`_ < '< < www__  ,0@_@_$  w@Ɛ _t \  ,0@_@ ` $`_ < '< < 0ww'@_0ww'@_@w_@w@w_w" @w_w" 0w @__@i$w@n_H @" L@ O7O @n_764  A@aDww (@(h c]c]@T HH  _w`@$`c]t`c]t`c]t` w@@@w@_ A@`$ww' (@h c]c]@  HH  _@t`$`c]t`c]t`c]t` w@@@w@_A@cww'''' (@ @@h c]c]@ H H'ˠ 'ˀh c]c]@ H H'Ǡ '_u%% %%@t`$`w߰@@@w_\ w @Y@W_A@alww' (@1 @-h c]c]@Y H H'Ӡ 'Ӏ@h c]c]@G HH  _w`'`t`$`w@@@w_\ w @@_ A@`ww'_wc]t`c]t`c]t` w@@@w_ A@c,ww''''_wc]t`c]t`c]t` w߰@@@w,_ A@b<ww'_*wc]t`c]t`c]t` w@@@wP_ A@adww@ _h c]c]@\!%HH   @j'`@t w0A@`@@w'G_E HH5@j_H?@3_H;@>_H7@J_H3@ _H/@_H+@+P_H'@__H#@Z_H`]c]@!MHH  HE O, < !"?ܠD@H>@j{_HGt @36_HBt @>_H=t @J,_H8t @_H3t @t_H.t @*_H)t @_D_H$t @Z__Ht `]c]@!mHH  HG O, < #bԠܠDG_$`L\<l|\pH@ww_D` H_@Jc@@ww_D` H_@J@@w'_D` H@J@ H@7@ H@_5@ H@Y@@w'_D` H@_G@ H@Yِ@@w'_D` H@IՐ@0A@cw_@hT`]D`,0aP]\@H5@i_H@@2^_H<@=_H8@Ih_H4@_H0@_H,@*_H(@^x_H$@Y8_H `]c]@!HH  H_D O, < #aܠD@j_dtT@w'_" 0A@a@wwwH1_@iI__@2__@=M__@I__@U__@j__@)__@^ __@X__D O, < !!H?ܠD@8L$`t@w?_:  A@cw_`?`]D`,0aP]&\@H{`]_@hH` ]_@1Hv`(] _@<Hl`0]``] H_@I8 H_@I3 _@IHHR`8]_@ >HH`@]_@H>`H]_@)H4`P]_@c0H*`X]_@XfH `]c]@"3HH  H_D O, < #bܠDw|T4\0A@a @wwwH>_@j_HV_@8_HQ_@D_HL_@Ot_HG_@ _HB_@ _H=_@,_H8_@e _H3_@Y'_H.`]c]@"OHH  H_D O, < !!?ܠD@`]c]@"QHH   >8L$`t A@c4w`h]@_hH`p]Hf_@jВ@Ho`x]_@8n@He`]_@C@H[`]_@O$@HQ`]_@ N@HG`]_@ В@H=`]_@,X@H3`]_@c@H)`]_@X&@H`]c]@n"HH  HG` O, < #bxܠD`]|@|hDl A@`www'`]_YD H__@jH`]J__@8UH`]=__@C*08H408`]0__@PHt`]#__@ Hg`]__@!HZ`] __@,HM`]__@d#H@a]__@X.H3`]c]@"H H' 'H_D O, < #b_נܠD`]c]@"H H' ' 5@4 `@0d@w_ 7@2 0A@aL@wwH5@jY_@7_@C_@PC_@ _@ _@,3_@c_@W{_`]c]@7"HH  H_D O, < !!?ܠD@`]c]@"H  0@ P`p A@cww__D`'  a]D`H>_@i_@7_@C(_@P _@ T_@ _@+̒_@cu_@WF`]c]@#HH  _D O, < #aܠD\pH0A@aܮ@wwH5@i_HA@7m_H=@B_H9@Pi_H5@ 1_H1@ y_H-@+_H)@c=_H%@W _H!`]c]@[#%HH  H_D O, < !!`?ܠD@ 74 0@ P`p A@`\www'_HS@`_@i@H[`_@7&@HT`_@B@*08HL408`_@Q@HE`_@ސ@H>`_@ /@H7`_@+X@H0`_@bߐ@H)`_@V@H"`]c]@ܔ#JH H'۠ 'H` O, 4!!?ܠD 5@4 Hd,wwwwwA@bHwwa]@@_@_ @@h@@@_@@ @@a]!@@O@U@@wwwwww0A@aww (@  (@@hH _t`$`t` a] <`@@@w@ _0A@`Dwww_D ,0aP]\@aP]@.\@ _ @_ _  @A@cww a ]}_  @w hHEL` HO` 7@ H7@4,0aP]@\@ H7@7@ 7@ O H a(]JH @}"  _  @wva0]? ,0aP]\@/w''''J '2`'ߐ `'ې  _ߑ+pw:`- : "w-@ "5@ H`2*0w:`5 : "w5@ " w'''J '2`'ߪ `5@  _ߑ+0@:`2 5@ H 7@ 2*0@:`* 7@'2 w'''2`' `'   ; *@" _+pw7@:- : @"w-@ @"5@ H`2*0w:`5 : "w5@ " w''2`' `5@   :*@" _+0@:2@7 5@ H 7@ 2*0@:`* 7@'2 wwwwwA@b8wwa8]@@_@[ @@h@@@_@@ @@a]!@@K@Q@@wwwwww0A@a wߐ H@h a@]aH]@G HH  @  H@u@$`$`$`$`aP] <`(aP] <` aP] <`t`0t`8t`@w@@@w_\ @@ ww_Z _ G H7@H G 2*0& G O '??'@wϕH 5t@L$@H't@L$@'wϕ灪H5@'5@4 A@bDw?'wߑH?w߁@@?aX]@ ϕIa`] HI@@74 0A@atw'wߕah] @H@?HH0A@`w'wߕap] @eH@?HHw _\ _`8h@ *G``@ pw`8``y'``?` `?`(`@_\ \` \` 7`H-Ϫw_\ \`\`@_`8_@ `rL"`` `(66_@wǡ7 7` Ow@w@_wwww_  @w@_'Ӻ  '˸  7@ӀHS__7@4,0@@'__ @В  7ÀH9__7@4,0@@47w__7@4,0@@]7'_\ @_@ _ rL"'_ˢ `H@? H/ ,`7 7À O7@ 7@Ӏ O@*_נ /4 0w' 7@H@k2 t@L$@_7@5,054,0`$$` 7@ Owww_  @7w_  @1wϠ 'ˠ 'Ǭ @_' ' '_\ 0h@͐_  @_t`0 7@`H7@_ס4@,0$`7@_  O__  7@_ H7@__ס4@,0,0%`7@_  O_\ @h@ _D``@_t`@__@ '-8408HǠ 'Ǡ H'ˠ '˺ 7@H-8408H__7@4,0@ @' HH   '_ $@H-8408H__7@4,0@@ w__7@4,0@@@ '_\ @_@_``rL"' ' `_@4,0$@t@L$@]`0_7@4,0@,0$ ' '__7@4,0@@w__7@4,0@@'_\ @_@_`rL"'\0_7@4,0@,0`t@L$@'_,0@ H'_-0'4@,0$$,0%@,0%@`' H ' $@' H' t@L$@'t@L$@ O '_ $@H-8408O77@ 7@H-8408O -8408H ǀ Hˀ# O@g_@e_ס-8408/4 A@aww?wwת d /Ҷ_\` \` ' aX] Ha] ?? w 8w @w 0_ H a]!ax] @h@__ H a]!a]@lh@`_ H a]!a]@U/ҡ5@$ ҀH5@ Oh@ڐh@ڐ5@ HH8w @w_D "  @@wע 0\`r (t` 8\`r 0t` @\`r 8t` (:  :  "  :  " _t`$`_ H a]!a]@_w_www_Z __ 0@ې_  @z__ @s@x__ 8@ې_  @f__ @_@d__  @V _  @O _  @H _  @A _  @:_ ( ,0_ @2 ' <  ww @@_t r 0_  @K@_ @A@w`0@ _t`w`8_  @1@_ @'@ϐw`8@_@  @`_  @`_  @ `_  @` _  @`@,0`(t \ `,0_ @ ww'_\ _`0_@]`rL"_`8_@P`rL"'``` ԗ7_`(74,0@`t@L$@'4 @w_\ @n_`(@_`0@_`8@h@@f_ ww_\ _@z_ 02 '``_ 0@@@͐2@@m_ 82 '``_ 8@@@2@ '`` '``@ w``@ w``_ ( ,0@y@0w_\ @>_`0@;_`8@2@2@`,0@ $< 64 A@`4www'_w`< 'ۢ`@owߡ2@w`< 'ˢ`@fwϡ2@   ' _ wa]``a] H`ʑHH? _ wa]``a] H`ʑHH? _G_@]rL"_G_@PrL"'ח554,0t@L$@'4 wwwwwA@bwwa]@: @_: @P @@h@@@_@@ @@a]!@@@@F@@wwwwww0A@`ww_h a]a]@? HH  _$ t $ 0A@`Lww_h a]a]@ "HH   7_ H_\ 74,0@\@7 7_  O_@\ 0A@c\ww'_h a]a]@ܔ -HH  _ 󀤀H8a]g@7@H 7@, 7@ O_\ 7@4@,0_t \ h a]a]@ 7HH  7@_$`a]:0A@awww'_h a]a]@} ?H H' '_  __]  ,0u] ,0$`  & 0A@`ww_h a]a]@E IHH  _  "H /084084 0A@`Tww_h a]a]@ OHH  _ 74  A@cĮww'_h a]a]@ UHH  _  H a]a]@ UHH  _\ ,0\@0A@bܮww'_h a]a]@ [HH  _  H a]a]@ [HH  _\ ,0@ 64 0A@aww'_h a]a]@ bHH  a]!a]@ 7@_ Ha]!a]_\ 7@4,0@\@7@ 7@_  O A@`̮w' @ h a]a]@6 wHH   @Uw  7@H_ 7@4,0А@7@ 7@ O_ h b]a]@  zHH  $ $ w0A@ctww'_  H b]a]@ HH  _\ ,0@.84084  A@bww'w'_  H b]a]@ H H'ߠ '_\ ,0@__\ ,0n@_` H \`,0d@_$ 0A@aww'_  H b]a]@n HH  _\ ,07@64  A@`ww''_  H b]a]@A HH  _\ ,0@,w0A@`4ww''_  H b]a]@ H H' '_\ ,0@254 @w_ 7@2 @w_ 7@2 w  _   @_  @ 7@_ H_\ 7@4,0@2,0w` $`7@ 7@_  O_ `,0'6`,0&`< $ 7@ H6@7@4,0`'6$`$7@ O 7@_ H$7@_\ 4@,0O2,0,0%_\ 7@4,0C@2,0w` $`7@ 7@_  O@6w@w 7@_ H_\ 7@2@,07@ 7@_  O@w 7_ H_\ 74,0@7 7_  O_@\ @_wwwwwA@cwwb]@@ _@ @@h@@@_@@ @@a]!@@@@@wwwwww A@b|w''H"b]@b ]Hb(]b0]@ HH  HG OOG$ w A@a|www'H__@H&b(]b0]@] #HH  H _D OOb(]b0]@G %HH   54  A@`twww'wH__@_߁b(]b0]@ 1H H'۠ 'ہ_D OOA@cwwwwH_@__ ?HfHb(]b0]@ AH H'Ӡ 'H _D OO_D ,0a]@\@_ @ _t \ _D ,0a]\@a]@\@ @ܒb8]_ _ _\ _D ,0a]@\@ _@Ĕ@_D ,0a]@\@: _` $`@d_߁ A@awwH@;_Hb(]b0]@m VHH  H _D OO_D $ w A@`Ԯww'  7@ H_7@4,0a]@7\@ HH7@7@ 7@  O HH< ,0a]@7\@: H  _5@4@$H H OO0A@cwwH@}_b(]b0]@ |HH  _D OO0A@bwwwH_@_b(]b0]@ HH  _D OO0A@b<w'H @7@Hb(]b0]@ HH  HG OO7@74  A@aww'w'H__@H%b(]b0]@^ HH  HG OOb(]b0]@I HH   54 A@`|ww'w'wH__@f_ׁb(]b0]@ H H'Ӡ 'ӁG OO@w_B ?`wwwwwA@c`wwb@]@@_@ @@h@@@_@@ @@a]!@@@@@wwwwww0A@b4w' @dbH]@2 t@L$@@$ w@w@P_ A@aTw'w'w'r!=2 _"`"`"`` H__L 2 L 2 * @L 2 * @L 2 * @" L 2 L 2 * @L 2 * @L 2 * @# `L 2 L 2 * @L 2 * @L 2 * @#` "@"`"@"`2 @" `"@#  "@#  * @# `"@#`` "@#`` 2 @#` "@"`"@"`2 @" `"@#  "@#  * @# `"@#`` "@#`` 2 @#` "@"`"@"`2 @" `"@#  "@#  * @# `"@#`` "@#`` 2 @#` w5@" 5@ ON_ߔ א@Hd"_ߔ _J 2 * @"_ߔ _J 2 * @"_ߔ _J 2 * @"_ߔ _J 2 * @"_ߔ _J 2 * @"_ߔ _J 2 * @"_ߔ _J *08208: @"__J 2 * @"__J 2 * @"__J 2 * @"__J *08208: @H"5@"  H * 2#,_ϐ?Ԑ B _"@" "@" 2 @" "@""@"* @" "@#  "@#  2 @# "@" "@" 2 @" "@""@"* @" "@#  "@#  2 @# "@" "@" 2 @" "@""@"* @" "@#  "@#  2 @# hH lH ww'_ _&7@4 0ww'w_ __߁0A@a\wwww _$` @)_t \ h?4 _$`_  @wbP]_ 0w @w_D$`$`w@@ A@`,ww' @_  $`" bX]`W@w@ww_@h _h ` @@ 7@2  ww'_ _b7@4 0ww'w_ _K_߁w''''J '2`'ߐ `'ې  _ߑ+pw:`- : "w-@ "5@ H`2*0w:`5 : "w5@ " w'''J '2`'ߪ `5@  _ߑ+0@:`2 5@ H 7@ 2*0@:`* 7@'2 w'''2`' `'   ; *@" _+pw7@:- : @"w-@ @"5@ H`2*0w:`5 : "w5@ " w''2`' `5@   :*@" _+0@:2@7 5@ H 7@ 2*0@:`* 7@'2 wwwwwA@bwwbp]@ʐ@_@s @@h@@ʔ@_@@ @’@a]!@@c@i@@wwwwww@w'@6,0_t @w_@5\ @w'',p,p@_t @ ,0_t @_t @w''_\ ,0@` _\ @[ _$ @w_@\ _@\ _@\ @w_@\ _@\ _t t  w'''_`\`*0*0@"\`*0*0@" \`*0*0@" `]`.0\`*0*0@" ]`.p\`*0*0@" ]`+p \`*0*0@" `]`" ]`"]`"`Zw ` *`Zw ` *`Z w ` *`` $`0A@aww'' 7@H)bx]7@_\ 2@,p,p```@b]_\ 7@4,p,p` ``@7@ 7@ O 7@Hb]7@_\ 2@,0@7@ 7@ O A@`\ww' ' 6 H_] -p-p64,0@] -@?'ߡ7@H3?H07@'_\ 4@,p,p5H H 'H H' '_\ 7@4,p,p,0@ 7@H?O7@?Hb]@_ 2`I@@S?߀H_\ 7@4,p,p64,0@ 4,p,p,0@H$` _] 7@4,p,p64,0@ ] 54,0$@_\ 54@w `$ ,`6 6  OpA@aw''ww  '4 4@< w4 4 @  'HK_] ߥ,p,p']  ']  '] @ H  @ H @ H"_ߡ5 4 4b`] @ <<@H_7@4@,0$`w b`] @@-ߠ ' Oˣ7@H_ˡ,p'Ǡ`'__] ǥ,p,p']  ']  '] @ H&],@'_á5 4 4b`] @ <<@H_7@4@,0$`w b`] @@-_\ @ H&\-0@'_á5 4 4b`] @ <<@H_7@4@,0$`w b`] @@-_\ @ H&\-0@'_á5 4 4b`] @ <<@H_7@4@,0$`w b`] @@-ˣ7@Oa@M_7@$@< '< < 0A@~a,wߐ @@#h b]b]@O HH  @  @@}@$`8t`t`$`  ,`$$`(t`0w@@0A@~`Tww_\ b]@@0A@}cww'_\  H H ':`/ $b]u ww_Z _ G H7@H G &8 G OСA@}bԮww?w_\ c ] HHc(] ?b];*[_ \ '`\ wHc0] @@`$ ` H`$`,`@'` `$ ,` $`b] ``w` w@@`($`b]````b]b]```;[#_ H a]!b]``@yb]G`8 w`_@_'H 6$ ,_`w`b]6_ H a]!b]@P66 HHHO6 HHh_ H a]!c]``@*_@ڐ@֐_ H a]!c]``@@0@ @_D "  8@wע`\`r t``\`r t``0\`r 0t``(" (` " `$* $`" `" `" u`%c])_ H a]!c]@@www '_\ _  W_\ \` \` '_\  HMϪw_\ \`\`@_ _3Ϣ `tL$'`tL$'`tL$,`'_\ \`\`__Oߠ '_\   O  __'ۀ  "H '< < A@{cwwww_ '_ 4 4@̐ _ wcH] @@'Ò @_t``4 4 @ _\ @ ߠ$ '   H&_,0@'_ ] ۥ,p,p']  ']  'c8]_\ 2`4  `, < <4 < ,08408< 24  , < <4 < ,08408< 24  , < <4 < ,08408< sס44  4b`] @ <<@Hӡ5`4 `4b`]  <<@H"_\ 5`4w   `,`< ,4@bh] @< ,08408< - w b`] @. ϡ5 4 4b`]  <<@H"_\ 5 4w `  ,`< ,4@bh] @< ,08408< -`w b`] @. _ ] ס6 4w ] ӡ44  , < <@4 < ,08408< ϡ4`4  `, < <4 < ,08408<   <``.! L $@ ,`< ,4@bh] @,08408< @-6 4w  4b`] @H,ӡ44  4b`] @ <<@Hϡ5`4 `4b`]  <<@H"_\ 5`4w   `,`< ,4@bh] @< ,08408< - w b`] @. _ ] ӡ6 4w ] ס44  , < <@4 < ,08408< ϡ4`4  `, < <4 < ,08408<   <``.! L $@ ,`< ,4@bh] @,08408< @-6 4w  4b`] @HQ,_ ] ϡ6 4w ] ס44  , < <@4 < ,08408< ӡ4`4  `, < <4 < ,08408<   <``.! L $@ ,`< ,4@bh] @,08408< @-6 4w  4b`] @,c@]_\ 2`4  `, < <4 < ,08408< 24  , < <4 < ,08408< 24  , < <4 < ,08408< :s$ '  O@A@ybDww ' _` 4 '`wǕcH] @@_ ( @_ 0t \ $  '_ (H16@(H@'׸ 7H5_\ @75 a] @ 76 O5_\ 0-p$6@'6$@`O'A@y`wwww_Z __ 3cP]_  @__ @@_ߐ _  @_  @ _  @ wcH] @@ _ 54_ @ _  @ $_  @ (_  @_ 0 (,0_ @ ' < A@xbwww 8@cX]2_t`_  @c`]#@l_ @Nw`@och]`_  @_@  @`_  @`wcH] @@5@4 @`t \ 5@4_ @i` _  @b`$_  @[`(_  @T`( @o`0t \ `(,0_ @FA@x`dw'ww': 3 '_ۑ*@* 7@2 3 '˓5ˀ@H5@_52 @2a] @5ˀ@ O5* 7@〢@H_7@22 @: * : :@2 : *08208: H5@ 7@ 7@〢@ O5@'߱2 ww'_\ _`_ˢ``tL$'`tL$'`tL$,`'Ӫ˰`^ ˡ44  , < <@4 < ,08408< ϡ44  , < <@4 < ,08408< ӡ4`4  `, < <4 < ,08408< <``.! L $@< ,0@`$_`0^ 67'4 @w_\ @,_`R_`@(_`0@&@@$_A@w`www_\ _3_ 2 '``_ Z@2@ '`` (`'``_ 0`,0@F@ (,0@ $/`` wǕcH] @-@_ 64@-@ A@vcww_\ _`G'2`(,0`wϕcH] @@2 < 74 ww'_`< 'ߢ`wס2@`'˺```-p@  _G_|ˁt@L$@'t@L$@'t@L$@,@'44 , < <@4 < ,08408< 44 , < <@4 < ,08408< 44 , < <@4 < ,08408< <``.! L $@< ,0'-8408< @!'4 w''''J '2`'ߐ `'ې  _ߑ+pw:`- : "w-@ "5@ H`2*0w:`5 : "w5@ " w'''J '2`'ߪ `5@  _ߑ+0@:`2 5@ H 7@ 2*0@:`* 7@'2 w'''2`' `'   ; *@" _+pw7@:- : @"w-@ @"5@ H`2*0w:`5 : "w5@ " w''2`' `5@   :*@" _+0@:2@7 5@ H 7@ 2*0@:`* 7@'2 wwwwwA@uawwcx]@}d@}`_@  @@h@@}d@_@}P@ @}\@a]!@@~@@@wwwwww@w'@~Б,0_t @w_@~\ @w'',p,p@~_t @~,0_t @~_t @w''_\ ,0@| _\ @| _$ @w_@~\ _@~\ _@~}\ @w_@~m\ _@~j\ _t t  w'''_`\`*0*0@"\`*0*0@" \`*0*0@" `]`.0\`*0*0@" ]`.p\`*0*0@" ]`+p \`*0*0@" `]`" ]`"]`"`Zw ` *`Zw ` *`Z w ` *`` $`0A@t`ww'' 7@H)c]7@_\ 2@,p,p```@~Ic]_\ 7@4,p,p` ``@~97@ 7@ O 7@Hc]7@_\ 2@,0@~"7@ 7@ O A@sbĮww' ' 6 H_] -p-p64,0@] -@?'ߡ7@H3?H07@'_\ 4@,p,p5H H 'H H' '_\ 7@4,p,p,0@ 7@H?O7@?Hc]@}_ 2`I@@y?߀H_\ 7@4,p,p64,0@ 4,p,p,0@H$` _] 7@4,p,p64,0@ ] 54,0$@_\ 54@w `$ ,`6 6  OpA@s`w''ww  '4 4@|֐ w4 4 @{?  'HK_] ߥ,p,p']  ']  '] @ H  @ H @ H"_ߡ5 4 4cp] @ <<@H_7@4@,0$`w cp] @@-ߠ ' Oˣ7@H_ˡ,p'Ǡ`'__] ǥ,p,p']  ']  '] @ H&],@'_á5 4 4cp] @ <<@H_7@4@,0$`w cp] @@-_\ @ H&\-0@'_á5 4 4cp] @ <<@H_7@4@,0$`w cp] @@-_\ @ H&\-0@'_á5 4 4cp] @ <<@H_7@4@,0$`w cp] @@-ˣ7@Oa@{_7@< < $@'< < 0A@qcwߐ @{h c]c]@{ HH  @  @z@$ t t w0A@qb̮ww_\ c]@{@ ww_Z _ G H7@H G & G OСA@qaww?w_\ ` ] HH`(] ?c];T[_ \ '`\ wH`0] @{@{m` $ ` H`$` ,`@`$`````:c]#c]``` ;[ d_ H a]!c]``@{^c]G`h w`_@_'H 6$ _`w`c]6_ H a]!c]@{566 HHHO6 H=H]O_ H a]!`]``@{_@ϐ@א!_ H a]!`]@z@ǐ@ @z_D "  @z}wע`\`r t``\`r t`` " `" ` " u %`]_ H a]!`]@z@www '_\ _  _\ \` \` '_\  HMϪw_\ \`\`@_ _#Ϣ `tL$'`tL$'`tL$,`'_\ \`\`__ߠ '_\   O  __'ۀ  "H '< < A@ocwwww_ '_ 4 4@y _ w`H] @z@y'Ò @z_t``4 4 @x ߠ$ '   H_,0@'_ ] ۥ,p,p']  ']  '`8]_\ 2`4  `, < <4 < ,08408< 24  , < <4 < ,08408< 24  , < <4 < ,08408< jsס44@ 4cp] @ <<@H~ӡ44@ ` 4cp]  <<@H w `cp] @-`ϡ44 ` 4cp]  <<@H w `cp] @-`_ ] ס6 4w ] ӡ44  , < <@4 < ,08408< ϡ4`4  `, < <4 < ,08408<   <``.! L $@ , < ,,08408< @-6 4w  4cp] @H,ӡ64@4cp] @ <<@Heϡ44@ ` 4cp]  <<@H w `cp] @-`_ ] ӡ6 4w ] ס44  , < <@4 < ,08408< ϡ4`4  `, < <4 < ,08408<   <``.! L $@ , < ,,08408< @-6 4w  4cp] @HJ,_ ] ϡ6 4w ] ס44  , < <@4 < ,08408< 64 , < <@4 < ,08408<   <``.! L $@ , < ,,08408< @-6 4w  4cp] @,`@]_\ 2`4  `, < <4 < ,08408< 24  , < <4 < ,08408< 24  , < <4 < ,08408< s$ '  O:@wݐA@mcww _ wǕ`P] @x@w' @x 7_ H37u`'ר _]5`4  `, < <4 /ޡ.8408< ށu`L %@4c] @L.8408- `7 O_@w{\ _t`A@mawwww߬ _Z `__ 儔`X]`_  @tH__ @tA@wF_ߐ _  @t8_  @t1 _  @t* w`P] @wn@w\_ 54_ @t ' < A@m`twww  @v``]_t`_  @w#`h]@v_ @w廐@w`@vܐ@`p]`_  @w_@  @v`_  @v`w`P] @v@v54 @v`t \ 54_ @vA@lbwww'_\ ]`_~Ӣ``tL$'`tL$'`tL$,`'ۦ`\Ӂt 4 @\ׁt 4 @\ہt 4 @Ӂt`L $@4,0c]@-84084 @ׁt`L $@4,0c]@/084084 @ہt`L $@4,0c]@/p84084 @ӡ-8408< /08408< @/p8408< @<``.! L $@< ,0''4 @w_\ @u_`_`@u@@u_A@kcwww_\ __ 2 '``_ @F2@ '`` wǕ`P] @u@u_ 64@s@ A@kbĮww_\ _``wϕ`P] @u@u274@ < 64 A@kbwww'_`< '`wס2@w`'ˠ`w_G_Kˁt@L$@'t@L$@'t@L$@,@'_t 4 @t 4 @t 4 @t`L $@4,0c]@-84084 @t`L $@4,0c]@/084084 @t`L $@4,0c]@/p84084 @-8408< /08408< @/p8408< @<``.! L $@< ,0'4 w''''J '2`'ߐ `'ې  _ߑ+pw:`- : "w-@ "5@ H`2*0w:`5 : "w5@ " w'''J '2`'ߪ `5@  _ߑ+0@:`2 5@ H 7@ 2*0@:`* 7@'2 w'''2`' `'   ; *@" _+pw7@:- : @"w-@ @"5@ H`2*0w:`5 : "w5@ " w''2`' `5@   :*@" _+0@:2@7 5@ H 7@ 2*0@:`* 7@'2 wwwwwA@icww`]@r @r_@s @@h@@r @_@q@ @r@a]!@@s@s@@wwwwww0A@ibtwߺ (@sth `]`]@s HH  @  (@q@$ $ t t t w0A@iaww_\ `]@sJ@ ww_Z _ G H7@H G 2*0& G OСA@i`ww?wwנ 'w /w_\ a0] HHa8] ?`];Z[_ \ '`\ w@s3H@s!` $``]``;@[` `@Fw``]6 @rw`  6 H _` 64@,0t`6  O ' ' d_ H a]!`]`` @s `] G`` _` t `]G``  _` t `]@E_'H(5$ _` \ ` \`t \`\ _` t `]ۓ5_ H a]!`]@r˕55 HHHO5 H@F}_`Hw_ H a]!`]@r@Ks_`_ Ha]!`]@ra]!`]@ra]` 40@r w` 40 @p `40@r w`40 @py @r_``  @rc`t \ h a]`]@r- H H' ' 6` H?_`@J6*08408H0_65 4 @ 4`x] @ <<@Ha@] H _@@@H /_@@@/H 6 6`  OH_ H a]!a]@r __@@Hˠ$ '_ H a]!a]@q@q_@q_Hˀ O@E_`w`ˀ HH3w @qiw_D "  @qbwע`\`r t`` \`r t`` " `" _t`$`a ]_ H a]!a(]@q_w_㾰A@ga<wow'wwww_@K\ @P{ waH]_ wggaP] @qe@qS" _\ -p$_ϡ5`4w `4`x] @,_ 4 4wgg@qv@q4'_@P@Pu_*08408H5@P_'_\ w@KatD$D$D"`D"`_@Kk\ 'À?H_\ @I*08408H_á4`4  `4`x] @ <<@H /Hs_  '_\ æw@K#tD$D$D"`D"` /_@K+\ '?HI_\ @I*08408H6_5 4  4`x] @ <<@H%_]`5,0@` H@P_ H/_ס5 4  4`x] @ <<@H H /_\ @J'?O_H$O_\ æw@JtD$D$D"`D"`_@J\ '?HH_\ @I,*08408H5_5 4  4`x] @ <<@H$__ ]`5,0@4 4w ]` 4`x] @- ]`_H$_\ @Jz'?O_\ å*p$_ϡ2`4w `4`x] @,@Oa__\ @J['À?O@OB_*08408O@P_ /α4 㾠A@ebwWw'wwwww ' '_@J\ 2wOOaX] @oȁH@Nڐ waH]_ wOOaP] @o@o" _\ -p$_ϡ5`4w `4`x] @,_ 4 4wOO@o@o'_@N@N_*08408Hy@O!_'_\ _@ItD$D$D"`D"`_@I\ 'À?HV_\ @H6*08408HC_á4`4  `4`x] @ <<@H2 '{ /H{H _4,0@'{ H'{_  'Ǡ?'{_\ æ_@IptsD$D$D"`D"` /_@Ix\ '?HK_\ @G*08408H8_5 4  4`x] @ <<@H'_]`5,0@` H @N_@n_ H/_ס5 4  4`x] @ <<@H H /_\ @I/'?OH_ HH _d4@n,0w$'_,p$`'_H$O`{$ '{{H $ '_,0@{,0$@_\ æ_@HtsD$D$D"`D"`_@H\ '?HH_\ @GG*08408H5_5 4  4`x] @ <<@H$__ ]`5,0@4 4wg ]` 4`x] @- ]`_H$_\ @H'?O_\ å*p$_ϡ2`4wg `4`x] @,@M|__\ @Hv'À?O@M]_*08408O@N_@m_ /α4  A@cc\www'_  H a`]`]@mٔ!eH H' '_5 4  4`x] @ <<@H H'HO74 A@cbTwww'ww_\ @GtD$D$D"`D"` _@G\ 5?HE_ף54`4  `4`x] @ <<@H+___ _"_Z ,0@$54,0$@_ס54 4w 5 4`x] @, "_5_\ @GϬ5?OA@c`wwww 'ah]h 7@_ Hy_\ 7@@GN '_\ 7@@GH '_ߡ44  4`x] @ <<@Hۡ4`4  `4`x] @ <<@H#_ߡ44  4`x] @ <<@Hۡ4`4  `4`x] @ <<@HH!_ߡ5 4 @ 4`x] @ <<@H __ה@H__ۖ @7@ 7@_  O 7@_ H._7@54 ` 4`x]  <<@H_Z 5,0$w ``x] @-`_ה٘7@ 7@_  OA@balww_\  ap] @C(_ _\ \` \` 5_\  Hw_\ \`\`ϔן_ \ _ rL"_ \ _ `rL"66H  6` H 66H_ H a]!ax]@lG5_\ \`\`_ן H<'_\ \`\`_ן_ 6@Eޕ6_ H-p8408H a]!a]@l-p8408H H'_ 6@@65 5_\   O}-p8408`?'G< A@abwwwwߠ '_Z ˉ__  @h{_ \ ٥a]_  @hi__ @hb@kg__ \ يa]_  @hN__ @hG@kL_ߐ _  @h>_  @h7_  ,0_ @h/ ' < A@a`www @ka]z_t`_  @k@ 4@j,0`t \ ,0t@a]` 6뀤H-w_  @k a]K@j_ @kٸ@w_`64,0t@@jԐ@6 6뀤 Oa]*`_  @j_@  @j`@j,0`t \ `,0_ @j A@`bĮwww'_\ _ \ _C rL"_ \ _5 rL"a]_5֗7@57@H  7@ H a]__ 54,0@7@4,0@ _ 54,0@7@4,0@'4 @w_\ @j<_`_`a\ _`^\ @j4_`@j2@@j0_ ww_\ __ C\ 2 '``_ \ i@ٕ2@_ 4\ 2 '``_ \ Z@ن2@ `'``_ `,0@hI@0w_\ _` \ _` \ b2_2@`,0@ < 64 ww'_w`< 'ۢ`Bwߡ2@w`< 'ˢ`9wϡ2@w``w_G_[rL"_G_N5rL"77@H 7@H _74,0@7@4,0@'4 w''''J '2`'ߐ `'ې  _ߑ+pw:`- : "w-@ "5@ H`2*0w:`5 : "w5@ " w'''J '2`'ߪ `5@  _ߑ+0@:`2 5@ H 7@ 2*0@:`* 7@'2 w'''2`' `'   ; *@" _+pw7@:- : @"w-@ @"5@ H`2*0w:`5 : "w5@ " w''2`' `5@   :*@" _+0@:2@7 5@ H 7@ 2*0@:`* 7@'2 wwwwwA@^b`wwa]@f@f_@he @@h@@f@_@f@ @f@a]!@@hU@h[@@wwwwww0A@^a4wߐ (@h%h a]a]@hQ HH  @  (@f@$ $ t t t w0A@^`lww_\ a]@g@ ww_Z _ G H/p828: H G 2*0& G OA@]ctww?wwנ /wǠ /w_\` \` ! H`H a]!a]@h Hwb] HHb] ?a];F[_ \ < /`\ w@g΁H@'G` ,`a]` `;*[` @;m`w`b]! @g\w`  .8408< H_` .84p84@,0t`.8408< O / / d_ H a]!b]`@g` b]G`ԭ` _` t b]G`ԣ` _` t b ]@N_'H/-8408$ _` F\ ` \`t \`@\ _` t b(]-8408< _ H a]!b0]-8408@g_< -8408< HHHO-8408< H@; _`Hw_ H a]!b8]@g;@@_`_ Ha]!b@]@g+a]!bH]@g"bP]o` 40@f w` 40 @e `40@f w`40 @e  @f_``  @f`t \ h bX]a]@f H H' ' .8408< ` HE_`.8408@?< *08408H1_.8408< = < @ <a] @ <Hb] H _ǐ@@@H /Ɣ_ǐ@@@/ƀH .8408 .8408< ` OƀH_ H a]!b`]@f__@@HԠ$ /_ H a]!bh]@fz@f_@f_ƀHԀ O@:._`w`Ԁ HH3w @ew_D "  @ewע`\`r t`` \`r t`` * ` * _t` $`bp]_ H a]!bx]@f6_w_A@[cdwww'wwww_@@'\ @Ewb]e_ woob] @eb] HH'oGo_\ ,_ϡ5`4w `4a] @,_ <` @< 'oo@e@'oGo/_@E@D_*08408H1@EF_'_\ @?tD$D$D"`D"`_@?\ 'ǀ?H_\ @>[*08408H_ǡ4`4  `4a] @ <<@H /€Hq_  /_\ Ǧ@?tD$D$D"`D"` /_@?\ 'À?HG_\ @>*08408H4_á5 4  4a] @ <<@H#_]`5 @ `H@E7_ H/_ס= <  <a] @ <H H /_\ @?j'À?O_ @H- €O_\ Ǧ@?<tD$D$D"`D"`_@?F\ 'À?HG_\ @=*08408H4_á5 4  4a] @ <<@H#__ ]`5 @< < w ]`  < a] @- ]` _ H,_\ @?'À?O_\ , _ϡ2`4w `4a] @,@C__\ @>'ǀ?O@C_*08408O@D_ /α4 㾠A@Zaw_w'wwwww / /_@>\ @Clwb]_ wWWb] @dVb] HH'WGW_\ ,_ϡ5`4w `4a] @,_ <` @< 'WW@db@'WGW/_@Cv@C`_*08408Hm@C_'_\ g@>LtD$D$D"`D"`_@>V\ 'ǀ?HJ_\ @<*08408H7_ǡ4`4  `4a] @ <<@H& / /€HH _4 @/ H/_  /͠ /_\ Ǧg@=t{D$D$D"`D"` /_@>\ 'À?HI_\ @ < @  <a] @ <H _Z 5,@w a] @@-_Ԙ@/p8408 /p8408< _ O A@Vcww_\  b] @7_ _\ \` \` .8408< _\  Hw_\ \`\`הߟ_ \ _^ rL"_ \ _P rL"-8408< .8408< H  .8408< H -8408< .8408< H_ H a]!b].8408@`ʕ< _\ \`\`_ߟ HI'_\ \`\`_ߟ_ -8408< .8408@:]< _ H-p8408H a]!b]@`-p8408H H'_ -8408< .8408@4< .8408 .8408< _\   Of-p8408`?'G'G< A@V`twwwwߠ /_Z __  @\_ \ b]_  @\__ @\@___ \ b]_  @\__ @\@__ߐ _  @\_  @\_  _ @\ ' < A@Ubwww @_b]@_t`_  @_ < @_p,0`t \ ,0t@b]' .8408< H1w_  @_b]@_K_ @_-@w_`.84084,0t@@_H@.8408 .8408< Ob]`_  @_c_@  @_\@_``t \ `_ @_Q A@U`www'_\ _ \ _̷ rL"_ \ _̩ rL"c]_-8408< /p8408< -8408< /p8408< H  /p8408<  H c]__ -84084 @/p84084 @u _ -84084 @/p84084 @/4 @w_\ @^_`_`\ _`\ @^_`@^@@^_ ww_\ __ ί\ 2 '``_ \ Ւ@2@_ Π\ 2 '``_ \ ƒ@2@  `/``_  `@\@0w_\ _`{\ _`w\ А2͐2@`@ < 64 A@Ta$www'_w`< 'ۢ`ͫwߡ2@w`< 'ˢ`͢wϡ2@w ``w_G_-8408< rL"_G_ʹ-8408< rL"c]_/08408< /p8408< /08408< /p8408< H  /p8408< -8408< H _/084084 @/p84084 @/4 w''''J '2`'ߐ `'ې  _ߑ+pw:`- : "w-@ "5@ H`2*0w:`5 : "w5@ " w'''J '2`'ߪ `5@  _ߑ+0@:`2 5@ H 7@ 2*0@:`* 7@'2 w'''2`' `'   ; *@" _+pw7@:- : @"w-@ @"5@ H`2*0w:`5 : "w5@ " w''2`' `5@   :*@" _+0@:2@7 5@ H 7@ 2*0@:`* 7@'2 wwwwwA@Rcwwc]@[ @[_@\ @@h@@[ @_@Z@ @[@a]!@@\@\@@wwwwww0A@Rbtwߺ p@\t "  * 8" " " r r (r 0r @r Hr P!" X  @\``t w`h\ c]@[O@h c ]c(]@\ .HH  @w0A@Ra\ww_\ @\=_``c0]@\6@ ww_Z _ G H7@H G 2*0& G O0w'_Z  H* '`X A@R` www_\ _h*@Z$@[_ `_$`  /H` @\& `t \ c8]@\N_` @\ `t \ c@]@\@_ A@Qcwww_\ _`ht \ h cH]c(]@[Ŕ fH  0w'_Z  @H H ': / 80w'G H H_Z G' A@Qaww?ww׶ cP];[_H8\ c] HH c] Hc] ?H+c] Hc] ?HcX]c(]@[> H H'à 'H G` O OO?`_\  `$`c`]`Y`w`8w@[4@["`<$`ch]`D`< @[.w` _ H a]!cp]@[/cx],G``<8w`Pc]"@_'ÀH 6$ _`Pw`Pc]6_ H a]!c]@[66 HHHO6 H c]@Z_` Hkwc]`< @Zw`( '`<H_` Ӡ%4 < _`(-0@-%@'`< O @ZTw_D "  H@ZMwע`0\`r t``@\`r 0t``H\`r 8t``P\`r @t`` \`r t``(\`r t``<" (`: ` " G` " _t` $`c]_ H a]!c]@Z_w_pA@P`w/w_\   '`X@Yw`< @ZTwwww 'wwww 'w wg_\ \` \`c]`L '`HC_\ \`\`{6{@4 `Xh_ H a]!c]@Z#_`'c '_ '[$` 7`<H_ǡ74,0@ H _c@'_'c_$7 7`< O ג @Yw 7׀H4[_ϡ64@@ @W_`P_ϡ64@ [1`<rL"'6__,0@`,0$wO` $`[ 7 7׀ O@W_``  @Ywc]_``@Y_c]@V#w@YH_w 7׀H#[__74,0@ @W__74,0@[ _ @V w7 7׀ O '׶ _`<,0@Wx  '@Y_@V__ϡ64@{ @WY_ϡ64@ _{@WP6{ @_`P_{Ʃ@<rL"' ] @ ` HD H!c] H `w''HH''G',08408< ] H @X_@X_Ǡ H'_` @ ` ,`_ǡ,@w_` $`נ '_\ \`\`_{ '` O6 H_ H a]!c]@X_`'c '_ '[$` 7`<H_ǡ74,0@ H _c@'_'c_$7 7`< O ג @Xw 7׀H4[_ϡ64@@ @V_`P_ϡ64@ [`<rL"'6__,0@`,0$wO` $`[ 7 7׀ O@Vi_``  @Xuwc]_``@X_c]@Tw@X_w 7׀H#[__74,0@ @VQ__74,0@[ _ @Tw7 7׀ O '׶ _`<,0@VD  '@W_@T_@W_@W_$H H'_ H a]!c]@X$aP]\ aP]@U\  _`h@ @Tw`_`h  @Tw`_`h  @Tw` _`h  @Tw`<_`h  @Tw_` `<_`h @Tw`X@w @Ww @Ww  7H;{@U_``  @Wwc]_``@W7_7@ _@Wg_w_7@ w_`P {@`<rL"'_75@,p$__,puw`7 O '  @Wwg  '`HV_@m_72@,0'w_@{whgh0_`P_ {`<rL"'_75@,0H__g.84084,0t@.8408 w '_{@@wo_h3.8408< _` w @H `]c(]@W!H H'c 'c_74-p]_g.84084,0t@.8408 u '_-p$@_u_h2.8408< _` w @H `]c(]@VΔ!H H'c 'c_74-]`_g.84084,0t@.8408 u` '?4 _-$@.8408< _` w @Hw_wWwOwG 'C_g.8408< )w_wWTG` _Ws`_WwOh _ Ha]!`]w `<@V '_W_g.8408@< __Hj_ HwtcL#$@ H a]!`]``<@VH)w7_O\ w7_7wC@@H'wGw7_O\ w7_7wC@@HwGcX]c(]@V4!H H'? '?H G` O OO_GC_`h @Rw@U_GwG_W_g.8408@Q< _O__ ` O@_@U_g@U_@U_瀤H H' 'G< 0w'  7@@H_7@2*0@72*0@H7@ 7@@ O752 @w' /p8408< H_/p84084,0@U\@_/p84p84@,0t`/p8408<  Oww'w߬  'Ϡ 'ww_`\`0Ç_\ 8Âˢ@@ _$  @U@ϔ @S`_@SϠ@ ˔ @SϠ@ _@S 5HϢ@ˢ@54@ _\ (,@ @St5 55@ O@U_@U_@wװww'wߠ 'Ӡ 'ww_ \  @w@U`t \ `_ @K A@@cwww_Z _`]``_  @G_``_ @G_@  @G_``_ @G ' < @w_\ @J_`@J_`@J@@J_ www'__z_@7@7@5$@5@4 0ww'_\ _`_`_74  ww_\ _ %``_  @H@ @@ `'``_ `@H@0w_Z `` : 72  ww'_w``wߠ@ w_74 w''''J '2`'ߐ `'ې  _ߑ+pw:`- : "w-@ "5@ H`2*0w:`5 : "w5@ " w'''J '2`'ߪ `5@  _ߑ+0@:`2 5@ H 7@ 2*0@:`* 7@'2 w'''2`' `'   ; *@" _+pw7@:- : @"w-@ @"5@ H`2*0w:`5 : "w5@ " w''2`' `5@   :*@" _+0@:2@7 5@ H 7@ 2*0@:`* 7@'2 wwwwwA@?`wwa]@GJ@GF_@H @@h@@GJ@_@G6@ @GB@a]!@@H@H@@wwwwww0' @Iww0A@>cww' _h a]a]@Hɔ LHH   7@H_7@4@,0$ `7@ OA@>bDwwww''߬ _ߥ,p,pw_`,0w_`,0wϬ 5`H!_ _`H `H a ]r H/_Ϡ wϡ5 5_  O_ _$` $`_ ` $` /ޱ4 @w@H$_A@>`w''wϝ?wϡ?a(] ?a0] Ha(] a8] HȿH?a(] @H*I@HH?a8]@H  I?HHСA@=c|ww'' @Ha@] ?Ϻ 7@H_7@5@,0,0w` $``7@ O 7@H07@4,0` H!?`w?`ww@GI@?a8]@G IH?ϡ7@ 7@ O@Gp?灠HH0A@=aĮwߐ 8@GIh aH]a]@Gu HH  @  8@E@$`t`$`$`t`$`  ,`$ $`( $`,t`0w@@0A@=`ܮww_\ aP]>_`0h@Gw`0@G@ ww_Z _ G H7@H G & G O0A@<cԮww'_h aX]a]@F HH  _\   H  H '&,0A@<cww'_h aX]a]@Fʔ HH  _\  H H '&(wwwwߠ 'נ '_\ w '` ,p,p@Fcw#'_$ $ '_`hG`` w`_`_\ \` \` '` HY_\ \`\`_`_6_ץ,p,pw`tL$'˨` tL$%` $ t@L$@ %`%`_\ \`\`__ӡ,0@ w` $``_H$נ '`  O_$  '`H_נ%4,0```-$%`'` O_נ$ 4,0@$  '` H_ץ+0+0@w__`A*08408H נ '`  O` H@E_ H / O:@E__`w` /ޱ4 СA@;bwww''' 4 @Ew_\ w_\ wa`] '뀤H_,0@ '`H _ϡ4@,0 w` $` '뀤 O_$  '〤H_%4,0```-$%`'〤O_$ 4,0@$  @E|w '뀤H(_-0`'`H_ϡ4@,0``'_,0@$``$`w $ '뀤 O@D___t` @EEw ' ' '〤HL_,0@`'``H7_,0@`'$` 'H_-`_,$``$`'' ' O '_,0@`` O '〤O@D___t`_wװA@:blwwww''''__ۑ*0@*0_ ( H, 5׀@H$@  J@ߔ@_jJ@"'Z0Ô@ (@Hw  * 5 5׀@ OH8 5׀@H2@  J@ߔ@_jJ@"'Z0Ñ22*0@ 2*0a] @Hwa]@" 5 5׀@ O5׀@HS__ۑ*0@*0_ ( H5`H``J@ߔ@_jJ@"'Z0Ò@w `" *``O#`H'5 H#``J@ߔ@_jJ@"'Z0Ñ22*0@w 2*0a]@# `Oݬ$  H/֐ /ֱ2 www'w''Ϭ   '___55@s*08408H55@_ L@__ӡ,0@ ,0$ H /Ρ5 5_ @ H$@5@  '〤H5@_  H H/Oα4 www'w'_wǬ  〥H4_ס54,0@```@H"____Ǜ5@54s*08408H H/ơ5@ 5@_ס54,0@`` O5$ 5 O /Ʊ4 A@9`twwww'w'_wah]' H ' ' '_,0@ `'` H_,0@`' ' '`HF___Bs*08408H_ L@__,0@ ,0H$_,0 _,0@`4,0% `4,0$` ' ' '_,0@  O_,0@$` '_ @ H$@' ' 'ӀH_  H _,0@$` H/_,0@  O|_,$`$' O_ /Ʊ4 www'w'_w_ `$H ___Ӑ@$sH /___Ӑ@s/Ʊ4 A@8`wwwwww'Ӡ '_`( H\`0`@@c H \`0` 4 4,0@@Y  5ӀH_ס54,0@`'``H5'__ǡ,0@`,0w_ߨ` ,0@_ `tL$' ,0@`t'À HM '_``4L@@_ lL$' (H] 0@ ` H HK/w ` H,`] 044,0` 4,0a]H H2/w`a]@%`_ wà$ 'À OǠ '_ס54,0@`` O5 5ӀOjap]y /ұ4 㾠A@7a\ww?ww_\` ?Ǡ /!' dww / 'a@] ?\` ` $`ax]`B` `,t `$`a]`2a] Ha] ?a] Ha] ?a];[` www`(wwwǑH @A `$ ` H`$`@*08408< H`` O$`a]`@`( H` `?_ H a]!a];@A[`w`  @@wwww?W` www@@@?ga8]@@ gIa] W@@IH'@`( H ` 4 4 @@w`0H` @@w`0` @@5@$ _ H a]!a]` `@@___Ζ*08408H_ H a]!a]@@ H/_ H a]!a]@@h@@(`` _ H a]!a]@@r__@s/ƀH,@`( H\`0`@>\ H \`0` 4 4,0@>R 5@ H_ H a]!a]@@@ H$/Ot_ H a]!a]@@-_`h@?ǐ  8@@`t @\ _``@ђ_@?_@?@?H _`hѐw`H3w @?w_D "  @?wע`\`r t``\`r t`` " `" _t` $`a]_ H a]!a]@?_w_A@5awww @?Na]|_t`_  @?b]m@?6_ @?pw @?9_  @?cb]P@?_ @?S  8@?nw _ @q@?b]6 _  @?< _  @?5A@5`$wwww_Z __ b]_  @;__ @;@>__ @ab ]_  @;__ @;@>_ߐ _  @; _  @; ' < @w_\ @ _`@>_`_`@>@@>_ww'_\ _`_o`tL$ע` `tL$'`$ tL$ _`@s5@7`  tL$'ǥ7 t'54ǠL@â@ l@L$@''4  ww_\ _J_ 2 '``_ q@2@ '`` '``_ @@ w_\ &_`'@#_`6474@ < 64 ww'_`< '`_wס2@'Ǭ_G_˜ǁt@L$@'t@L$@'ä' t@L$@ @7@t@L$@'7@t'5@4L@@l@L$@''4 w''''J '2`'ߐ `'ې  _ߑ+pw:`- : "w-@ "5@ H`2*0w:`5 : "w5@ " w'''J '2`'ߪ `5@  _ߑ+0@:`2 5@ H 7@ 2*0@:`* 7@'2 w'''2`' `'   ; *@" _+pw7@:- : @"w-@ @"5@ H`2*0w:`5 : "w5@ " w''2`' `5@   :*@" _+0@:2@7 5@ H 7@ 2*0@:`* 7@'2 wwwwwA@2bwwb0]@:̐@:_@b]b]7@_\ @)@ڔ@_\ @7@_`] *p"7@4,0$b]] 7@2,0@ ]`_\,0@__x7@_\ @7@?OA@0`4ww_\  b] G ,0a]\@G ,0a]\@@_ _\ \` \` 5_\  Hm_\ \`\`ϔן_ \ _w rL"_ \ _i `rL"66H  6` H 66H_ H a]!b]@95_\ \`\`_ן H;'b]_ϒ_\ \`\`_ן_ 6@A65 5_\   O@_ @_ H@H a]!b]@9b]@`?'G< A@/a<wwwwߠ '_Z 1__  @6#_ \ Mb]_  @6__ @6 @9__ \ 2b]_  @5__ @5@8_ߐ _  @5_  @5_  ,0_ @5 ' < A@.cwww @8c]b_t`_  @8 4@8,0`t \ ,0t@c]H 6뀤H-w_  @8c]3@8~_ @8`@w_`64,0t@@8|@6 6뀤 Oc]`_  @8_@  @8`@8O,0`t \ `,0_ @8 A@.adwww'_\ _ \ _ rL"_ \ _ rL"c ]_57@57@H  7@  H c(]__ 54,0@7@4,0@ _ 54,0@7@4,0@ t@L$@'4 @w_\ @7_`_`\ _`\ @7_`@7Ґ@@7_ ww_\ __ \ 2 '``_ \  @52@_ \ 2 '``_ \ @&2@ `'`` '``_ `,0@5@0w_\ _`\ _`\ 22@`,0@ < 64 A@-awww'_w`< 'ۢ`wߡ2@w`< 'ˢ`wϡ2@w``w`'`w_G_rL"_G_rL"c ]_7Ǘ7@77@H  7@5@ H c(]__74,0@7@4,0@_74,0@7@4,0@t@L$@'4 w''''J '2`'ߐ `'ې  _ߑ+pw:`- : "w-@ "5@ H`2*0w:`5 : "w5@ " w'''J '2`'ߪ `5@  _ߑ+0@:`2 5@ H 7@ 2*0@:`* 7@'2 w'''2`' `'   ; *@" _+pw7@:- : @"w-@ @"5@ H`2*0w:`5 : "w5@ " w''2`' `5@   :*@" _+0@:2@7 5@ H 7@ 2*0@:`* 7@'2 wwwwwA@,`8wwc8]@42@4._@5ې @@h@@42@_@4@ @4*@a]!@@5˔@5ѐ@@wwwwww@'  H 2 '7  O762 @w_$ $ $ @ _t (@w_@5\ (_t (@  ww'w_ $`_`$ 4,0%  `t_ $`` H $`_``< 44 @5w_``L 4 4 @5_t`( `< ,$ '߸ 7`H_] (7_2@,0ߔ @  67 7_  O  7_``< 4H/7_54,0@_ < 4@H5 7_54,0@_ < 4@O5_ף7$`4,0$`7_``< 4O_`_``< 4`@j@4_ׁ A@*cdww'_ H H>' < 4 < ,@$ 5 '6`H H 7@ @5$` 7@6$@_] 7@4`4,0 `4,0c0]@ H] (7 5〢H7@ 7O 7'4 @w_@ 7@_``L 4 , 7@ `7@64 A@*awwww_@F '_``L 4 ,  wϠ '5@@ _$`c@]ocH]j5@_  @4y_t \ h?4 _$`_ @2h7@ cP]_ K_\ 7@4@_  @2U7@ cX]_ 8_\ 7@4@_  @2B7@ c`]_ %_ @_\ 7@4@˔ @2+7@ ch]_\ 7@4@_@27@˺@@3__\ 7@4@_\ (5@@2 47@5@@cp]_  A@)bԮwww'  ' __ @17@ cP]_ _ _7@4@ @17@ cX]_ _ _7@4@ @17@ c`]_ _7@4@ @17@ ch]_ _7@4@@7@@_\ (h@3D_``L 4 5@4 @3_ (t`5@, \`_7@4@5@@1|47@5@@cx]_0ww_@h_hw '@__@1Q@2_0w_@ _``L 4 , 67@ 64 A@(cww'_''߶'۶'רwϠ wס4 4,0w〤HH:'ۥ< 4 ,$ 5@ '5`H H 7@$`@ 7@5$@_ǣ7@4`4,0 `4,0c0]@ H_7ܗ5@H7@ 7O 7'4 w''''J '2`'ߐ `'ې  _ߑ+pw:`- : "w-@ "5@ H`2*0w:`5 : "w5@ " w'''J '2`'ߪ `5@  _ߑ+0@:`2 5@ H 7@ 2*0@:`* 7@'2 w'''2`' `'   ; *@" _+pw7@:- : @"w-@ @"5@ H`2*0w:`5 : "w5@ " w''2`' `5@   :*@" _+0@:2@7 5@ H 7@ 2*0@:`* 7@'2 wwwwwA@'b@wwc]@/@/_@1] @@h@@/@_@/@ @/@a]!@@1M@1S@@wwwwww@'  H 2 '7  O762 @w_@  _$ $ t ($ t 0@w_@0\ 0_t 0@0\ (_t (@ 1  ww' @14w_$`$` 7`H#_74,0@`H_H$`_ߡ74,0@$_ @$7 7_  O_\ 0h@0_  4 4 @0_t`0$` 7`H,_74,0@`H _ߦ< -$ %@'_\`0`_  _ߡ74,0@% 7 7_  O_``t8_ $`` H $`_\ (h@0\_``L 4 4 @0_t`( `< ,$ '$` 7`H#_`_ߓ72@,0%`](`۔ @ _``< 4_ߣ74@,0$`7` O_@ ' _`_```< @ 4@0_߁@w_@  7@_` 4 , 7@``L 4 , 7@ 64  A@%cܮww'_  H c]c]@/ H H'נ 'צ _ < ,$ '`H  @ N@H @ I$`6$ $@ _ `< ,5@] (`}_ @ 66$@ _ `< ,7] (`i75@$@7`H H'_\ 0͔@'ߢ 7< ,@$ '4 A@%awwww_@` '_``L 4 , ` 4 , 'ۺ wϠ '5@@۠@ _$`c]c]5@c]_  @/_t \ h?4 _$`_ @-u7@ c]_ _\ 7@4@_  @-b7@ c]_ _\ 7@4@_  @-O7@ c]_ _ @ _\ 7@4@˔ @-87@ c]_\ 7@4@_@-'7@˺@@.__\ 7@4@_\ (5@@-47@5@@_\ 7@4@_\ 0@- c]_ n A@$bwww'  '  '__ @,7@ c]_ G_ _7@4@ @,7@ c]_ 5_ _7@4@ @,7@ c]_ #_7@4@ @,7@ c]_ _7@4@@ 7@@_\ (h@.F_``L 4 5@4 @._ (t`5@, \`_7@4@5@@,~47@5@@_` 4 '\`0h@. ے @.l_ 0t`ۡ, '\`_7@4@@,^c]0ww_@h_hw '~@__@,7@-_0w_@ ѐ _` 4 , ``L 4 , 66@7@ 54 w'_w`'`w``w w`'۪`wwۡ4 4,0@wwL@ 4 'á,0ww =,@$ '󀤠H @@ H$@ @7$ $@ 5:,6_K_@ 77$@ 5:,7@_;7@6$@7@`H H'_@' 7@< ,@$ '4 w''''J '2`'ߐ `'ې  _ߑ+pw:`- : "w-@ "5@ H`2*0w:`5 : "w5@ " w'''J '2`'ߪ `5@  _ߑ+0@:`2 5@ H 7@ 2*0@:`* 7@'2 w'''2`' `'   ; *@" _+pw7@:- : @"w-@ @"5@ H`2*0w:`5 : "w5@ " w''2`' `5@   :*@" _+0@:2@7 5@ H 7@ 2*0@:`* 7@'2 wwwwwA@"awwc]@*@*_@,1 @@h@@*@_@*t@ @*@a]!@@,!@,'@@wwwwww0'' 8@+hH@+,0w`@+,0w`@+,0w`w` '`('`'`@ؐ@@@A@!cwwc]_@+\ _@+\ _@+\ _@+\ @+_0A@!c,ww 6_ Hv`]6_\64,0@7@c] H[ `]\uL%5@4,0@uL%4,0@+@_\ 7@4,0@c] @H0 @`]_\`7@`tL$6@4,0tL$4,0@+_\ 7@4,0@c] @O6 6_  O A@!aww''_`,'` H `]`]@+A YH H' '_  H ` ]`]@+, ZH H' '_  H `(]`]@+ [H H'ߠ '_D 0H `0]`]@+ \H H'۠ '_`^`/0`^ .$^`$@`^$@^`,0@^ `4,0$^`$@^4,0$@`,` $` A@ bww''' '`8]_\``tL$@4,0tL$4,0X '_\``tL$ߠ@4,0HtL$4,0뀤H H,' '_\``tL$ߠ@4,0뀤HtL$4,0H H' 'G<  A@ `ww''_\ ,0@c] @H `@]`]@*! uH H' '_7@NH 7@_ t@L$@5@H3'_\ 7@4,0@c] @H `@]`]@) zHH  _7@O 7@_ t@L$@5@'4  A@bww''`H]t_Z *7@H_\7@4,0@\,0$@`P]Y`X]R7@'_\ 4@,0c] @H `@]`]@)~ H H' '_7@O_\ 7@4,0@,0$@`P]@w'' _" 0_0A@`ww 7@_ @Hc] _[ 7@2*0"@7@ @ O 7@_ * @Hc] _[`7@3*0"@ c] [`"  7@`* @ O_" ," 0A@cdww'ww_\ *p ``]7@c] H H/ޠ 'Ϡ 'ˠ '__ uL%Ϡ@4 4 < uL%ˠ@ 4c] @ uL%Ǡ@ < <H _$`_\7@4,0@7@c] @HG 'Ϡ 'ˠ '_u@L%@Ϡ@4 4 u@L%@ˠ@ 4c] @ u@L%@Ǡ@ < <O-8408H H/`h] 7@_$`O -8408/ޱ4 A@`ww'w ''ۺ __7/․H '`p]_\``r@L"@Ӡ@4,0r@L"@4,0 'Ϡ '__ tL$Ϡ@4 4w ` tL$ˠ@ 4c] @-` ']` tL$@4,0ۀ@H]` t@L$@4,0`x]l7@_7@_/․H `]]7@7@H'ہOx A@aܮww_ 40@'L _ 4  4w@% `]_``1 7_ H_707 7_  O 6_ H,65`4 `4c] @ <<@H`]_\5@,0@4,0@@'H  `6_  O@' =0A@`$ww'_Z 22 @ 2c] @ ::@/p82082  A@cww_ 40@& w_ 4  4w@%# _@&\ _ 40@& _` t $`(\ `40 @% `]_`` 6_ H_6_6 6_  O 7_ H_75`4  `4c] @ <<@Hx`]_\5@,0@4,0U@_ ]` ]74,0@4`4  `4c] @ <<@H (` $`]`]4 4w ] 4c] @- _` ]`^ 7``4,04`4  `4c] @ <<@H `(` $`]^ `4,04 4w ^ `4,0@ 4c] @- 7 7_  Os@%_0A@` ww''_] -p7@c] HH% 9@HH _\7@4,0@7@c] HH  O /084084 0w''_Z  J@2*07@2 @w_ (7@2 0w''_Z *p'w .0  0A@awww_`c] HH?_Z2*0`@H2*0H@_Z _ *0@"652  www_ _ h_  hO_jJ@"M_jJ@"_20w ow߰ www_@`h_" @hH   _瀢@hM@_j@ J "@"@hH `_瀣@ o /p82082  w_ ` hHW l`L $@ hHO l`L $@ hHG l`L $@ hH? $` 6@ ` o _ s@_*08408< HH%  _ b_*08408< HH  =_ =Q_{*08408< HH  .84084 wwwwwA@aww`]@"@"_@$G @@h@@"@_@"@ @"@a]!@@$7@$=@@wwwwww@w_`2 "`@w_2 "<@"@w_" " r r 0w_@6 2 2   @7@6* @7@7* @7@52 @w_@#\ _@#\ _t t  A@cww_Z  67@77@_ @H+5@72 `] @@57@ O7" 2 *0`]@5@"2 @: *@_Z 63*0"@OӴ ww'' '_%  $ @'Ӡ 4 ' 4  '] h@#Oϒ @#_t \ h@#C˒ @#_t  55@'_54,0@5@H$ ۠ '۠ ` H _\ 4`$ 4,0$5 5_ H7_4,0@5@O5@_ H)_54,0@H۠ '۠ ` H _\ 4`$ 4,0$5@ _54,0@5@OOۢHנ  < 4'_\ $4 4,0$@_ A@cDwww'_22*0@'2 '_72 @  : *@"  : `] @' 5_72 `] @@5뀢 O7" 2 *0`]@3@"2 @: *@'2 @w'_\`\`7@4  A@aww'2_7@2 @  : *@"  2`] @  7_7@2 `] @75@ O7@" 2 *0`]@5"2 @: *@3@2 @w'_\ 7@4  A@`Dwwww_``' 4 , `4  , 'ۺ 5@۠@ _$   @"0_t \ h?4 _$`_ @ 7@ _\ 7@4@_  @ 7@ _\ 7@4@_\ 5@@ 47@5@@_\ 7@4@_\ @`]_ s A@bwww'  '  '__ @7@ _ _7@4@ @7@ _``' 4 , `4  , '\`h@!c5@440 @!_t \ h@!Uۑ40 @!_t \ _7@4@5@@47@5@@_\ _7@4@@`]0ww_@h_hw '@__@c@!_0w_@6 2 * 2  * 77@@ 62 w'_````7 4 wϡ7@4,0@w@'4 0w'_h7@4  A@cw' 4 @ h `]`]@ Ŕ HH  @ @ t`$` $`$`w@@@w_  @ "H /p82082 0A@aww'_`  `tL$`H `]`]@ w HH  _ `  tL$$`] `,0$0A@`ww_*08408H `]`]@ @ $HH  _ `  tL$$`] `,074 0A@`ww_`` @H)a]!`]_\`7@ `tL$4,0@ 47@ _`tL$7@` O@w_@\ _@r  A@bw' @h `]a]@ HH  @t`t`$`$`$` ,`w@@0A@bwww_a]@B_t @w'_" @w_ 7@2 @w_@;\ _  @_`t \ `\` @]_ $   H - _$  www߸  _ `H ``H @Hjw_ 7`H$ `$@6H_] @@84__64,0@_\``7@*4_ 7@$_` `@ w_ @_ 7`H$ `$@6H _ߐ ] @@4o__ߡ64@ _\``7@4_ 7@$_w_@w_@\ _t @\ _r " " "  @}* PPalloc_sectionfind_entry_node_g_ir_node_build_typelibget_type_size_alignmentstate_switchpop_nodepush_nodeparse_basicparse_type_internalintrospectable_preludestart_functionstart_parameterstart_fieldstart_propertystart_constantend_type_topend_type_recursestart_return_valueend_element_handler_gi_typelib_hash_builder_prepare_gi_typelib_hash_builder_pack_gi_typelib_hash_search@@??ᙙ?333333@ @ @ @ @ @?C0A @?zG@?@ @ @ @ @ @?zG@@@ @ @ @ @? @?ffffff?=p =@? @ @ @ @? @?ffffff?=p =@ @ @ @ @?@?@ @ @ @ @ @?C0A @ @ @ @ @??@ @ @ @ @??zG@4 @? @@Q @ @ @ @? @ @ @ @ @? @ @ @ @ @? @ @ @ @ @?%s-%s%s.tmpwbfailed to open '%s': %s ERROR: Could not write the whole output: %sERROR: failed to rename %s to %s: %sno input files [parsing] start, %d includeserror parsing file %s: %s [parsing] done[building] start[building] module %sFailed to build typelib for module '%s' Invalid typelib for module '%s': %s[building] doneno-initdo not create _init() functionincludedirinclude directories in GIR search pathoutputoutput fileFILEmodulemodule to compileNAMEshared-libraryshared librarydebugshow debug messagesverboseshow verbose messages%d: In .: %s-%s.gir:%serror: %s girepository/girmodule.csection_id != GI_SECTION_END%d entries (%d local), %d dependencies allocating %d bytes (%d header, %d directory, %d entries) GOBJ METADATA Names may not contain '.'Found implicit cross references, starting overleft a hole of %d bytes header: %d entries, %d attributesreallocating to %d byteserror building typelib: %s%lu strings (%lu before sharing), %lu bytes (%lu before sharing)%lu types (%lu before sharing)functioncallbackparamtypeobjectinterfacesignalpropertyvfuncfieldenumflagsboxedstructvalueconstantxrefunionunknownUnhandled node type %d Unhandled node type '%s' node %p type '%s' size %dCaught NULL node, parent=%snode %p type '%s'node %p type tag '%s'Unknown type tag %d node %s%s%s%p type '%s' full size %d'' file %s: line %d: assertion `%s' failedgirepository/girnode.cnode != NULLmember != NULLCannot add a member to unknown type tag type %d in-outoutinTRUEFALSEname != NULLstrlen (name) > 0.Too many name partsCreating XREF: %s %stype reference '%s' not found%s%s*[length=%dfixed-size=%d%szero-terminated=1,]GByteArrayGArrayGPtrArray<>%s.Interface for type reference %s not foundGListGSListGHashTableGErrorbuild_typelib: %s%s(%s) node->offset == 0((GIrNode *) function->result)->offset == 0building function '%s'((GIrNode *) signal->result)->offset == 0Unknown member function %s for vfunc %smembers == NULLnode %s%s%s%p type '%s', offset %d -> %d, offset2 %d -> %dexceeding space reservation; offset: %d (prev %d) offset2: %d (prev %d) nodesize: %dUnexpected enum width %dUnexpected enum storage type %sCan't resolve type '%s' for %s%s has is not a pointer and is of type %s%s has void typegirepository/giroffsets.ctype_ffifield %s.%s.%sRecursion encountered when computing the size of %s.%saliastyperecordnamedisguised1%s.%sgir-1.0/usr/local/share/gir-1.0girepository/girparser.cctx->state != newstatectx->node_stack != 0popping node %d %snode != NULLpushing node %d %sTypeGLib.TypeList<ListGLib.List%sSList<SListGLib.SList%sHashTable<HashTableGLib.HashTable%sError<ErrorGLib.Error%sGLib.ListGLib.SListGLib.GLib.HashTableGLib.Error,type->tag >= 0 && type->tag < GI_TYPE_TAG_N_TYPESResolved: %s => %s GLibGObjectParsed type: %s => %dFailed to parse type: '%s'ctx->state != STATE_PASSTHROUGHintrospectableshadowed-byglib:boxedglib:nameglib:type-nameglib:get-typedeprecatedLine %d, character %d: The attribute '%s' on the element '%s' must be specifiedfunctioncallbackconstructormethodshadowsc:identifierthrowsnonecontainerfullUnknown transfer-ownership value: '%s' for property '%s' in type '%s.%s'required attribute 'transfer-ownership' missinginvalid value for 'transfer-ownership': %sparameterdirectionretvaloptionalallow-nonecaller-allocatestransfer-ownershipscopeclosuredestroyskipunknownoutinoutcallasyncnotifiedfieldreadablewritablebitsbranchgpointer0enumerationbitfieldglib:error-domainpropertyconstructconstruct-only<<membervalueconstantinterfaceglib:type-structclassparentabstractglib:fundamentalglib:ref-funcglib:unref-funcglib:set-value-funcglib:get-value-funcarrayvarargsThe element is invalid hereGLib.ArrayGLib.ByteArrayGLib.PtrArrayzero-terminatedlengthfixed-sizec:typegconstpointercurrent node is %d param != NULLdocattributereturn-valueimplementsglib:signalwhenno-recursedetailedactionno-hookshas-class-closureLASTFIRSTvirtual-methodmust-chain-upoverrideis-class-closureoffsetinvokeralwaysneverglib:is-gtype-struct-forforeignuniondiscriminatorModule '%s' imported with conflicting versions '%s' and '%s' %s-%s.girCould not find GIR file '%s'; check XDG_DATA_DIRS or use --includedir Parsing include %s %s: %s %s:%d:%d: error: %s %s="%s" <%s%s>includeversionFailed to parse included gir %s-%s%s-%sc:includenamespaceOnly one element is currently allowed per shared-libraryc:identifier-prefixes name element '%s' doesn't match file name '%s'parametersprerequisitepackagerepository1.2Unsupported version '%s'c:%s:%d:%d: warning: element %s from state %d is unknown, ignoring Unexpected end tag '%s' on line %d char %d; current state=%d (prev=%d)Unexpected end tag '%s' on line %d char %dcase STATE_FUNCTION %dctx->unknown_depth >= 0Unhandled state %d in end_element_handler Expected namespace element in the gir file.girExpected filename to end with '.gir'[parsing] filename %s/-gchargshortgushortgintguintglonggulonggssizegsizegintptrguintptrgbooleangint8guint8gint16guint16gint32guint32gint64guint64gfloatgdoubleGTypeutf8filenamegunicharfile %s: line %d: assertion `%s' failedgirepository/gthash.cbuilder->c == NULLnum_elts <= 65536cmph_size (builder->c) == num_eltsbuilder != NULLbuilder->preparedbuilder->buildablelen >= builder->packed_size(((unsigned long)mem) & 0x3) == 0hashv >= 0 && hashv < num_elts(((unsigned long)memory) & 0x3) == 0%s:%d key_sourcegirepository/cmph/cmph.ccmph_struct_vectorcmph_vectormph0Destroying mph with algo %s Creating mph with algorithm %s Creating chm hash Creating bmz hash Creating bmz8 hash Creating brz hash Creating fch hash Creating bdz hash Creating bdz_ph hash Creating chd_ph hash Creating chd hash Loading mphf generic parts Loading mphf algorithm dependent parts Loading bmz algorithm dependent parts Loading bmz8 algorithm dependent parts Loading brz algorithm dependent parts Loading fch algorithm dependent parts Loading bdz algorithm dependent parts Loading bdz_ph algorithm dependent parts Loading chd_ph algorithm dependent parts Loading chd algorithm dependent parts Loaded mphf mphf algorithm: %u bmz algorithm search bmz8 algorithm search brz algorithm search fch algorithm search bdz algorithm search bdz_ph algorithm search chd_ph algorithm search chd algorithm search mphf->algo = %u bmzbmz8chmbrzfchbdzbdz_phchd_phchd%s:%d Loading mphf Algorithm %s not found Algorithm is %s and mphf is sized %u %s:%d fchgirepository/cmph/fch.cEntering mapping step for mph creation of %u keys Starting ordering step Starting searching step. Successfully generated minimal perfect hash function %s:%d bucketgirepository/cmph/fch_buckets.cIncreasing current capacity %u to %u bucket->entriesIncreased index_key < bucket->sizePrinting bucket %u ... key: %s bucketsbuckets->valuesindex < buckets->nbuckets%s:%d Jenkins function - %u Jenkins function created 0girepository/cmph/hash.cAlgobuf is %u jenkins%s:%d Initializing jenkins hash Dumped jenkins state with seed %u Loaded jenkins state with seed %u %s:%d edge %d %d %d %d nexts %d %d %d first for vertice %d %d error remove edge %d dump graphbdzgirepository/cmph/bdz.cDestroying algorithm dependent data b: %u c: %f b: %u -- k: %u ranktablesize: %u Created hypergraph m (edges): %u n (vertices): %u r: %u c: %f Entering mapping step for mph creation of %u keys with graph sized %u linear hash function %u iterations remaining acyclic graph creation failure - %u iterations remaining Entering assigning step for mph creation of %u keys with graph sized %u Entering ranking step for mph creation of %u keys with graph sized %u Successfully generated minimal perfect hash Successfully generated minimal perfect hash function B:%u %u %u -- %u %u %u A:%u %u %u -- %u %u %u Dumping hash state with %u bytes to disk Loading bdz mphf Hash state has %u bytes Reading m and n %s:%d edge %d %d %d %d nexts %d %d %d first for vertice %d %d error remove edge %d dump graphbdz_phgirepository/cmph/bdz_ph.cDestroying algorithm dependent data c: %f Created hypergraph m (edges): %u n (vertices): %u r: %u c: %f Entering mapping step for mph creation of %u keys with graph sized %u linear hash function %u iterations remaining acyclic graph creation failure - %u iterations remaining Entering assigning step for mph creation of %u keys with graph sized %u Starting optimization step Successfully generated minimal perfect hash Successfully generated minimal perfect hash function B:%u %u %u -- %u %u %u A:%u %u %u -- %u %u %u Dumping hash state with %u bytes to disk Loading bdz_ph mphf Hash state has %u bytes Reading m and n %s:%d bmzgirepository/cmph/bmz.cDestroying algorithm dependent data c: %f m (edges): %u n (vertices): %u c: %f Created graph Entering mapping step for mph creation of %u keys with graph sized %u hash function 1 hash function 2 Generating edges %u iterations remaining simple graph creation failure - %u iterations remaining Starting ordering step Starting Searching step. Traversing critical vertices. Searching step bmz->g Traversing non critical vertices. Restarting mapping step. %u iterations remaining. Successfully generated minimal perfect hash Successfully generated minimal perfect hash function Labelling critical vertices unused_edge_index < bmz->mLabelling non critical vertices Generating edges for %u vertices Self loop for key %u A non simple graph was generated Dumping hash state with %u bytes to disk Loading bmz mphf Reading %u hashes Hash state has %u bytes Reading m and n key: %s h1: %u h2: %u key: %s g[h1]: %u g[h2]: %u edges: %u %s:%d bmz8girepository/cmph/bmz8.cDestroying algorithm dependent data The number of keys in BMZ8 must be lower than 256. c: %f m (edges): %u n (vertices): %u c: %f Created graph Entering mapping step for mph creation of %u keys with graph sized %u hash function 1 hash function 2 Generating edges %u iterations remaining simple graph creation failure - %u iterations remaining Starting ordering step Starting Searching step. Traversing critical vertices. Searching step bmz8->g Traversing non critical vertices. Restarting mapping step. %u iterations remaining. Successfully generated minimal perfect hash Successfully generated minimal perfect hash function Labelling critical vertices unused_edge_index < bmz8->mLabelling non critical vertices Generating edges for %u vertices Self loop for key %u A non simple graph was generated Dumping hash state with %u bytes to disk Loading bmz8 mphf Reading %u hashes Hash state has %u bytes Reading m and n key: %s h1: %u h2: %u key: %s g[h1]: %u g[h2]: %u edges: %u %s:%d /var/tmp/brzgirepository/cmph/brz.cDestroying algorithm dependent data %s/%sbrz->mphf_fdc: %f 0m: %u k: %u Partioning the set of keys. hash function 3 Generating graphs %u iterations remaining to create the graphs in a external file Failure: A graph with more than 255 keys was created - %u iterations remaining Graphs with more than 255 keys were created in all 20 iterations Graphs generated Successfully generated minimal perfect hash Successfully generated minimal perfect hash function Generating graphs from %u keys Flushing %u %s%u.cmphwb MPHF generation nkeys_vd < brz->size[cur_bucket]ERROR: Can't generate MPHF for bucket %u out of %u MPHF for bucket %u out of %u was generated. Dumping brzf Dumping hash state with %u bytes to disk Loading brz mphf Reading c = %f k = %u algo = %u Hash state 1 has %u bytes Hash state 2 has %u bytes g_i has %u bytes Hash state has %u bytes key: %s h1: %u h2: %u h0: %u key: %s g[h1]: %u g[h2]: %u offset[h0]: %u edges: %u Address: %u buff_managergirepository/cmph/buffer_manager.c%s:%d chdgirepository/cmph/chd.cDestroying algorithm dependent data Generating a CHD_PH perfect hash function with a load factor equal to %.3f packed_chd_phf_size = %u Compressing the range of the resulting CHD_PH perfect hash function Successfully generated minimal perfect hash Successfully generated minimal perfect hash function Loading chd mphf Loading CHD_PH perfect hash function with %u bytes to disk Loading Compressed rank structure, which has %u bytes Dumping CHD_PH perfect hash function with %u bytes to disk %s:%d bucketsgirepository/cmph/chd_ph.cItem not added chd_phDestroying algorithm dependent data mphMAX BUCKET SIZE = %u USING HEURISTIC TO PLACE BUCKETS We were able to place m = %u keys m = %u nbuckets = %u load_factor = %.3f n = %u space lower bound is %.3f bits per key Starting mapping step for mph creation of %u keys with %u bins Failure in mapping step Starting ordering step Starting searching step Failure because the max trials was exceeded Starting compressing step Successfully generated minimal perfect hash Successfully generated minimal perfect hash function Loading chd_ph mphf Hash state has %u bytes Compressed sequence structure has %u bytes Reading n and nbuckets Dumping hash state with %u bytes to disk Dumping compressed sequence structure with %u bytes to disk %s:%d chmgirepository/cmph/chm.cDestroying algorithm dependent data m (edges): %u n (vertices): %u c: %f Created graph Entering mapping step for mph creation of %u keys with graph sized %u %u iterations remaining Acyclic graph creation failure - %u iterations remaining Starting assignment step Assignment step chm->gSuccessfully generated minimal perfect hash Successfully generated minimal perfect hash function Visiting vertex %u Visiting neighbor %u Visiting edge %u->%u with id %u g is %u (%u - %u mod %u) Generating edges for %u vertices with hash functions %s and %s Self loop for key %u Adding edge: %u -> %u for key %s Cyclic graph generated Looking for cycles: %u Dumping hash state with %u bytes to disk Loading chm mphf Reading %u hashes Hash state has %u bytes Reading m and n key: %s h1: %u h2: %u key: %s g[h1]: %u g[h2]: %u edges: %u %s:%d sel_size = %u vals_rems_size = %u max_val = %u n = %u rem_r = %u buflen_sel = %u Dumped compressed rank structure with size %u bytes Loaded compressed rank structure with size %u bytes %s:%d idx < cs->ngirepository/cmph/compressed_seq.csel_size = %u length_rems_size = %u store_table_size = %u n = %u rem_r = %u total_length = %u buflen_sel = %u Dumped compressed sequence structure with size %u bytes Loaded compressed sequence structure with size %u bytes %s:%d Destroying graph Printing edges connected to %u %u -> %u v1 < g->nnodesgirepository/cmph/graph.cv2 < g->nnodese < g->nedges!g->shrinkingChecking edge %u %u looking for %u %u e != EMPTYDeleting edge point %u %u Deleted Checking linked list Checking degree of vertex %u Found first edge Deleting edge %u (%u->%u) Checking if second endpoint %u has degree 1 Inspecting vertex %u Looking for cycles in graph with %u vertices and %u edges Edge %u %u->%u was not deleted Looking for the 2-core in graph with %u vertices and %u edges Edge %u %u->%u belongs to the 2-core %s:%d Dumped select structure with size %u bytes Loaded select structure with size %u bytes qgirepository/cmph/vqueue.c(q->end + 1)%q->capacity != q->beg!vqueue_is_empty(q)%u buff_entrygirepository/cmph/buffer_entry.crbD(0hG0X`pӐӰ HhpxՀՈՐpq@r8sը,Xp֐(II I(I0I8I@Hאװ (08@HX`hp؈ب0X`hpxـ٨ (08@Phpڈڠ: (0@HX`hp۠ۨ۰۸H`ܐܸ Jxݘݸ @cP`K0ޘޠިް޸K {8PȈhxȑJX`8IHțߐߘߨ߰߸ (0@P`hxȧ(HXȻhx(8@HXhx0@PXhx(0HP`p (@P`x (8P(`hx9 0@X`hpx`x`p(0x(LYX(@`hxɁɟ8hP@@Pp0H`xɸ0X0Xh8P0hʈʐ0@Pp8PXxʘʸ@H`Ph`ʠʨʰ(@`HxKK@H`PPX`(@hpX(0XhXp(X ( 8`͸8@HhPh0P`h0Pp0H`8@HX`hpx`px΀Έ(HXhp  ( X p      0 h ( x 0      P p    8 x      0 8 ` h     8x P`hp8ЈxHhАИPh H`x($PXh08Hp8<xP(P`0HPQHx HKXHHG(HHKZdH0o0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0ow`0oo0og0o_0oW0oO0oG 0o?@0o7`0o/0o'0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0ow`0oo0og0o_0oW0oO0oG 0o?@0o7`0o/0o'0o0o0o0o 0o@0o`0o0o0o0o0o 0o 0o @0o `0o 0o 0o 0o 0o 0o 0o @0ow `0oo 0og 0o_ 0oW 0oO 0oG 0o? @0o7 `0o/ 0o' 0o 0o 0o 0o 0o @0o `0o 0o 0o 0o 0o 0o 0o @0o `0o 0o 0o 0o 0o0o 0o@0ow`0oo0og0o_0oW0oO0oG 0o?@0o7`0o/0o'0o0o0o0o(<M[hp  x90 x ooWo XW` oo4DXI`ԀHԐԸoG(mIlH H(@HH`H`8@PX`hpx      (0(hz(hpxH QXxx90WW`XX d`   ( (4D(FYZX Zh#G@G SGam (|ZXIYm (      0 0( f hlG0 X ` p  Ӑ  Ӱ    0  ( H%ZXFYm :1 h6 p; x@ ՀE ՈJ ՐO pPa q@D r8 r sH ը    , t u\  ( @ X  p  ֐0   (#  ) (/ZXIHYm c@I9I TI(MI0gI8`I@s HH א x װ}   1   ;      ( 0 8J @ H X ` h p ؈  ب  p      0( X  ` h p x# xE ـ(K ٨Q W ] 8c i  o (u h8 8 4 0 8 X @ P h p ڈ ڠ  :  <  X 85 ; A G M S Y _ e  k (q 0w @} H X ` h p0 ۠ ۨ ۰ ۸    X0      " 0( H. `04 ܐ(: ܸ@ @G N U \  Uc JiZXFYm {v x { | ݘ  ($ ݸ  0 L    @ c h P  < XtX `7^ vZXKXZXm ` h z h ( (\K0( ޘ ޠ ިE ްJ ޸   ( ) @0 8 @  *K( ;  A dL  R  X { ^ 8d Pj Ȉ p y h x ȑ  hJX ` 8IH  ț  0  ߐ ߘ ߨ ߰ ߸         (  0 @ P `# h x ) 8/ ȧ5 hDIY _  do  H       4 (  H X Ȼ hP h x    P       (  8 % @ + H 1 X 7  = W h L x R P X @ p 0 v 0 | `D  0  @  P  X  h  x                         \        (  0 % H +  1 $8p = P C `_ p I * T  Z  ` }  f - u  { 1P      2      40p      7,"       (  @  P  `  x  ;      (   !  (  /  6  =  D   K (\ 8 R  Y I f P m ( t K  Md  `  Nx  h  N8  x  9  PH    SX<                 '  . T @  G   N 0 U @ \ X c ` j h q p x X  x      \x      aP    d  @    H  `  x    e     !  (  /  6 ( =  D  K  R H Y ` ` p g @ n  u  |         (  0H  xH  w<  0  y(  z`T     (0! L(Y/ X06 = (D K R YZXFYm ɷb (g l  ( @(q `!v h{ x    R (   Ɂ % ɟZXKYm  8 (  , hd   P  (  @(3 $E $^ $p @ @ P  p  , h4   4          0 H  `& x, 2 8 ɸ  A (G (M 0(S X( + (Y (_ 0e 0k 0(q Xw h}          8 PZXFYm    ,8    &ZXFYm    ʀ 8 @  '   ,  8 , 5 > G T Ͱc P0l Ϙ p (H 08 h   6  ʈ ʐZXFYm (   ,q }   @  ( 0 @ ` @( (< x P L `_ Hd p u 8   [ZXKYm (  h `,}    1   8ZXFYm ( P  , X   x( #ZXFYm  ʘ  ʸ    '  x p, 0 $ @d T  0< <3 x@  F  L p<^ ([ k pp~ @ H `(      0X H P h  @ P H `0 88 ʠ, ʨ5 ʰP (8 *0  3|  > Y 0 ( @  ` 9\ZXPYm x H x  Ap Bx C@ DH' x E F,K K FP0- F$? FdS GXTf G<y H < Hxx@  F   J<^ ( K` Nt~    ( @ H) `0 H    @ PP   0 88 P, X5 ` Xx Zp  bt  ( @> hG p& X0) ,   2ZXFYm 0  0 Ͱ n o p q'  rp sh,   ( ( 0(8 X hH> D F    @L XJ p   j P y (V 8\ (0 X88 , b 5 p |, 0    >  G (     ( (   8( `0      &  ',ZXFYm  ͸  h    ' 8  , @ H  h(8 8; 3 ( D H P9 hX   ? @j E  P 0 K P^ `Q h( 8W 0] 88 , c x 5 r 4 @ (4 0 > G  P  h p p( (  (  0 0 H `   ! ''ZXFYm ΐ ΐ Θ    ̠ ͨ'  p h,   - (2 8 @9 H8 XV `> h pD x W J P HV P\ `Hb ~ 0h 88 p, x5 ΀> Έn و8{ (  H X h p ( 8 0     x    (0  X  p(           !  08  h  l* p9 @P PG   (fZXFYm (w  x|  #ZXFYm ϰ ϰ 0 ϸ      p  x'   @ 8,      (  P  P   pH  0X  8    8@L  x8  < XZXFYm x x  Ѐ    '   x p, <         L !H   ! 8 , 5 # ">   06  8(  `< ')  h\ +K /X^ 3(8k 4xz  ( 5 8  ( 9,  2       (  8@ x    + 0    0 P8G ` h p w   0  0 8=ZXFYm Р Ј Р   K L M N' x Op Ph,   ( (  H H D h@     0K 88 А, И Y WT# P) h/ (5  ; @P   ( HA ` x0G  M  S  Y ('_ZXFYm Ѥ Ѥ $ Ѭ f8 g@ h i' P i j,q kTJ X h E P K  8 5ZXFYm Ѱ Ѱ Ѹ 8 x0 y8 z {' 0 { |, }T? 8 H( p6   # 8   @ 89ZXPYm D < D     ' x  x,P     ;      (( h P ` V Q  p       0 0  H@   @  &,ZXFYm (; C QZXYYm (ZPlQ  (  , h( <   0 x^ 0/ H,ZXFYm (w x|   (' E ZXFYm (w | (b    hl3 |P `d[ k H~ <C`  @  ? 0  5:6 B7 X }Do | 0H 0 FT ۘ ( ǰT I8 x H hx  + l(D7`^ mo; v %d @h"D j(@ tPA  8@  H%5/@P uteZX. (<m v hT  (4  L Xl P 7  d@ : ! @ 5; ? > O o  bB h@  t  , = 5  xl     9!A! 9!>I !8 (!L @!^G!f k4!~!=! !5@!? !(! v!<!Z`! "8|" 8" b"%?`": QP"M "\ 7h<"eH"q9"8"  " 0p"A`" <" 8,#A #  0# X#/=#6 ?P#H <#c9 #s \# # 0#B # 4# (#?# $ sP$&7$, x$@ l$_@$m $v 1$ Rp$ 0$ h@$ d`$:$;$ 4$C% b`X% X(%- 4%>7%U   Ő%t4% SXP% l%A% x% @t%%% ˜&>&  &4  &J6 &V &x #&I& &<`&  |& & & &Zh&:@& '>'+ <% '?F'N6'p@' cp'!F'  ' ' D@'B' nx( '(& X(G 5x(P ((d 8(  (C@( ϰ>B`( Sd( GP((:`( ) (()*@)> "d)W GpH)f )q JHl%6`) )6)8) %Hl)  )  . * !P*+KXP*6 @*?  *U <*d *v8* *> *6* 8*6* ^* * 8l% X+5 +$ 0P+3 @+C  (8+O q+o +x +B+?+ +<+ P+ R+I+8+ 0,  ŐC, nD,5 H,O H<,s<,~ }<, H\,  p<,,H,A@, (, P- g-;-'  -> -U9`-` -l  -v #P-~C - tl-G(- H@- Ԉ- ~8p- `- <\-<.A.  .1 s.@ k` .S .c @p.uC.{ .H. X. @. p. iH\. (. vT. x.A/   / İ /4 P/H8 /W (PT /jH/p?@/&B@/=@/K/ H/ t/= 0C0 0@ 'F0/ @0@:0Q=0c 0i40 0 0 H0 k80 hh0 x405`1 \1  <1 81'< 1< X1O x1d p X1?1 ;81 11Zd1 ӸT%91 $(B17@2 Hh& 2! $2< P2E=  2^6@2l;2x42} $` 0D2 (2 (H2D(2;2 X28`2 ̰d2 ph3;`3  T@3 P3) up\31 0d3= X<3M 3Z  t3t@@3 p(383 Ǡ3 3 3C3 h3B3 P4H4<4"=`4.44>@4C9@4O 4^?4n  494 84 (4 e#P = 4 ؈4 Hh4 H4 5 v 54 I\5G 5^ZX5e45l x5u p4f<@5  5 0X5 h5 l5>5 x576 h<6/ j6; (6H  6W6g;@6n 6{I6 Ql6 P6 6:  4666  ,6 &P7:7 =7>`7' d0d-b 73 7\>7f77t 2w47@`7 P`7 = H757 7757 p.libs/g-ir-compilercrti.scrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptr__crt_scratchvalues-Xa.cDrodata.rodatacompiler.cBbss.bssDdata.dataDpicdata.picdata.L22.L24.L25.L28.L32.L39write_out_typeliblog_handleroptions.L71.L78.L79.L92.L93.L94.L99.L105.L114.L120girmodule.c.L42.L45.L48.L57.L61.L62add_alias_foreachadd_disguised_structure_foreachwrite_attributewrite_attributesnode_cmp_offset_func.L111.L112.L102alloc_sectionadd_directory_index_section.L142.L155.L167.L168.L192.L198.L212.L217.L223.L229girnode.cunique_string_countunique_string_sizeunique_types_count.L23.L34.L36.L38.L40.L44.L46.L50.L52.L54.L56.L58.L60.L64.L66.L68.L70.L270.L275add_attribute_size.L294.L298.L320.L341.L449.L452.L454.L458.L461.L463_g_ir_node_get_full_size_internal.L521.L522.L523.L530.L542.L557.L558.L559parse_int_valueparse_uint_valueparse_float_value.L585.L588parse_boolean_value.L605.L612.L613.L619.L645.L646.L596find_entry_nodefind_entryfind_namespaceget_index_of_member_type.L711.L714.L716.L722.L725.L729.L732.L735.L737.L738.L744.L748.L750.L753.L754.L762.L764.L768.L772.L778.L784.L790serialize_type_g_ir_node_build_members_g_ir_node_check_unhandled_members.L831.L835.L838.L840.L852.L904.L905.L924.L938.L959.L1084.L1088.L1092.L1096.L1102.L822giroffsets.c.L81compute_enum_storage_typeget_enum_size_alignment.L118.L130get_interface_size_alignment.L151.L160.L161.L135get_type_size_alignmentget_field_size_alignmentcompute_struct_field_offsetscompute_union_field_offsets.L245check_needs_computationgirparser.cfirstpass_start_element_handlerfirstpass_end_element_handlertext_handlercleanupmarkup_parser.L55.L59.L65.L67start_aliasstart_typefind_attributestate_switchfirstpass_parser.L103locate_gir.L131.L132.L122.L145.L146.L136pop_node.L159.L150push_nodeinteger_aliases.L172.L173basic_typesparse_basic.L236.L238.L246.L248.L250.L254.L256.L258.L262.L264.L266.L272.L274.L280.L282.L284.L290.L318.L231parse_type_internal_g_ir_node_free.L332resolve_aliasesis_disguised_structure.L353.L354.L359.L361parse_type.L374.L375.L376.L365introspectable_prelude.L394.L399.L400.L401.L402.L408start_glib_boxed.L433.L435.L442.L448.L465.L466.L467.L425start_function.L534.L537parse_property_transfer.L546.L556parse_param_transfer.L565.L568.L569.L570.L571.L572.L573.L574.L575.L576.L577.L580.L583.L591.L614.L624.L560start_parameter.L660.L668.L669.L670.L671.L683.L647start_field.L726.L730start_enum.L755.L770.L771start_property.L800parse_value.L811.L814start_member.L826start_constant.L872.L877start_interface.L909.L910.L911.L912.L913.L914.L915start_class.L955.L956.L1001.L1008.L1013.L1018.L1023.L1024.L1025.L1049.L1063.L1077end_type_top.L1126.L1110end_type_recurseend_type.L1167start_doc.L1177start_attribute.L1202.L1197start_return_value.L1230start_implements.L1246.L1252.L1253.L1254.L1255.L1256.L1257.L1266.L1270start_glib_signal.L1301.L1307.L1308.L1309.L1310.L1311.L1323.L1328start_vfunc.L1357.L1358.L1380start_struct.L1397.L1414start_union.L1428start_discriminator.L1455.L1457.L1460.L1461.L1464.L1467parse_include.L1476.L1481.L1485.L1529.L1532.L1545.L1546.L1552.L1561.L1566.L1567.L1568.L1583.L1593.L1599.L1609.L1614.L1624.L1626.L1648.L1650.L1668require_one_of_end_elements.L1687state_switch_end_struct_or_unionrequire_end_element.L1700.L1738.L1863.L1870.L1697.L1898.L1919.L1927.L1929.L1930.L1931.L1935gthash.c.L29.L30.L31.L35.L80.L87.L125.L144.L98.L171.L162cmph.c.L17debugprintfdummyprintfkey_nlfile_readkey_byte_vector_readkey_struct_vector_readkey_vector_readkey_nlfile_disposekey_vector_disposekey_nlfile_rewindkey_struct_vector_rewindkey_vector_rewindcount_nlfile_keys.L123.L124cmph_io_struct_vector_newcmph_io_struct_vector_destroy.L182cmph_io_vector_newcmph_io_vector_destroy.L235.L259.L338.L392.L396.L398.L407.L409.L411.L413.L415.L_cseg0.L455.L460.L462.L464.L468.L470.L472.L474.L480.L487.L492.L494.L496.L498.L500.L502.L504.L506.L552cmph_structs.c.L69fch.cbitmaskbitmask32valuemaskset_bits_valueget_bits_valueset_bits_at_posget_bits_at_pos.L49.L_cseg1.L_cseg2.L_cseg3.L_cseg4bdz_mappingchd_ph_orderingcheck_for_collisions_h2permutchd_ph_searching.L234.L239.L244.L_cseg5.L_cseg6.L_cseg7fch_buckets.cfch_bucket_newfch_bucket_destroy.L74.L76fch_bucket_reservefch_bucket_insertfch_bucket_is_emptyfch_bucket_sizefch_bucket_get_keyfch_bucket_get_lengthfch_bucket_print.L183.L37.L41jenkins_hash.c__jenkins_hash_vector.L84.L97bdz.cbdz_alloc_queuebdz_free_queuebdz_alloc_graph3bdz_init_graph3bdz_free_graph3bdz_partial_free_graph3bdz_add_edge.L110.L117bdz_dump_graphbdz_remove_edgebdz_generate_queue.L194.L195.L203.L214.L240.L241.L242.L249.L252.L255.L263.L267assigningranking.L292.L305.L339.L340rankbdz_ph.cpow3_tablebdz_lookup_tablebdz_ph_alloc_queuebdz_ph_free_queuebdz_ph_alloc_graph3bdz_ph_init_graph3bdz_ph_free_graph3bdz_ph_partial_free_graph3bdz_ph_add_edgebdz_ph_dump_graphbdz_ph_remove_edgebdz_ph_generate_queue.L225.L228.L232.L253.L257bdz_ph_mappingbdz_ph_optimization.L279.L311.L319bmz.c.L100.L115.L116.L134.L140.L163.L169bmz_gen_edgesbmz_traverse_critical_nodesbmz_traverse_critical_nodes_heuristicbmz_traverse_non_critical_nodes.L179next_unused_edgebmz_traverse.L316.L345.L358.L362.L382.L383.L388.L390.L397bmz8.c.L104.L121.L128.L139.L141.L164.L174.L177bmz8_gen_edgesbmz8_traverse_critical_nodesbmz8_traverse_critical_nodes_heuristicbmz8_traverse_non_critical_nodes.L184.L297bmz8_traverse.L321.L350.L363.L367.L380.L387.L393.L395.L406brz.c.L77.L109.L149.L166.L170.L175.L178.L181.L187.L188.L197brz_gen_mphf.L204.L213.L226.L227.L265.L289.L303.L308brz_min_indexbrz_destroy_keys_vdbrz_copy_partial_fch_mphfbrz_copy_partial_bmz8_mphf.L368.L369.L377.L405brz_bmz8_searchbrz_fch_searchbrz_bmz8_search_packedbrz_fch_search_packedbuffer_manager.c.L20.L21chd.c.L108.L119.L129.L138_chd_searchchd_ph.cchd_ph_bucket_new.L73chd_ph_bucket_cleanchd_ph_bucket_insertchd_ph_bucket_destroychd_ph_space_lower_boundchd_ph_get_entropy.L143chd_ph_mappingplace_bucket_probeplace_bucketplace_buckets1.L343place_buckets2chd_ph_check_bin_hashing.L414.L420.L428.L447.L451.L456.L469.L476.L479.L486.L488.L489.L497chm.c.L107.L113chm_gen_edgeschm_traverse.L148.L153.L156.L157.L165.L185.L202.L208.L210.L221compressed_rank.ccompressed_rank_i_log2compressed_seq.ccompressed_seq_i_log2.L147graph.cEMPTY.L72.L83.L86.L126check_edgedel_edge_point.L201.L215find_degree1_edge.L230.L233cyclic_del_edgemiller_rabin.cint_powcheck_witnessselect.crank_lookup_tableselect_lookup_tableselect_insert_0select_insert_1select_generate_sel_table_select_query_select_next_queryvqueue.cbuffer_entry.cbuffer_entry_loadcrtn.s_END__START_fch_config_set_hashfuncs_gi_typelib_hash_builder_newbmz_searchhash_state_dumpgraph_neighbors_itcmph_config_set_mphf_fdvfprintfhash_state_copybmz_loadffi_type_uint16brz_search_packedg_slist_freeselect_generatehash_state_destroyg_strerrorg_assertion_message_exprjenkins_hash_packedg_option_context_freecompressed_seq_destroymixh10h11h12graph_vertex_idvqueue_insertchd_ph_dumpfch_dumpcmph_config_set_hashfuncsbuffer_entry_destroychd_ph_packgraph_obtain_critical_nodesfch_destroygraph_destroyfch_calc_bcompressed_rank_generateg_log_set_default_handler_g_ir_module_newmemcpychd_ph_config_set_hashfuncsselect_query_packed_get_exit_frame_monitorbdz_ph_destroybmz_config_destroycmph_packcmph_io_nlnkfile_adapterg_slice_alloc0buffer_manager_newg_fprintfg_markup_parse_context_end_parsecompressed_rank_pack__xargvbmz8_newchd_search_packedbrz_config_set_mphf_fdchd_config_set_bjenkins_state_copychd_config_destroychm_config_newhash_state_packed_sizeg_type_initchm_search_packedstrcmpcompressed_seq_loadg_malloc0bdz_packed_size_g_ir_module_fatalfreadg_markup_parse_context_parsecmph_destroyselect_initg_get_system_data_dirsbmz8_packed_sizecmph_config_set_bjenkins_state_destroyg_string_append_printfmallocg_list_prependg_hash_table_lookup_extendedcompressed_seq_dumpbmz_search_packed___Argvcompressed_rank_destroyg_ascii_tableg_strdupvfch_buckets_is_emptyfopenatoi_GLOBAL_OFFSET_TABLE_compressed_rank_query_packedg_list_append__xargcbdz_config_set_bbrz_destroychm_packg_markup_error_quarkchm_config_destroyhash_state_newbdz_loadincludedirsg_hash_table_foreachg_strdup_vprintffch_buckets_get_nbucketsbmz_packed_sizeg_hash_table_iter_initbrz_config_set_memory_availabilitychd_loadg_strrstrvqueue_destroyselect_packed_sizestrcpybdz_search_packedjenkins_hash_vector_packedg_string_appendcmph_config_set_keys_per_bin_g_ir_node_can_have_memberchd_config_set_hashfuncsfeofchd_packed_sizegraph_next_neighborg_strcmp0_g_ir_node_type_to_stringcompressed_rank_loadg_logcmph_config_destroycompressed_seq_get_space_usageg_list_concatbmz_dump_g_ir_node_build_typelibchm_newhash_state_packchd_destroy_startg_string_append_cg_typelib_new_from_memoryselect_next_query_packed__dtoulchm_destroycmph_config_set_verbosity_g_ir_parser_newg_option_context_parsecmph_io_nlfile_adapter_destroyg_strdup_printfbdz_ph_config_destroybdz_ph_search_packedg_string_free_g_ir_node_get_sizeselect_packffi_type_voidg_str_hash__cmph_loadg_str_has_prefixcmph_io_nlnkfile_adapter_destroygraph_ncritical_nodesg_file_move_g_ir_node_param_direction_string_etextno_initgraph_contains_edgestrtoulljenkins_state_loadfch_buckets_destroycmph_search_packedselect_dump_endg_realloc_gi_typelib_hash_builder_packg_slist_find_custombuffer_manager_open__environ_lockg_option_context_add_main_entriesg_markup_parse_context_freechm_packed_size_environcmph_io_struct_vector_adapter_destroy_g_irnode_init_statschd_ph_load__assert_g_ir_module_freechd_ph_config_set_keys_per_bin_gi_typelib_hash_builder_destroybdz_dumpfch_buckets_get_key_gi_typelib_hash_builder_preparecmph_io_byte_vector_adapterrandbrz_config_newbdz_ph_config_set_hashfuncschd_ph_searchffi_type_uint64g_list_lengthfch_buckets_get_keylengthfch_config_destroyg_file_get_contentsbdz_config_set_hashfuncschd_ph_destroyvqueue_newchd_ph_search_packed_gi_typelib_hash_builder_add_stringfcloseg_slice_free1chd_ph_config_destroycmph_io_byte_vector_adapter_destroycmph_io_vector_adapter_destroybdz_config_destroycmph_namesbrz_pack_g_ir_node_add_memberselect_destroygraph_clear_edgesg_hash_table_destroycheck_primalityg_file_testg_log_default_handlervqueue_is_emptyg_option_context_newchm_loadcmph_searchbrz_config_set_hashfuncsg_file_new_for_pathgraph_del_edgebrz_packed_sizeselect_load_g_ir_module_add_include_modulechd_dumpgraph_edge_idfgetsstrstrjenkins_state_packed_sizeg_list_delete_linkhash_state_loadbdz_ph_config_newmnameg_typelib_validatevqueue_removebuffer_entry_read_keycompressed_rank_query_g_ir_parser_set_includescmph_config_set_memory_availabilityg_strsplitcompressed_seq_init_g_ir_node_cmpjenkins_hash_vector_ffi_type_uint8inputg_malloc_ncmph_config_set_graphsizejenkins_state_packbdz_ph_searchg_hash_table_new_fullbuffer_manager_destroycmph_io_vector_adapterg_printerr__cmph_dumpcmph_sizebdz_newcallocbmz_config_set_hashfuncsoutputcmph_packed_sizebrz_newcompressed_seq_generatechm_searchchd_ph_newg_type_tag_to_stringg_hash_table_iter_nextfch_buckets_get_max_sizebmz_config_newbdz_ph_packed_sizecmph_config_new_g_ir_parser_freefloorgraph_printdebugchd_newcmph_newgraph_node_is_criticalmain_g_irnode_dump_statscompressed_rank_packed_sizehash_get_typeg_str_has_suffix_g_ir_find_nodebuffer_entry_get_capacitybmz8_config_destroyg_typelib_free_g_ir_write_stringshlibg_markup_parse_context_get_positiong_str_equalg_hash_table_insertcmph_hash_namescompressed_seq_querycompressed_seq_packg_hash_table_lookupceilbrz_config_set_tmp_dirg_string_insert_cbuffer_entry_newg_hash_table_newg_hash_table_size_fini_PROCEDURE_LINKAGE_TABLE_bmz8_dumpcmph_io_struct_vector_adapter_g_ir_parser_parse_filecompressed_rank_initbrz_loadchd_config_set_keys_per_bin___errnochm_dumpjenkins_hashbrz_searchg_list_insert_sortedbrz_config_destroycmph_config_set_algocompressed_rank_get_space_usageg_set_errorbdz_search__1cG__CrunMdo_exit_code6F_v___fsr_init_valuelogged_levelsbrz_config_set_bfch_config_newg_log_set_always_fatalfch_buckets_print_g_ir_node_compute_offsetsbmz_packgi_type_tag_get_ffi_typeg_clear_errorg_strfreev_exitchd_ph_config_new_g_ir_node_get_full_sizebrz_config_set_algo_DYNAMICg_list_sortbmz_destroyg_list_freefch_calc_p1fch_packed_sizememsetbdz_ph_newbuffer_entry_openbmz_newfch_calc_p2fch_buckets_newvqueue_printbmz8_config_set_hashfuncsg_string_truncatebuffer_entry_set_capacityg_string_newbmz8_packgraph_newbuffer_manager_read_keysprintffch_buckets_insert__dtou_gi_typelib_hash_searchverbosestrtodg_list_copy__iobg_slist_free_1g_list_lastchd_config_newg_ascii_strtoll__config_destroyg_hash_table_replacefch_loadfch_buckets_get_indexes_sorted_by_sizebdz_ph_loadfch_newselect_get_space_usagegraph_is_cyclic_g_ir_parser_parse_string_g_ir_module_build_typelibchd_ph_packed_sizecmph_io_nlfile_adapter_edataatexitfch_packcompressed_rank_dumpjenkins_state_dumpbmz8_destroybmz8_loadcompressed_seq_packed_sizeg_build_filenamefch_buckets_get_sizeg_irepository_prepend_search_pathcmph_config_set_tmp_dirbdz_ph_pack_lib_versionbdz_config_newffi_type_uint32strchr__config_newinclude_cwdchm_config_set_hashfuncsbrz_dumpbmz8_config_newg_assertion_messageg_typelib_check_sanitygraph_add_edgechd_ph_config_set_bstrlenbdz_packg_slist_prependbdz_ph_dump_gi_typelib_hash_builder_get_buffer_sizeg_strndupg_strv_lengthcompressed_seq_query_packedg_markup_parse_context_new_g_ir_node_newbdz_destroyfwritejenkins_state_newffi_type_pointerg_strdupchd_packanotate anotate d dex GG "e`#ed$elanotate8 0 jXhjThanotate @qprq@s`r8~s@qpqq@s\r8~sanotate P`xHHHHP\tHHHHanotate anotatep h `K(KK0hK8zK@KP(anotate anotate  dhth\l@|L\@l$P4@D`hphXh@xHX@h P0@@anotate anotate anotate anotate anotate anotate anotate anotate anotate anotate anotate anotate anotate anotate anotate anotate anotate anotate anotate anotate @(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stat.h 1.12 10/01/15 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)unistd.h 1.76 06/03/10 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)float.h 1.22 04/09/28 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)float.h 1.22 04/09/28 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.500tools/compiler.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -DGIREPO_DEFAULT_SEARCH_PATH='"/usr/local/lib"' -I./girepository -I/usr/local/include -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c tools/compiler.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0girepository/girmodule.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -I/usr/local/include -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/girmodule.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0:,girepository/girnode.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -I/usr/local/include -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/girnode.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0|Bgirepository/giroffsets.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -I/usr/local/include -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/giroffsets.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0Xgirepository/girparser.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -I/usr/local/include -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/girparser.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0ngirepository/gthash.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -I/usr/local/include -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/gthash.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0Agirepository/cmph/cmph.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/cmph.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0girepository/cmph/cmph_structs.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/cmph_structs.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0girepository/cmph/fch.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/fch.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0 girepository/cmph/fch_buckets.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/fch_buckets.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0Mgirepository/cmph/hash.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/hash.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0girepository/cmph/jenkins_hash.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/jenkins_hash.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0girepository/cmph/bdz.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/bdz.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0"girepository/cmph/bdz_ph.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/bdz_ph.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0c4girepository/cmph/bmz.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/bmz.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0Jgirepository/cmph/bmz8.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/bmz8.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0`girepository/cmph/brz.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/brz.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0*vgirepository/cmph/buffer_manager.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/buffer_manager.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0kgirepository/cmph/chd.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/chd.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0girepository/cmph/chd_ph.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/chd_ph.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0girepository/cmph/chm.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/chm.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0<girepository/cmph/compressed_rank.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/compressed_rank.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0}girepository/cmph/compressed_seq.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/compressed_seq.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0girepository/cmph/graph.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/graph.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0girepository/cmph/miller_rabin.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/miller_rabin.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0Y&girepository/cmph/select.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/select.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0<girepository/cmph/vqueue.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/vqueue.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0Rgirepository/cmph/buffer_entry.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/buffer_entry.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0+.$ toolscompiler.c6, girepositorygirmodule.c4* girepositorygirnode.c7- girepositorygiroffsets.c6, girepositorygirparser.c3) girepositorygthash.c6, girepository/cmphcmph.c>4 girepository/cmphcmph_structs.c5+ girepository/cmphfch.c=3 girepository/cmphfch_buckets.c6, girepository/cmphhash.c>4 girepository/cmphjenkins_hash.c5+ girepository/cmphbdz.c8. girepository/cmphbdz_ph.c5+ girepository/cmphbmz.c6, girepository/cmphbmz8.c5+ girepository/cmphbrz.c@6 girepository/cmphbuffer_manager.c5+ girepository/cmphchd.c8. girepository/cmphchd_ph.c5+ girepository/cmphchm.cA7 girepository/cmphcompressed_rank.c@6 girepository/cmphcompressed_seq.c7- girepository/cmphgraph.c>4 girepository/cmphmiller_rabin.c8. girepository/cmphselect.c8. girepository/cmphvqueue.c>4 girepository/cmphbuffer_entry.c DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD%.interp.hash.dynsym.dynstr.SUNW_version.rela.got.rela.data.rela.plt.text.init.fini.rodata.rodata1.dynamic.picdata.bss.symtab.strtab.annotate.comment.debug_info.debug_line.debug_abbrev.shstrtabXX xx xx)"9090oWWP-BW`W` 7BXXBBXX Ld`d`c RX^(( fG[2((G44$ oD(D(<FFxYYZXZXZX H8o2P:h3uhh 070701000a2828000041ed0000000000000000000000054f83d4aa000000000000010000010007ffffffffffffffff0000001300000000root/usr/local/lib070701000a2899000081a40000000000000000000000014f83d4a0000b3f680000010000010007ffffffffffffffff0000002900000000root/usr/local/lib/libgirepository-1.0.a! / 1334039512 0 0 0 12192 ` 5l444444444444.4.4.4I4I4I4I4I4I4I4mmmmmm|$$$$$$$$$$$$$$$.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d|||DDD||||||||||||||||||||||||$$$ӌӌӌӌӌӌӌӌӌ$$$$$$$$ϤϤϤϤϤϤϤϤϤϤϤddddddd , , , , , , , , , , , , ,xxxxxxxxxxxSdSdSdSdSdSdSdSdSdSdSd,,,,,,,,,,,,,,,,RRRRRRk<k<k<k<LLLLLLLLLLLLL###########pppppppppppppppppppppppppppppppllll           ? ? ? ? ? ? ? ? ? ? u< u< u< u< u< u< u< u< u< u< u< u< u< u< u< D D D D D D D D D D D | | | | | | | | | | | | | | | D| D| D| D| D| D| D| D| D| D| D| D| D| r r r r r r r r r r r d t t t t t t t t t t t t \ \ \ \ \ \ \g_irepository_dumpg_arg_info_load_typeg_arg_info_get_typeg_arg_info_get_destroyg_arg_info_get_closureg_arg_info_get_scopeg_arg_info_get_ownership_transferg_arg_info_is_skipg_arg_info_may_be_nullg_arg_info_is_optionalg_arg_info_is_caller_allocatesg_arg_info_is_return_valueg_arg_info_get_directiong_base_info_equalg_base_info_get_typelibg_base_info_get_container_attribute_blob_find_firstg_base_info_iterate_attributesg_base_info_get_attributeg_base_info_is_deprecatedg_base_info_get_namespaceg_base_info_get_nameg_base_info_get_type_g_type_info_init_g_type_info_new_g_info_from_entryg_info_new_g_info_init_g_info_new_fullg_base_info_unrefg_base_info_refg_base_info_gtype_get_type_g_callable_info_invokegi_type_info_extract_ffi_return_valueg_callable_info_iterate_return_attributesg_callable_info_get_return_attributeg_callable_info_load_argg_callable_info_get_argg_callable_info_get_n_argsg_callable_info_get_caller_ownsg_callable_info_skip_returng_callable_info_may_return_nullg_callable_info_load_return_typeg_callable_info_get_return_typeg_constant_info_get_valueg_constant_info_free_valueg_constant_info_get_typeg_value_info_get_valueg_enum_info_get_storage_typeg_enum_info_get_methodg_enum_info_get_n_methodsg_enum_info_get_valueg_enum_info_get_error_domaing_enum_info_get_n_valuesg_field_info_set_fieldg_field_info_get_fieldg_field_info_get_typeg_field_info_get_offsetg_field_info_get_sizeg_field_info_get_flagsg_function_info_invokeg_invoke_error_quarkg_function_info_get_vfuncg_function_info_get_propertyg_function_info_get_flagsg_function_info_get_symbol_g_base_info_find_methodgi_cclosure_marshal_genericg_interface_info_get_iface_structg_interface_info_get_constantg_interface_info_get_n_constantsg_interface_info_find_vfuncg_interface_info_get_vfuncg_interface_info_get_n_vfuncsg_interface_info_get_signalg_interface_info_get_n_signalsg_interface_info_find_methodg_interface_info_get_methodg_interface_info_get_n_methodsg_interface_info_get_propertyg_interface_info_get_n_propertiesg_interface_info_get_prerequisiteg_interface_info_get_n_prerequisitesg_object_info_get_get_value_function_pointerg_object_info_get_get_value_functiong_object_info_get_set_value_function_pointerg_object_info_get_set_value_functiong_object_info_get_unref_function_pointerg_object_info_get_unref_functiong_object_info_get_ref_function_pointerg_object_info_get_ref_functiong_object_info_get_class_structg_object_info_get_constantg_object_info_get_n_constantsg_object_info_find_vfunc_using_interfacesg_object_info_find_vfuncg_object_info_get_vfuncg_object_info_get_n_vfuncsg_object_info_find_signalg_object_info_get_signalg_object_info_get_n_signalsg_object_info_find_method_using_interfacesg_object_info_find_methodg_object_info_get_methodg_object_info_get_n_methodsg_object_info_get_propertyg_object_info_get_n_propertiesg_object_info_get_fieldg_object_info_get_n_fieldsg_object_info_get_interfaceg_object_info_get_n_interfacesg_object_info_get_type_initg_object_info_get_type_nameg_object_info_get_fundamentalg_object_info_get_abstractg_object_info_get_parentg_property_info_get_ownership_transferg_property_info_get_typeg_property_info_get_flagsg_registered_type_info_get_g_typeg_registered_type_info_get_type_initg_registered_type_info_get_type_nameg_info_type_to_stringg_type_tag_to_stringg_irepository_get_option_groupg_irepository_require_privateg_irepository_enumerate_versionsg_irepository_get_typelib_pathg_irepository_get_c_prefixg_irepository_get_shared_libraryg_irepository_get_versiong_irepository_get_loaded_namespacesg_irepository_find_by_error_domaing_irepository_find_by_nameg_irepository_find_by_gtypeg_irepository_get_infog_irepository_get_n_infosg_irepository_get_defaultg_irepository_is_registeredg_irepository_error_quarkg_irepository_load_typelibg_irepository_get_dependenciesg_irepository_requireg_irepository_get_search_pathg_irepository_prepend_search_pathg_irepository_get_typeg_callable_info_free_closureg_callable_info_prepare_closureg_function_invoker_destroyg_function_invoker_new_for_addressg_function_info_prep_invokerg_type_info_get_ffi_typegi_type_tag_get_ffi_typeg_signal_info_true_stops_emitg_signal_info_get_class_closureg_signal_info_get_flagsg_struct_info_is_gtype_structg_struct_info_is_foreigng_struct_info_get_alignmentg_struct_info_get_sizeg_struct_info_find_methodg_struct_info_get_methodg_struct_info_get_n_methodsg_struct_info_get_fieldg_struct_info_get_n_fieldsg_type_info_get_array_typeg_type_info_is_zero_terminatedg_type_info_get_array_fixed_sizeg_type_info_get_array_lengthg_type_info_get_interfaceg_type_info_get_param_typeg_type_info_get_tagg_type_info_is_pointerg_typelib_symbolg_typelib_get_namespaceg_typelib_freeg_typelib_new_from_mapped_fileg_typelib_new_from_const_memoryg_typelib_new_from_memoryg_typelib_validateg_typelib_check_sanityg_typelib_get_dir_entry_by_error_domaing_typelib_get_dir_entry_by_gtypeg_typelib_get_dir_entry_by_nameg_typelib_get_dir_entryg_typelib_error_quarkg_union_info_get_alignmentg_union_info_get_sizeg_union_info_find_methodg_union_info_get_discriminatorg_union_info_get_discriminator_typeg_union_info_get_discriminator_offsetg_union_info_is_discriminatedg_union_info_get_methodg_union_info_get_n_methodsg_union_info_get_fieldg_union_info_get_n_fieldsg_vfunc_info_invokeg_vfunc_info_get_addressg_vfunc_info_get_invokerg_vfunc_info_get_signalg_vfunc_info_get_offsetg_vfunc_info_get_flags_g_base_info_find_vfuncbdz_search_packedbdz_packed_sizebdz_packbdz_destroybdz_searchbdz_loadbdz_dumpbdz_newbdz_config_set_hashfuncsbdz_config_set_bbdz_config_destroybdz_config_newbdz_lookup_tablebdz_ph_search_packedbdz_ph_packed_sizebdz_ph_packbdz_ph_destroybdz_ph_searchbdz_ph_loadbdz_ph_dumpbdz_ph_newbdz_ph_config_set_hashfuncsbdz_ph_config_destroybdz_ph_config_newbmz_search_packedbmz_packed_sizebmz_packbmz_destroybmz_searchbmz_loadbmz_dumpbmz_newbmz_config_set_hashfuncsbmz_config_destroybmz_config_newbmz8_search_packedbmz8_packed_sizebmz8_packbmz8_destroybmz8_searchbmz8_loadbmz8_dumpbmz8_newbmz8_config_set_hashfuncsbmz8_config_destroybmz8_config_newbrz_search_packedbrz_packed_sizebrz_packbrz_destroybrz_searchbrz_loadbrz_dumpbrz_newbrz_config_set_algobrz_config_set_bbrz_config_set_mphf_fdbrz_config_set_tmp_dirbrz_config_set_memory_availabilitybrz_config_set_hashfuncsbrz_config_destroybrz_config_newbuffer_entry_destroybuffer_entry_read_keybuffer_entry_get_capacitybuffer_entry_set_capacitybuffer_entry_openbuffer_entry_newbuffer_manager_destroybuffer_manager_read_keybuffer_manager_openbuffer_manager_newchd_search_packedchd_packed_sizechd_packchd_searchchd_destroychd_dumpchd_loadchd_newchd_config_set_keys_per_binchd_config_set_bchd_config_set_hashfuncschd_config_destroychd_config_newchd_ph_search_packedchd_ph_packed_sizechd_ph_packchd_ph_searchchd_ph_destroychd_ph_dumpchd_ph_loadchd_ph_newchd_ph_config_set_keys_per_binchd_ph_config_set_bchd_ph_config_set_hashfuncschd_ph_config_destroychd_ph_config_newchm_search_packedchm_packed_sizechm_packchm_destroychm_searchchm_loadchm_dumpchm_newchm_config_set_hashfuncschm_config_destroychm_config_newcmph_search_packedcmph_packed_sizecmph_packcmph_destroycmph_sizecmph_searchcmph_loadcmph_dumpcmph_newcmph_config_set_graphsizecmph_config_set_hashfuncscmph_config_set_verbositycmph_config_destroycmph_config_set_memory_availabilitycmph_config_set_keys_per_bincmph_config_set_bcmph_config_set_mphf_fdcmph_config_set_tmp_dircmph_config_set_algocmph_config_newcmph_io_vector_adapter_destroycmph_io_vector_adaptercmph_io_struct_vector_adapter_destroycmph_io_struct_vector_adaptercmph_io_byte_vector_adapter_destroycmph_io_byte_vector_adaptercmph_io_nlnkfile_adapter_destroycmph_io_nlnkfile_adaptercmph_io_nlfile_adapter_destroycmph_io_nlfile_adaptercmph_names__cmph_load__cmph_dump__config_destroy__config_newcompressed_rank_query_packedcompressed_rank_packed_sizecompressed_rank_packcompressed_rank_loadcompressed_rank_dumpcompressed_rank_get_space_usagecompressed_rank_querycompressed_rank_generatecompressed_rank_destroycompressed_rank_initcompressed_seq_query_packedcompressed_seq_packed_sizecompressed_seq_packcompressed_seq_loadcompressed_seq_dumpcompressed_seq_querycompressed_seq_get_space_usagecompressed_seq_generatecompressed_seq_destroycompressed_seq_initfch_search_packedfch_packed_sizefch_packfch_destroyfch_searchfch_loadfch_dumpfch_newfch_calc_p2fch_calc_p1fch_calc_bmixh10h11h12fch_config_set_hashfuncsfch_config_destroyfch_config_newfch_buckets_destroyfch_buckets_printfch_buckets_get_indexes_sorted_by_sizefch_buckets_get_nbucketsfch_buckets_get_max_sizefch_buckets_get_keylengthfch_buckets_get_keyfch_buckets_get_sizefch_buckets_insertfch_buckets_is_emptyfch_buckets_newgraph_next_neighborgraph_neighbors_itgraph_ncritical_nodesgraph_vertex_idgraph_contains_edgegraph_obtain_critical_nodesgraph_node_is_criticalgraph_is_cyclicgraph_del_edgegraph_edge_idgraph_add_edgegraph_printgraph_destroygraph_clear_edgesgraph_newhash_get_typehash_vector_packedhash_packedhash_state_packed_sizehash_state_packhash_state_destroyhash_state_loadhash_state_copyhash_state_dumphash_vectorhashhash_state_newcmph_hash_namesjenkins_hash_vector_packedjenkins_hash_packedjenkins_state_packed_sizejenkins_state_packjenkins_state_loadjenkins_state_copyjenkins_state_dumpjenkins_hash_vector_jenkins_hashjenkins_state_destroyjenkins_state_newcheck_primalityselect_next_query_packedselect_query_packedselect_packed_sizeselect_packselect_loadselect_dumpselect_next_queryselect_queryselect_generateselect_destroyselect_get_space_usageselect_initvqueue_destroyvqueue_printvqueue_removevqueue_insertvqueue_is_emptyvqueue_newvstack_sizevstack_emptyvstack_topvstack_popvstack_reservevstack_pushvstack_destroyvstack_new_gi_typelib_hash_search_gi_typelib_hash_builder_destroy_gi_typelib_hash_builder_pack_gi_typelib_hash_builder_get_buffer_size_gi_typelib_hash_builder_prepare_gi_typelib_hash_builder_add_string_gi_typelib_hash_builder_new// 1334039512 0 0 0 1356 ` libgirepository_1_0_la-gdump.o/ libgirepository_1_0_la-giarginfo.o/ libgirepository_1_0_la-gibaseinfo.o/ libgirepository_1_0_la-gicallableinfo.o/ libgirepository_1_0_la-giconstantinfo.o/ libgirepository_1_0_la-gienuminfo.o/ libgirepository_1_0_la-gifieldinfo.o/ libgirepository_1_0_la-gifunctioninfo.o/ libgirepository_1_0_la-ginvoke.o/ libgirepository_1_0_la-giinterfaceinfo.o/ libgirepository_1_0_la-giobjectinfo.o/ libgirepository_1_0_la-gipropertyinfo.o/ libgirepository_1_0_la-giregisteredtypeinfo.o/ libgirepository_1_0_la-girepository.o/ libgirepository_1_0_la-girffi.o/ libgirepository_1_0_la-gisignalinfo.o/ libgirepository_1_0_la-gistructinfo.o/ libgirepository_1_0_la-gitypeinfo.o/ libgirepository_1_0_la-gitypelib.o/ libgirepository_1_0_la-giunioninfo.o/ libgirepository_1_0_la-givfuncinfo.o/ libcmph_la-bdz.o/ libcmph_la-bdz_ph.o/ libcmph_la-bmz.o/ libcmph_la-bmz8.o/ libcmph_la-brz.o/ libcmph_la-buffer_entry.o/ libcmph_la-buffer_manager.o/ libcmph_la-chd.o/ libcmph_la-chd_ph.o/ libcmph_la-chm.o/ libcmph_la-cmph.o/ libcmph_la-cmph_structs.o/ libcmph_la-compressed_rank.o/ libcmph_la-compressed_seq.o/ libcmph_la-fch.o/ libcmph_la-fch_buckets.o/ libcmph_la-graph.o/ libcmph_la-hash.o/ libcmph_la-jenkins_hash.o/ libcmph_la-miller_rabin.o/ libcmph_la-select.o/ libcmph_la-vqueue.o/ libcmph_la-vstack.o/ libgirepository_gthash_la-gthash.o/ /0 1334039417 0 0 100644 20364 ` ELF+K@@.shstrtab.text.rodata1.bss.data.rodata.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_infowwwwA@`wwwwǒw@__@@Ϛǐ@@H `]_\ @ @@@ A@`wwww__@@ߐ@@H`]_\ @ @߁A@`wwww__@׀H@_`]_@@ H_ן h @_`]_@@ @ A@`wwww__@׀H@_`]_@@ H _ן74  A@`www@_ Ph @_@H@_@ 7@瀤H 7@4,0]\ _h_`]\@\F@@7@ 7@瀤 O@A@`www_@ 6瀤H64,0@5@_`]_@_@ϔG`H _`]H$ `H _`]H `H _`]H  `H_`]G H_`]G H_`]G H_`]G @H_`]y_`] 7ǀH_`]_ϡ74,0@\@_7 7ǀ O_`]6 6瀤 OkA@`wwww_`]@__@._`Ph/ '@@w`]@_ǀ hGÀH H'Ð@ ,@_ǒ@@_wǀ o_`]]@ _@ H_`]_`]!_@wת 5@〤H_ס5@4,0\@_`]@@Ғ5@ 5@〤 O_____`]A@`wwww_`]@__@_@w׸ 7〤H_ס74,0\@@`Ph _`]@@7 7〤 O_=____`]0A@`wwww_`]@__@RA@`wwww@__`]@__@1 7@ H_ 7@4,p,pw_`]\`\``7@ 7@  O_`]CA@`wwww@__`]@__@ 7@ H_ 7@4,p,pw_`]\`\`D`7@ 7@  O_`]A@`wwww '_`]@__@_@ H_`]_@ H_`]@_`]@wπhGÀH H'_@ ,@h_@@@@ o_\` h_`]^\`_@ _`]_@wת 5@〤H_ס5@4,0\@w_`]@_@;5@ 5@〤 O_`]d0wwwH(_____b____________>_@_ Dh 0h oOo 4oO Hh DoOo PoO0A@`w'ww_`]_@@A@`wwww '@ wh@_`]@@ @H  _`]@ w@Z w_@\ w__@whH __  @h @_@@@Hݪ @@`]@@`]@w@_@@@w@__@@@hL` H@@Hx@@`]`]@@@ H1`]@@__pw`h `]@ '@@HM_@@hC__@@_@ɒH4`]`]@@@ H%`]@@__j'H `]@ '@@H@@@@Oz@_@@`]G_@? @w@_@@_@HH @@_@HH G`?'G=`failed to write to iochannel: %sFailed to find symbol '%s'Function '%s' returned G_TYPE_INVALID failed to open self: %s, get-type:Invalid GType function: '%s' error-quark:Invalid error quark function: '%s' @(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11 girepository/gdump.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -DG_IREPOSITORY_COMPILATION -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c girepository/gdump.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.02( girepositorygdump.c DD%gdump.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L19escaped_printfgoutput_write.L36.L39invoke_get_typeinvoke_error_quark.L63dump_properties.L75.L78.L82.L86.L90.L93.L96.L99.L102.L103.L108.L110dump_signals.L118.L121.L130.L133.L138.L140dump_object_type.L147.L154.L156dump_interface_type.L163dump_boxed_type.L170.L175.L177dump_flags_type.L184.L190dump_enum_type.L197.L202.L203.L221dump_fundamental_typedump_type.L244dump_error_quark.L253.L254.L259.L260.L269.L273.L279.L283.L284g_output_stream_closeg_hash_table_destroyg_hash_table_insertg_hash_table_lookupg_printerrstrncmpg_strchompg_data_input_stream_read_lineg_object_unrefg_data_input_stream_newg_hash_table_newg_output_stream_get_typeg_input_stream_get_typeg_type_check_instance_castg_input_stream_closeg_file_replaceg_file_readg_file_new_for_pathg_strsplitg_module_errorg_module_openg_irepository_dumpg_quark_to_stringg_type_interface_prerequisitesg_type_interfacesg_type_test_flagsg_string_freeg_string_appendg_string_append_cg_string_newg_type_parentg_signal_queryg_signal_list_idsg_type_nameg_object_interface_list_propertiesg_type_default_interface_refg_object_class_list_propertiesg_type_class_refg_type_fundamentalg_io_error_quarkg_set_errorg_module_symbolg_freeg_clear_errorg_logstrleng_output_stream_write_allg_markup_vprintf_escaped_GLOBAL_OFFSET_TABLE_  .=(BQ_( dH(iyp0(( 0@PX xP(  #()0 /P5 P I`(O `_(e0kq ( ((Php (PH0h  (8(` !7L`t4IXdxp&8ESbt 07EKRl0s4sTrdpq onmssp8qLP dolnsslj  k,j8 < Lksslj  k0s4sHi\hhgxfe d mXs\stcb d (, X\     (, @D pt d  s$s@D Lda `_d^a  $]0\H!L! `d x["" d # # Xs \s x% |% d Z & & d L' P' s s ) ) d s s $h 4+ 8+ @d , , - - s $s <h L/ P/ Xd , , 0 0 0s 4s X2 \2 dd \ ! ! \ 3 3 a 4 4 `0_8dPd\^da  ] ["" dT5X5 @iss88 ,Yxs|sWj:: Vk;; UT T4ShROPQNP<< NP== M OP L,K@Jlm|I>> >> pH>> p?? Gm,FHEPN\P|@@ @@ pH@@ pAA Gm N,PDmTD\NhPpBtB OPQNPC66@ (iii%i-i6i? K">W"e"m( Cu3p KX0  /32 1334039419 0 0 100644 12428 ` ELF+,@@.shstrtab.text.rodata1.bss.data.rodata.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info A@`ww_@@h`]`]`] @ ?H-?@@ H`]`]`] @ @H?^\   4` H4` HH   4  HH  ?` A@`ww_@@h`]`]`] @ [H @@ H`]`]`] @ \H  _ \  w 4  ?` A@`ww_@@h`]`]`] @ tH @@ H`]`]`] @ uH  _ \  w 4  ?` A@`ww_@@h`]`]`] @ H @@ H`]`]`] @ H  _ \  w 4  ?` A@`ww_@@h`]`]`] @ H @@ H`]`]`] @ H  _ \  w 4  ?` A@`ww_@@h`]`]`] @ H @@ H`]`]`] @ H  _ \  w 4  ?` A@`ww_@@h`]`]`] @ H)?@@ H`]`]`] @ H?_ \  w 4` HH  4` HH  ?` A@`ww_@@h`]`]`] @ H?@@ H`]`]`] @ H ?_ \  w 4  ?` A@`ww_@@h`]`]`] @!H?@@ H`]`]`] @!H?_ \  wL ?` A@`ww_@@h`]`]`] @!H?@@ H`]`]`] @!H?_ \  wL ?`0A@`ww_h`]`]`] @!0H@ H`]`]`] @!1H _^  @< @0A@`www_h`]`]`] @!G@ H`]`]`] @!H___   @< file %s: line %d: assertion `%s' failedgirepository/giarginfo.cinfo != NULLGI_IS_ARG_INFO (info)@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/giarginfo.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -DG_IREPOSITORY_COMPILATION -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c girepository/giarginfo.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.06, girepositorygiarginfo.c DD%giarginfo.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L23.L24.L25.L32_g_type_info_initg_arg_info_load_type_g_type_info_newg_arg_info_get_typeg_arg_info_get_destroyg_arg_info_get_closureg_arg_info_get_scopeg_arg_info_get_ownership_transferg_arg_info_is_skipg_arg_info_may_be_nullg_arg_info_is_optionalg_arg_info_is_caller_allocatesg_arg_info_is_return_valueg_base_info_get_typeg_logg_arg_info_get_direction_GLOBAL_OFFSET_TABLE_  !2A(F( KHPXUg x| x XXX0XGXfX$ $HL T X ` d t   `d          `d          `d          `d          `d          `d                    $ 4            $ 4                ,                 $ D                ( L 66@  h @n  % - 6 Z? K(BWjemP uP ,X0  /68 1334039421 0 0 100644 12940 ` ELF+.@@.shstrtab.text.data.rodata1.rodata.picdata.bss.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info@A@`w`]\ h`]`]`]@`]t `]\ @A@`w'www'_瀤h_hH`]`]`] @ ;Hwϐ H@G___@ % _瀤h D #cH@] @]w_ϰ 'ww'G_Z_@wװA@`ww'www'_  H@'_$`G$`_t`$` _߀ht`@_@@H`]`]`]@ g__t`ww7_@w`4  ,00400H `__`@H&w_] `w] `w@_w׀h (@w "  " @__uu_u_Hu H@ ww'_\ 4`,08408< H 4`,00400< HH__7@ w߰www'_w_\ w 4`,08408< H 4`,00400< HH_ __\ __5@@ 0A@`ww_wD #cH`]`]`]@ _D` $`w0A@`ww_D  H#cH`]`]`]@ @D`$ $`D`H#\h D#cH@_`h@@D` H (@@ H@@@w_B ?` A@`w_D  H`]`]`]@!%HW`] \ ` @] \ H]`] \ ` @] \ HS`] \ ` @] \ HI`] \ ` @] \ H?`] \ ` @] \ H5`] \ ` @] \ H+`] \ ` @] \ H!_H^`]`]!r@HG`$  O, < #bPDddddddddddd,T| A@`ww_@\`\ D` H`]`]`]@!D` H_wH\ \`\ ,@ A@`ww_H(_`Z ` 2  *00H.200_`Z ` 2 H& _`Z ` 2  *00H200_`Z ` 2 H HB"  O* : !P? B  ? $$$$$$$$$$LlA@`www`]\r`\r`\r`\r`_@H_@_ HH __ǔ@O ww_w_w `HH?HH  ?`A@`ww'_wߢ \`\ w'\`\ _` ``N`]@hH$  h H &  h O@wwww_wϢ`\`\ w\`\ _` ``NL4w_\ hH` @@@h `_ H_@ h H'ۨ ] \ `_t`] \ `_t`` _t` 'G۱< @w_Z @@w_Z @ ww_w_wZ`Z ` ZZ  @ "h ': : GIBaseInfofile %s: line %d: assertion `%s' failedgirepository/gibaseinfo.ccontainer != NULL || repository != NULLG_IS_IREPOSITORY (repository)rinfo->ref_count != INVALID_REFCOUNTrinfo->ref_count > 0 && rinfo->ref_count != INVALID_REFCOUNTrinfo->ref_count > 0_g_info_initg_base_info_refg_base_info_unrefg_base_info_get_nameg_base_info_get_namespace@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/gibaseinfo.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -DG_IREPOSITORY_COMPILATION -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c girepository/gibaseinfo.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.07- girepositorygibaseinfo.c DD%gibaseinfo.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L17.L20.L35.L36.L37.L61.L50.L105.L96.L119.L109.L158.L149.L188.L232cmp_attributeg_base_info_equalg_base_info_get_typelibg_base_info_get_containerbsearch_attribute_blob_find_firststrcmpg_base_info_iterate_attributesg_base_info_get_attributeg_base_info_is_deprecatedg_base_info_get_namespaceg_assertion_messageg_base_info_get_nameg_base_info_get_typeg_slice_free1g_object_unref_g_type_info_init_g_type_info_newg_slice_alloc0g_irepository_find_by_nameg_typelib_get_dir_entry_g_info_from_entryg_assertion_message_exprg_irepository_get_typeg_type_check_instance_is_amemsetg_info_newg_object_ref_g_info_initg_slice_allocg_log_g_info_new_fullg_base_info_unrefg_base_info_refg_boxed_type_register_staticg_base_info_gtype_get_type_GLOBAL_OFFSET_TABLE_  " 3^BGL(Q8 VX([ ` e(k p@v|/D  Xhh  0 / I h c }08 %=`PiPX(+F ;$;04 L P X8\8 d7h7 p9x|  ;;   $ , 0 @5T4t3826`;d;0./      -t+6* )(213; ;< @ HL TX d-;;     (-|7&%%8;<;` d lp x| -    " ; ;      - p; t; ; ;   0 H p(;,; 66@ @  =^( 16?"KCW#e9\m u$8 .X0  /105 1334039423 0 0 100644 17716 ` ELF+A0@@.shstrtab.text.rodata1.picdata.rodata.bss.data.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info0w_@H ?H H H H B` H  O OHO O@H ^Z  2@2H 72  A@`ww_h`]`]`] @ cH/@ H@_ H @_ H@_ HH`]`]`] @ dH __^@6 A@`www_h`]`]`] @ ~@ H@_ H @_ H@_ HH`]`]`] @ 7___^@7 A@`ww_@@h`]`]`] @ H3 @@ H@_ H @_ H@_ HH`]`]`] @ H ^\ _2@w 4  ,00400?  A@`ww_@@h`]`]`] @ H3 @@ H@_ H @_ H@_ HH`]`]`] @ H ^\ _2@w 4 ,00400?  A@`ww_@@h`]`]`] @ HB?@@ H@_ H @_ H@_ HH`]`]`] @ H?^\ 6_2@w 4` ,00400HH  4` ,00400HH  ?  A@`ww_@@h`]`]`] @ H0?@@ H@_ H @_ H@_ HH`]`]`] @ H ?_: '^\ w ? A@`ww'_h`]`]`] @ H:@ H@_ H @_ H@_ HH`]`]`] @ H_: 'Ӣ\`\ _\`TGFL4 @ A@`ww'w_h`]`]`] @!@ H@_ H @_ H@_ HH`]`]`] @!"_: 'Ӣ\`\ _]_\` TG FL4 @ A@`www`]\r`\r`\r`\r`_@H_@_ HH __ǔ@Owwww_wϢ \`\ w\`\ _` ``NL4w_\ hHw_@7@w_@h `7@H_@ h H'_Ϩ ] \ `_t`] \ `_t`` _t` 'G۱<  A@`wwwwHa_\ _,`_\ _,`_\ _4`_\ _4`_\ _$`_\ _$`_\ _t`_\ _t`_ _$ _ _< @_@wH '_\ _H$`_\ _H t`Gۀ O OO@_߁_\ _t`@_`H%` O, < #bH_ϠԠDO`OO(@XpPA@`wwww'w'_wG'G'_w ';w//w'@_@wow@_o'k 'S 'O@_'[GÀHG〤 H @_`]@@ Hd'WGS H'S'WGHGW 'WGW,0` ?#w` ?#w?GÀH `]_t`_ _?t` 'KG[HGÀ@ 'G'_@GKHw_@__@ww_GKG@< ,0t@_wGSG〥H @_`]@@ H_=,0_?GKG@< ,0uHw'S`]_GKG@< ,0tGOGӀH @_`]@@ H_ס= ,0_?t@ HT'O`]_GKG@< ,0tGSG〥H @_`]@@ HGOGӀH @_`]@@ H_= ,0_?t@ 'SH'O`]`]"2@H@ O, < #b_D@__GK G[ON'KGH'_?GW$ < ,0t@`]_t@GSG〤H @_`]@@ HcGOGӀH @_`]@@ HSGW4 __@  HI_ǀh`]`]`] @"Q H9'HHwHwHwHwGk$  O, < #b_D__@_?_/h_@ H';_o@_Ǡ ';@_oG;'G< |file %s: line %d: assertion `%s' failedgirepository/gicallableinfo.cinfo != NULLGI_IS_CALLABLE_INFO (info)Too few "in" arguments (handling this)Too few "in" arguments (handling in)Too few "out" arguments (handling out)Too few "in" arguments (handling inout)Too few "out" arguments (handling inout)Too many "in" arguments (at end)Too many "out" arguments (at end)return_value_g_callable_info_invoke@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/gicallableinfo.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -DG_IREPOSITORY_COMPILATION -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c girepository/gicallableinfo.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0;1 girepositorygicallableinfo.c DD%gicallableinfo.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodatasignature_offset.L38.L39.L40.L51.L216.L277.L296.L300.L304.L307.L318.L321.L330.L270g_propagate_errorffi_callffi_prep_cifg_arg_info_get_directiong_assertion_messageg_arg_info_get_typeg_invoke_error_quarkg_set_errorg_type_info_get_ffi_type_g_callable_info_invokeffi_type_pointerg_type_info_get_tagg_base_info_unrefg_type_info_get_interfacegi_type_info_extract_ffi_return_value_attribute_blob_find_firstg_strcmp0g_callable_info_iterate_return_attributesg_callable_info_get_return_attribute_g_info_initg_callable_info_load_argg_info_newg_callable_info_get_argg_callable_info_get_n_argsg_callable_info_get_caller_ownsg_callable_info_skip_returng_callable_info_may_return_null_g_type_info_initg_callable_info_load_return_type_g_type_info_newg_base_info_get_typeg_logg_callable_info_get_return_type_GLOBAL_OFFSET_TABLE_  & 7FW(\( aHfX k qx(w(}((0H(p( %1Jbs   (( MZ hs~ \08x<< 84@Qfl,88 $ , 0 8 < L6\5p555      64@8D8l p x |   65555      ,6T288      655505L P X \ d h x688    ( , <6L5`5t55      6@8D8h l t x   65555      (688      $645H5\5p5      6 8 8 D  H P  T \  ` p6 5 5 5 5    6 T, 8 8    6 5 5 $5 85 T  X `  d l  p 6 * 8 8 (  , `( x' ( `&(8,8<$D5#"887".LX\ h!! H-\d# ! ! DPT `!!    ,h l tx #(!,! P\` l        6%#6!6@ @ #+06?*K GW!&e!<m$X u*8 A0  /146 1334039425 0 0 100644 6852 ` ELF+@@.shstrtab.text.rodata1.bss.data.rodata.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info0A@`ww_h`]`]`] @ ?H@ H`]`]`] @ @H_^ @ @ A@`www_h`]`]`] @ X@ H`]`]`] @ Y_`\ ` w 4`,08408< H4`,00400< H 4` H_@\  A@`www_@@h`]`]`] @ xH @@ H`]`]`] @ yH  ] \  @@`4`,08408< H4`,00400< H|4` H ] \ `` @_Hnt H[_ \ `D@_He$`_ \ `L@_H^,`_ \ ` @_HW,`_ \ `T@_HP4`_ \ `@_HI4`_ \ `D@_HB$`_ \ `@_H;$`__ \ `@ @H1__ \ `@ @H'__ \ `@ @H__ \ `@ @H` $  H , 4#c4_ϠԠD` =Pl<dfile %s: line %d: assertion `%s' failedgirepository/giconstantinfo.cinfo != NULLGI_IS_CONSTANT_INFO (info)@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/giconstantinfo.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -DG_IREPOSITORY_COMPILATION -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c girepository/giconstantinfo.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0;1 girepositorygiconstantinfo.c DD%giconstantinfo.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L23.L24.L25.L32memcpyg_memdupg_constant_info_get_valueg_freeg_constant_info_free_value_g_type_info_newg_base_info_get_typeg_logg_constant_info_get_type_GLOBAL_OFFSET_TABLE_  &7F(K( PHUXZajh < $HL T X ` d t   DH P T \ ` p     4pt               6!6@ xs%-6? *K GW e m u p 0  /187 1334039428 0 0 100644 9308 ` ELF+ X@@.shstrtab.text.rodata1.bss.data.rodata.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info A@`ww_@@h`]`]`] @ >H# @@ H@_ HH`]`]`] @ ?H ^\  w ?` A@`ww_h`]`]`] @ LH-@ H@_ HH`]`]`] @ MH] \  @w @H] \ 4@H@A@`ww'_h`]`]`] @ iH0@ H@_ HH`]`]`] @ jH] \  VGLL4 < '_] 4`@  A@`ww_@@h`]`]`] @ H# @@ H@_ HH`]`]`] @ H ^\  w ?`A@`ww'_h`]`]`] @ H;@ H@_ HH`]`]`] @ H ]`\ ]`\  `w`V LL4 G>L4 < '_]`4`@  A@`ww_@@h`]`]`] @ H' @@ H@_ HH`]`]`] @ H  ^\  w 4 ,00400?` A@`ww_@@h`]`]`] @ ٺ?H%@@ H`]`]`] @ ں?H_ \  w`4  HD`H4 D`@file %s: line %d: assertion `%s' failedgirepository/gienuminfo.cinfo != NULLGI_IS_ENUM_INFO (info)GI_IS_VALUE_INFO (info)@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/gienuminfo.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -DG_IREPOSITORY_COMPILATION -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c girepository/gienuminfo.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.07- girepositorygienuminfo.c DD%gienuminfo.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L23.L24.L25.L34.L155g_value_info_get_valueg_enum_info_get_storage_typeg_enum_info_get_methodg_enum_info_get_n_methodsg_info_newg_enum_info_get_valueg_enum_info_get_error_domaing_base_info_get_typeg_logg_enum_info_get_n_values_GLOBAL_OFFSET_TABLE_  "3B(G( LHQXVp\xsP `p40$3 $HL T X ` d t   8<`d l p x |      x|        ( , <     ,@\` h l t x     $ ( 8H\x|      X\                    (66@  X  % - 6 Z?:"K\CWeIm@ u@  (0  /224 1334039430 0 0 100644 13748 ` ELF+1@@.shstrtab.text.rodata1.bss.data.rodata.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info A@`ww_@@h`]`]`] @ CH. @@ H`]`]`] @ DH ^\   4  ,08408H 4  ,08408H`@?  A@`ww_@@h`]`]`] @ bH @@ H`]`]`] @ cH _ \  w ?` A@`ww_@@h`]`]`] @ yH @@ H`]`]`] @ zH _ \  w ?`A@`ww_@\`\ @h`]`]`] @ H?@@ H`]`]`] @ H+]`\  w 4  ,08408H_]`J@@ wϢ $%`,H $`_]` @< HA@`wwww '_@h`]`]`] @  H:'@@ H`]`]`] @  H%'@_  H H'@_@_@w׀H _?`\@_t` H'H`]@_ @@H_?`D@  2H _$` H'_?` @_,` H'_?`@_4` H'_?`@_$` H'_?`\@_t` H'_?`\@_t` H'_?`@_$  H'_?`@_<  H'_?`@_t` H'`]@_@_@ @@HH@_תHmwH|Hz@_ǦH3'_?` @_$` H:'_?`@_$` H2'_?`@< _$` H)'_?`\@_$` H!'`]@_@GØ @@H$ O, < #a_DH3`]@_@_ǘ @@H#`]@_@_ǘ @@H@@ H , < #a_D@_H@_נ H , < #b0_D@_G'G< ((HHhhpp0 ppppp0ppppp@p@` A@`wwww '_@h`]`]`] @!x HS'@@ H`]`]`] @!y H>'@_  H H5'@_@_@w׀HH`]@_ @@H_D  2H _?`$@ H'_ _?`,@ H'_ _?`4@ H'_ _?`$@ H'_\ _?`t@ H'_\ _?`t@ H'_ _?`$@ H'_ _?`<@ H'`]@_@_@ @@HH@_׬HmwH|Hz@_ǪH3'_D _?`,@ H:'_D _?`4@ H2'_D 4 _?`$@ H)'_D _?`t@ H!'`]@_@GØ @@H%` O, < #a_DH3`]@_@_ǘ @@H#`]@_@_ǘ @@H@ H , < #b<_D@_H@_נ H , < #b_DH)H @_תH w_\ _?`t@ H'H @@ O OO@_H @_׀ OO@_G'G< ((LL000000000000 P @``````file %s: line %d: assertion `%s' failedgirepository/gifieldinfo.cinfo != NULLGI_IS_FIELD_INFO (info)field_info != NULLGI_IS_FIELD_INFO (field_info)Field %s: should not be have void typeField %s: type %s should have is_pointer setField %s: Unexpected enum storage type %sField %s: Interface type %d should have is_pointer setField %s: Interface type %d not expectedField%s: Interface type %d should have is_pointer set@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/gifieldinfo.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -DG_IREPOSITORY_COMPILATION -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c girepository/gifieldinfo.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.08. girepositorygifieldinfo.c DD%gifieldinfo.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L23.L24.L25.L32.L106.L113.L122.L142.L164.L168.L181.L252g_field_info_set_fieldg_base_info_unrefg_enum_info_get_storage_typeg_type_info_get_interfaceg_type_info_get_tagg_type_tag_to_stringg_base_info_get_nameg_type_info_is_pointerg_field_info_get_field_g_type_info_newg_info_newg_field_info_get_typeg_field_info_get_offsetg_field_info_get_sizeg_base_info_get_typeg_logg_field_info_get_flags_GLOBAL_OFFSET_TABLE_  #4C(H( MHRXWp] c(i0o0u08{h06 (%<lSdoHtPX( %$%HL T X ` d t#"   #`%d%     #"     #X%\%     #"     #P%T%     #"     #\%%  $ , 0 @#T"hl t x   #$   (<#| # #    $" <# L P X d" |# "   $ 0% 4% d h p  t |  # "     # $   ( 0 L P X l#      #  #  (4"L#\` ht"#"D"66@ ff%f-f6fZ?$KDW(e>m@ u  10  /262 1334039432 0 0 100644 9092 ` ELF+@@.shstrtab.text.rodata1.data.bss.rodata.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_infow''w_]\ wϠ 'GH$\\ @w\\ `w@_瀢 H _]@ Hw_ >@'Gˠ GO'w_߰ A@`ww_h`]`]`] @ aH"@ H`]`]`] @ bH_w] \  @w] \ `@ A@`ww_@h`]`]`] @ yH]?@@ H`]`]`] @ zHI?_w\`\ ` @ `4 ,00400H `4  ,00400H  4 ,00400H` 4 ,00400H` 4  ,00400H` 4 ,00400H` 4 ,00400H` @> A@`ww_h`]`]`] @ H&@ H`]`]`] @ H_w\`\ ` w\` #,00400< @@ A@`ww_h`]`]`] @ H&@ H`]`]`] @ H_w\`\ ` w\` #,00400< @@@A@`w`] H `]@`]$ `] 7@4 A@`www'w'w_w@_w@__@H@_Ǧ`]@_@ @@ H('@_ H @_  H H' 'G'@_ '___G_G_G_ss= s@s'Gñ< file %s: line %d: assertion `%s' failedgirepository/gifunctioninfo.cinfo != NULLGI_IS_FUNCTION_INFO (info)g-invoke-error-quarkCould not locate %s: %s@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/gifunctioninfo.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -DG_IREPOSITORY_COMPILATION -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c girepository/gifunctioninfo.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0;1 girepositorygifunctioninfo.c DD%gifunctioninfo.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L36.L37.L38.L45.L119.L122.L131_g_callable_info_invokeg_module_errorg_set_errorg_base_info_get_typelibg_typelib_symbolg_function_info_invokeg_quark_from_static_stringg_invoke_error_quarkg_interface_info_get_vfuncg_function_info_get_vfuncg_interface_info_get_propertyg_function_info_get_propertyg_function_info_get_flagsg_base_info_get_typeg_logg_function_info_get_symbolg_info_newstrcmp_g_base_info_find_method_GLOBAL_OFFSET_TABLE_  &7F(K( PHUX Z`xflTPx*0Db ""48 @ D L P `p      "$"DH P T \ ` p     ""<@ H L T X hx     8"<"\` h l t x      X"\"h l       ""$0DPT \x6!6@ 8    % - 6 ?W*KGWemH u8  P0  /303 1334039434 0 0 100644 10860 ` ELF+&h@@.shstrtab.text.rodata1.rodata.bss.data.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info A@`www_@\  h`]`]`]@ $H[`]_ _Ht``]_ _Ht``]_ _Ht``]_ _Ht``]_ _Ht``]_ _Hzt``]_ _Hrt``]_ _Hjt``]_ _Hbt``]_t `]@ @@HQ (h& h h oOo oO h  o oOo $oO @h 8h  (o ,oOo <oO Hh  @ov DosOoo PolOwA@`wwww_@\  h`]`]`]@ c__HRt``]H`]H`]H`]H`]H`]__Ht``]__Hzt``]Hu`]Hp`]__Hit``]__Hbt``]_t `]@@ @@HQ@ (h& h h oOo oO h  o oOo $oO @h 8h  (o ,oOo <oO Hh  @o DoOo| PoyO@w߰0A@`wwwHj__\ @< __@ __@ __\ @< __@\ __\ @< __\ @< __\ @< __@\ __@\ __@\ __@\ __@\ __@\ `]_@\ @ @@_@\  (h& h h oOo oO h  o{ oOo $oO <h ,h (oOo 8ofO Dh  <od @onOo HoO㾰A@`w_ww'www_wo_@h \`hǔN@Hw`]ww`< -  ?#w-  #`H1_ 4  H_ߐ %< ,0R@_%< ,0t@`]t`_ Hu`_ߐ A@_t``]%< ,0t@_ %< ,0u@H `]_t`_ u` ' %H_G,p,p@_G,pt`'%Ow5__@  H_πhHwg_o\ wgw_g_@@_@h \`h@girepository/ginvoke.ctype != G_TYPE_INVALIDUnsupported fundamental type: %svalue_to_ffi_typeg_value_to_ffi_return_type@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/ginvoke.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -DG_IREPOSITORY_COMPILATION -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c girepository/ginvoke.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.04* girepositoryginvoke.c DD%ginvoke.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L23.L24.L43.L14value_to_ffi_type.L48g_value_to_ffi_return_typeg_value_from_ffi_valueffi_callffi_prep_cifgi_cclosure_marshal_genericffi_type_voidg_value_set_boxedg_value_set_uint64g_value_set_int64g_value_set_ulongg_value_set_longg_value_set_pointerg_value_set_uintg_value_set_ucharg_value_set_charg_value_set_stringg_value_set_booleang_value_set_doubleg_value_set_floatg_value_set_intffi_type_uint8ffi_type_sint8g_type_nameg_logg_assertion_message_exprg_type_fundamentalffi_type_uint64ffi_type_sint64ffi_type_doubleffi_type_floatffi_type_pointerffi_type_uint32ffi_type_sint32_GLOBAL_OFFSET_TABLE_  0-?DI0!NS<ejp$  %6J[m~ #6FVfu /$/@'\` h l t x &.. -- ,, ++ ** 4)8) T(X( t)x) (( ,,   $%x/|/'     &##  ""  .$. 4-8- H,L, \+`+ x*|* )) (( )) (( ,,   $(%//! 0Hd,< @ L'T$h%|' / / H L , , $, (, `, d,  866@   XQ -" ' - 6 ?K@Wem uH &80  /337 1334039436 0 0 100644 15364 ` ELF+8@@.shstrtab.text.rodata1.bss.data.rodata.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info A@`ww_@@h`]`]`] @ AH @@ H`]`]`] @ BH _ \  w ?` A@`ww'_h`]`]`] @ ZH$@ H`]`]`] @ [H \`\  w_ \`G,0@ (@ A@`ww_@@h`]`]`] @ rH @@ H`]`]`] @ sH _ \  w ?`A@`ww'_w׀h`]`]`] @ H:@ H`]`]`] @ H&_׬]\ ]\  `w`\ <` @ ?$@@, 4 GHL@4 < '_]4`@ @ A@`ww_@@h`]`]`] @ H @@ H`]`]`] @ H _ \  w ?`A@`ww'_w׀h`]`]`] @ H?@ H`]`]`] @ H+_׬]\ ]\  `w`\ <` @ ?$@@, 4  HL4 G>L@4 < '_]4`@ @ww_wע \`\ \`\  `w``\`<` @ ?$@@, 4 ``HL@4 < '4 `@_w A@`ww_@@h`]`]`] @ H @@ H`]`]`] @ H _ \  w ?`A@`ww'_w׀h`]`]`] @!HD@ H`]`]`] @!H0_׬]\ ]\  `w`\ <` @ ?$@@, 4  HL4  >L4 GBL@4 < '_]4`@ @ A@`ww_@@h`]`]`] @!5H @@ H`]`]`] @!6H _ \  w ?`A@`ww'_w׀h`]`]`] @!PHI@ H`]`]`] @!QH5_׬]\ ]\  `w`\ <` @ ?$@@, 4  HL4  >L4  BL4 GDL@4 < '_]4`@ @A@`www_h`]`]`] @!uHC@ H`]`]`] @!vH/\`\ \`\  `w` \`<` @ ?$@@, 4 ` HL4 ` >L4 ` BL@4 < '4 `_@@ A@`ww_@@h`]`]`] @!H @@ H`]`]`] @!H _ \  w ?`A@`ww'_w׀h`]`]`] @!HN@ H`]`]`] @!H:_׬]\ ]\  `w`\ <` @ ?$@@, 4  HL4  >L4  BL4  DL4 GPL@4 < '_]4`@ @ A@`ww_h`]`]`] @!H(@ H`]`]`] @!H \`\  w H] \`@H@file %s: line %d: assertion `%s' failedgirepository/giinterfaceinfo.cinfo != NULLGI_IS_INTERFACE_INFO (info)@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11 girepository/giinterfaceinfo.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -DG_IREPOSITORY_COMPILATION -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c girepository/giinterfaceinfo.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0<2 girepositorygiinterfaceinfo.c DD%giinterfaceinfo.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L23.L24.L25.L32g_interface_info_get_iface_structg_interface_info_get_constantg_interface_info_get_n_constants_g_base_info_find_vfuncg_interface_info_find_vfuncg_interface_info_get_vfuncg_interface_info_get_n_vfuncsg_interface_info_get_signalg_interface_info_get_n_signals_g_base_info_find_methodg_interface_info_find_methodg_interface_info_get_methodg_interface_info_get_n_methodsg_info_newg_interface_info_get_propertyg_interface_info_get_n_properties_g_info_from_entryg_interface_info_get_prerequisiteg_base_info_get_typeg_logg_interface_info_get_n_prerequisites_GLOBAL_OFFSET_TABLE_  '8G(L( QHVX[} 0   )Ed} p(\0 3Ujp !$!HL T X ` d t   !!DH P T \ ` p     8!<!`d l p x |      0!4!\` h l t x      l!!       $ , 0 8 < L!!       ( , 4 8 H!! $ , 0 8 < L\pt |    !!   (  , 4  8 H X l p x  |   T ! !             $ 4 ! !              0  8! <! d h p  t |        !!     $4HL T X ` d t!!      0DH P T \ ` pT!!          $ 4x6#6@ pt%-6Z?>,KjHWemx0 u ( 70  /379 1334039438 0 0 100644 29660 ` ELF+o@@.shstrtab.text.rodata1.bss.data.rodata.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info A@`ww_h`]`]`] @ AH(@ H`]`]`] @ BH \`\  w H] \`@H@ A@`ww_@@h`]`]`] @ \H% @@ H`]`]`] @ ]H _ \  w 4  ,00400<  2H ?` A@`ww_@@h`]`]`] @ sH% @@ H`]`]`] @ tH _ \  w 4 ,00400<  2H ?` A@`ww_h`]`]`] @ H @ H`]`]`] @ H  ] \  @w] \ `@ A@`ww_h`]`]`] @ H @ H`]`]`] @ H  ] \  @w] \ ` @ A@`ww_@@h`]`]`] @ H @@ H`]`]`] @ H _ \  w ?` A@`ww'_h`]`]`] @ H$@ H`]`]`] @ H \`\  w_ \`G,0@ <@ A@`ww_@@h`]`]`] @ H @@ H`]`]`] @ H _ \  w ?`A@`ww'_w׀h`]`]`] @!H:@ H`]`]`] @!H&_׬]\ ]\  `w`Z <` @ ?$@@, 4 GJL@4 < '_]4`@ @ A@`ww_@@h`]`]`] @!H @@ H`]`]`] @!H _ \  w ?`A@`ww'_w׀h`]`]`] @!6H?@ H`]`]`] @!7H+_׬]\ ]\  `w`Z <` @ ?$@@, 4  JL4 GHL@4 < '_]4`@ @ A@`ww_@@h`]`]`] @!SH @@ H`]`]`] @!TH _ \  w ?`A@`ww'_w׀h`]`]`] @!nHD@ H`]`]`] @!oH0_׬]\ ]\  `w`Z <` @ ?$@@, 4  JL4  HL4 G>L@4 < '_]4`@ @A@`www_h`]`]`] @!H>@ H`]`]`] @!H*\`\ \`\  `w`Z`<` @ ?$@@, 4 `JL4 `HL@4 < '_4``@_@www_@_h@_h@_'˪ H_@@w@_hH _@_`Gˀ@O_瀤@hHt`h@w߰ A@`ww_@@h`]`]`] @!H @@ H`]`]`] @!H _ \  w ?`A@`ww'_w׀h`]`]`] @"HI@ H`]`]`] @"H5_׬]\ ]\  `w`Z <` @ ?$@@, 4  JL4  HL4  >L4 GBL@4 < '_]4`@ @ ww@_ H_@@@@_ H@HH`@O A@`ww_@@h`]`]`] @"AH @@ H`]`]`] @"BH _ \  w ?`A@`ww'_w׀h`]`]`] @"\HN@ H`]`]`] @"]H:_׬]\ ]\  `w`Z <` @ ?$@@, 4  JL4  HL4  >L4  BL4 GDL@4 < '_]4`@ @A@`www_h`]`]`] @"HH@ H`]`]`] @"H4\`\ \`\  `w` Z`<` @ ?$@@, 4 ` JL4 ` HL4 ` >L4 ` BL@4 < '4 `_@@www_@_h@_h@_'˪ H_@@w@_hH _@_`Gˀ@O_瀤@hHt`h@w߰ A@`ww_@@h`]`]`] @"H @@ H`]`]`] @"H _ \  w ?`A@`ww'_w׀h`]`]`] @"HS@ H`]`]`] @"H?_׬]\ ]\  `w`Z <` @ ?$@@, 4  JL4  HL4  >L4  BL4  DL4 GPL@4 < '_]4`@ @ A@`ww_h`]`]`] @#H(@ H`]`]`] @# H \`\  w H] \`@H@A@`www_@h @@@@oh_ _@w߀@h _`@@_h_ o`]@w A@`ww_h`]`]`] @#_H&@ H`]`]`] @#`H ] \  @w $@H] \ 4@H@0A@`ww_h`]`]`] @#xH@ H`]`]`] @#yH _`]@@ A@`ww_h`]`]`] @#H&@ H`]`]`] @#H ] \  @w (@H] \ 4@H@0A@`ww_h`]`]`] @#H@ H`]`]`] @#H _`]@ A@`ww_h`]`]`] @#H&@ H`]`]`] @#H ] \  @w ,@H] \ 4@H@0A@`ww_h`]`]`] @#H@ H`]`]`] @#H _`]4@ A@`ww_h`]`]`] @#H&@ H`]`]`] @#H ] \  @w 0@H] \ 4@H@0A@`ww_h`]`]`] @$ H@ H`]`]`] @$ H _`]@file %s: line %d: assertion `%s' failedgirepository/giobjectinfo.cinfo != NULLGI_IS_OBJECT_INFO (info)@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/giobjectinfo.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -DG_IREPOSITORY_COMPILATION -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c girepository/giobjectinfo.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.09/ girepositorygiobjectinfo.c DD%giobjectinfo.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L23.L24.L25.L32_get_funcg_object_info_get_get_value_function_pointerg_object_info_get_get_value_functiong_object_info_get_set_value_function_pointerg_object_info_get_set_value_functiong_object_info_get_unref_function_pointerg_object_info_get_unref_functiong_object_info_get_ref_function_pointerg_object_info_get_ref_functiong_slist_free_fullg_typelib_symbolg_slist_prependg_object_info_get_class_structg_object_info_get_constantg_object_info_get_n_constantsg_interface_info_find_vfuncg_object_info_find_vfunc_using_interfaces_g_base_info_find_vfuncg_object_info_find_vfuncg_object_info_get_vfuncg_object_info_get_n_vfuncsg_base_info_get_nameg_strcmp0g_object_info_find_signalg_object_info_get_signalg_object_info_get_n_signalsg_base_info_unrefg_interface_info_find_methodg_base_info_refg_object_info_find_method_using_interfaces_g_base_info_find_methodg_object_info_find_methodg_object_info_get_methodg_object_info_get_n_methodsg_object_info_get_propertyg_object_info_get_n_propertiesg_info_newg_object_info_get_fieldg_object_info_get_n_fieldsg_object_info_get_interfaceg_object_info_get_n_interfacesg_object_info_get_type_initg_object_info_get_type_nameg_object_info_get_fundamentalg_object_info_get_abstract_g_info_from_entryg_base_info_get_typeg_logg_object_info_get_parent_GLOBAL_OFFSET_TABLE_  $5D(I( NHSXXb'(&%#"/!P w!=g 9Khx0l    p& EP\h`@/BW]v =$=HL T X ` d t;:   ;9H=L=pt |    ;:     ;h=l=     ;:      ;==     ;:     ,;==     ;:     $ 4;==     ;:   ( , <;==     ;:    $ ( 8;t9==     ;:(, 4 8 @ D T;==     ; : $ ( 0  4 <  @ P; 0 = $= H L T  X `  d t; :     ; = = D H P  T \  ` p; :     ; h0 = =     ; :   $  ( 0  4 D; = =     ;:  $ , 0 @;08=<=dh p t |  ;:     ;*+(4$30'P&&==     $ 4;D:X\ d h p t ;==     0;@:TX ` d l p ;P0%$!"&(=,=PT \ ` h l |;:     ; =$=LP X \ d h x;:     ;0==  $ , 0 @;P:dh p t |  ;\(43(&l&==      ;:04 < @ H L \;==     ;:,0 8 < D H X;P0==     ;:     ,;p9==<Hp&t& |==     ; ,: @ D L  P X  \ l; = =! ! ! ! !$ !( !8;!H:!\!` !h !l !t !x !;!! !=!=""  " " " "$ "4;"D:"X"\ "d "h "p "t ";#=#=#$#( #0 #4 #< #@ #P;#`:#t#x # # # # #;## #=#=$ $$ $, $0 $8 $< $L;$\:$p$t $| $ $ $ $;%=%=%<%@ %H %L %T %X %h;%x:%% % % % % %;%% &=&=&8&< &D &H &P &T &d;&t:&& & & & & &;'0='4='T'X '` 'd 'l 'p ';':'' ' ' ' ' ';'' 66@ ((q)Q)Q%)Q-)Q6)QZ?-&K/EW0e0,m5 u;4 o0  /418 1334039440 0 0 100644 6028 ` ELF+@@.shstrtab.text.rodata1.bss.data.rodata.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info A@`ww_@@h`]`]`] @ >H4 @@ H`]`]`] @ ?H  ^\    4  H  4  H` 4  H` 4  H`@>0A@`ww_h`]`]`] @ bH@ H`]`]`] @ cH _^  @< @ A@`ww_@@h`]`]`] @ yH)?@@ H`]`]`] @ zH?_ \  w 4` HH  4` HH  ?`file %s: line %d: assertion `%s' failedgirepository/gipropertyinfo.cinfo != NULLGI_IS_PROPERTY_INFO (info)@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/gipropertyinfo.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -DG_IREPOSITORY_COMPILATION -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c girepository/gipropertyinfo.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0;1 girepositorygipropertyinfo.c DD%gipropertyinfo.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L23.L24.L25.L32g_property_info_get_ownership_transfer_g_type_info_newg_property_info_get_typeg_base_info_get_typeg_logg_property_info_get_flags_GLOBAL_OFFSET_TABLE_  &7F(K( PHUXZpp@ $HL T X ` d t   x|          < x|          6!6@ `s%-6Z? -*K WGW e m  ux X0  /459 1334039443 0 0 100644 7420 ` ELF+@@.shstrtab.text.rodata1.bss.data.rodata.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info A@`ww_h`]`]`] @ JHK@ H%@_ H @_ H@_ H@_ H@_ H @_ H@_ HH`]`]`] @ KH] \  @w @H] \ 4@H A@`ww_h`]`]`] @ gHK@ H%@_ H @_ H@_ H@_ H@_ H @_ H@_ HH`]`]`] @ hH] \  @w @H] \ 4@H A@`ww_h`]`]`] @ Hc@ H%@_ H @_ H@_ H@_ H@_ H @_ H@_ HH`]`]`] @ H*@_@@h H `]@@H @_@Hw^@H H_ߟfile %s: line %d: assertion `%s' failedgirepository/giregisteredtypeinfo.cinfo != NULLGI_IS_REGISTERED_TYPE_INFO (info)intern@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11*girepository/giregisteredtypeinfo.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -DG_IREPOSITORY_COMPILATION -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c girepository/giregisteredtypeinfo.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0A7 girepositorygiregisteredtypeinfo.c DD%giregisteredtypeinfo.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L23.L24.L25.L40.L100g_typelib_symbolg_type_from_namestrcmpg_registered_type_info_get_g_typeg_registered_type_info_get_type_initg_base_info_get_typeg_logg_registered_type_info_get_type_name_GLOBAL_OFFSET_TABLE_  !,=L(Q((VP[`(`fw $HL T X ` d t,0 8 < D H X     ,<Pdx          0DXl         (H 6-6@ `%-6? 6K MW e#,mP u`h 0  /506 1334039445 0 0 100644 43212 ` ELF+@@.shstrtab.text.data.rodata1.rodata.picdata.bss.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.picdata.rela.debug_info@A@`ww@_`]t @_0A@`w`]@H`]@`]`] P   @sw`]@`]\ @@A@`ww@_@@_t `]`]`]@_\ t `]`]`]@_\ t `]`]`]@_\ t `]`]`]@_\ t 0A@`ww@_@@Z @\ _`@\ _`@\ _`@\ `]\  P@Z 0@ P@0A@`ww_ P@w`]r 0_ @ A@`w`]@@`]\ h @@`]t `]\ h^`]@w`]t `]t @h`]@@ Z h`]\ @_``]t `_`o@`]\ h `]@\ `]t `]`]@w`]@\ `]t `]@\ `]t `]@@@A@`wwg`]\ @_@@`]t @A@`w`]Z @0A@`w4`]\ h`]@\ `]@\ @@Hr `]@\ @w0ww@_@ _@@@@ w A@`ww_\` $HH \`4@w`]@ @0A@`ww_hH`]\ @A@`wwwww_瀤h _߀ht _H-w_\`w\`_ 0@h`]`]`]@!_@@ H _߀@ht`H w_߀ht _w_װwww'ww_w_׀h$ _\ \ @_w@h ___@Hw_\ \ @_whHw_׀@h $`G〤HHw___z_w_ǰ0www___ w߰www_@@h/ \`h(? ,0_@@@ -w"@@_ w__@ h @@@ H'@ ? ,0_@o@@ 'G< A@`www'ww_߀@h`]`]`] @!yHiw]`w_ǀh`]`]`] @!}HTw]` ,w]` 0@wG뀤H"_\ \ @h`]`]`]@!_\ \ _]__@@H&__[@HHw_\ \ _@H _\ \ @_H_:_w_\ \ _@__w_ϰ A@`www_h`]`]`] @!HG_w_w߀h`]`]`] @!H @A@`www'wG _w_] w] _`,] `0w@kh_h@_ߒ`]__@ @@sH wH w_`]__w_װ0www_w_~_瀢 2h '< < @w A@`www _h`]`]`] @""H?_w_8w߀@h`]`]`] @"(H?\` ?`A@`www'_h`]`]`] @"EH.J_w_@@h`]`]`] @"KHG @@wπ@hH `_`@@@ www__@\` hD`\`@@` t \ ht`A@`www_wZ \ @_h@HN_w '_www\`\ `]@_߀h _\ \ `]@_߀h  '_\ \ `]@_߀h _\ \ `]@_߀@h`__`@_\ \ @_@@HA@`wwww_h`]`]`] @"H-h_w_@@h`]`]`] @"H_@@wπ@hH `_`@@@ www__@\`h`@@`t \ ht`A@`ww' _wZ \ @h@H3_w'ww\`\ `]@_߀h _\ \ `]@_߀@h`__`@_\ \ @@@H0www__`@_w`A@`www_wZ \ `]@_\ \ `]@@_ߠ 4@,0 _߀@h @_`>,0v_`@o@_ߠw A@`www_h`]`]`] @#WH O_w_w߀@h`]`]`] @#]H\`\`0@@ A@`www_h`]`]`] @#yH& _w_w߀@h`]`]`] @#H \`4H\`4H@@ A@`www_h`]`]`] @#H&_w_qw߀@h`]`]`] @#H \`8H\`4H@@ ww_wZ \ _@׀H_\ \ _@׀HH_@ A@`wwwwwww`]_@__瀧@h_`@@@ w_ǀh@@H_Ht`_`@o@@_wװ www_@ _$`_@ .w׀h_$ H _πhH @ _$`__@hH  ?  A@`www_ߠH`]`]`]@$ _נH`]`]`]@$GGۀHH @HH?GG׀HH @HH? ?`0ww_\ _\ '瀤 HH?HH _D _D HH HH ??`@w_@\ _@\ _@\ _ @㾠A@`wWwww`]`]@w`]@_w`]@_wǪ _hy^w_ @whj@ha`]@HS_@H@ .wg@ -wo _g@$c_H@@H6HH2@@h@@H(@@@_@w@ wh @_@@@H @ww_r`"`_r`r`@_w@_o@_`^o@_@_@_wA@`wwwwww_t _t _@_@@h"`]@@_`w@@@_\w\_t`\_t` @`]@@@@_wװA@`wwww_@_׸@@h_ @]@@Ԑ_ o@@__@H_@_w@h`]@@@h@_@@@w㾠A@`wgwww'wwwwG   4H 'wwww_h`]`]`] @$Hw_w__GNwhHw_h@_ϒ`]___@ @sHw_瀤@h __זU@w@_Hww__הw w_h_瀤h@_ϒ`]__@@ H @_ϒ`]_@@ Hjwoo@wh@_ϒ`]___o\ @ @s@oHO] w] _`,w] `0w@_ H@_ϒ`]___@ @s@_H._瀤h_@ H@_ϒ`]____@ s@s@_H__G_F_πh@_H_w@_w@__w_ǰwww'w___G_@@@wϰA@`wwwww'w`]\s \s _w___G_ϠwǰA@`wwwwww_@'ˀH `]_\ @ H@ 0A@`w`]`]`]@`]@@w@A@`w`] H `]@`]$ `] 7@4 0A@`w'Hu`]H~`]Hy`]Ht`]Ho`]Hj`]He`]H``]H[`]HV`]HQ`]HL`]HG`]HB`]H=`]H8`]H3`]H.`]H)`]H$`]H`]H`]H`]HG O* : "? B @ 4H\p$8L`t0A@`w'Hf`]Ho`]Hj`]He`]H``]H[`]HV`]HQ`]HL`]HG`]HB`]H=`]H8`]H3`]H.`]H)`]H$`]H`]H`]H`]HG O* : "D? B @ 4H\p$8L`tGIRepositoryGI_TYPELIB_PATH:/usr/local/libgirepository-1.0|girepository/girepository.cloaded_version != NULLfile %s: line %d: assertion `%s' failedtypelib != NULLheader != NULL!g_hash_table_lookup (repository->priv->lazy_typelibs, namespace)namespace != NULLAttempting to load namespace '%s', version '%s', but '%s' is already loadednamespace_ != NULL%s-%s.typelibsuccess%s-%s.typelib.typelibRequiring namespace '%s' version '%s', but '%s' is already loadedTypelib file for namespace '%s', version '%s' not foundTypelib file for namespace '%s' (any version) not foundFailed to load typelib file '%s' for namespace '%s': %sTypelib file %s for namespace '%s' contains namespace '%s' which doesn't match the file nameTypelib file %s for namespace '%s' contains version '%s' which doesn't match the expected version '%s'Failed to extract GType data: %sgirepositoryIntrospection OptionsShow Introspection Optionsg-irepository-error-quarkvoidgbooleangint8guint8gint16guint16gint32guint32gint64guint64gfloatgdoublegunicharGTypeutf8filenamearrayinterfaceglistgslistghasherrorunknowninvalidfunctioncallbackstructboxedenumflagsobjectconstantunionvaluesignalvfuncpropertyfieldargtypeunresolvedintrospect-dumpDump introspection informationinfile.txt,outfile.xmlcheck_version_conflictregister_internalcompare_version@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/girepository.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -DG_IREPOSITORY_COMPILATION -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c girepository/girepository.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.09/ girepositorygirepository.c DD%girepository.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodataglobals_lockdefault_repositorysearch_pathoverride_search_pathg_irepository_parent_classg_irepository_class_intern_initg_irepository_class_init.L23.L26g_irepository_initg_irepository_finalize.L55.L58.L66.L67init_globalsbuild_search_path_with_overridesbuild_typelib_key.L103get_typelib_dependenciesget_repository.L128.L129.L115check_version_conflictget_registered_statusget_registeredload_dependencies_recurse.L185.L186.L193.L202.L176register_internal.L221.L238.L239find_by_gtype_foreachfind_by_error_domain_foreachcollect_namespaces.L425.L450find_namespace_versionparse_version.L482.L473compare_versioncompare_candidate_reversefree_candidate.L528.L529.L541enumerate_namespace_versionsfind_namespace_latest.L599.L607.L609.L613.L616.L620require_internal.L635.L647g_irepository_introspect_cbintrospection_args.L660.L661.L662.L669.L672.L682.L684.L686.L688.L690.L692.L694.L696.L698.L700.L702.L704.L706.L708.L710.L712.L714.L716.L718.L720.L722.L724.L726.L737.L739.L741.L743.L745.L747.L749.L751.L754.L756.L758.L760.L762.L764.L766.L768.L770.L772g_info_type_to_stringg_type_tag_to_stringg_quark_from_static_stringg_option_group_add_entriesg_option_group_newg_irepository_get_option_groupexitg_irepository_dumpg_irepository_require_privateg_typelib_new_from_mapped_fileg_list_find_customg_list_prependg_irepository_enumerate_versionsg_slist_freeg_slist_foreachg_slist_delete_linkg_slist_sortg_dir_closeg_slice_alloc0g_str_has_prefixg_str_has_suffixg_dir_read_nameg_dir_openg_hash_table_newg_slice_free1g_mapped_file_unrefstrchrstrtolg_clear_errorg_mapped_file_newg_strdup_printfstrleng_irepository_get_typelib_pathg_irepository_get_c_prefixg_irepository_get_shared_libraryg_irepository_get_versiong_list_freeg_list_lengthg_malloc0g_irepository_get_loaded_namespacesg_list_appendg_irepository_find_by_error_domaing_typelib_get_dir_entry_by_error_domaing_typelib_get_dir_entry_by_nameg_irepository_find_by_nameg_hash_table_foreachg_base_info_refg_irepository_find_by_gtypeg_typelib_get_dir_entry_by_gtype_g_info_new_fullg_typelib_get_dir_entryg_irepository_get_infog_irepository_get_n_infosg_irepository_get_defaultg_irepository_is_registeredg_irepository_error_quarkg_set_errorg_irepository_load_typelibg_irepository_get_dependenciesg_hash_table_removeg_hash_table_lookup_extendedg_hash_table_insertg_logg_strfreevg_irepository_requireg_strndupstrrchrg_hash_table_lookupstrcmpg_assertion_message_exprg_string_freeg_string_appendg_string_append_cg_string_newg_slist_lastg_slist_copyg_irepository_get_search_pathg_strdupg_irepository_prepend_search_pathg_mutex_unlockg_build_filenameg_slist_reverseg_slist_prependg_strsplitg_getenvg_object_newg_static_mutex_get_mutex_implg_mutex_lockg_type_class_add_privateg_type_check_class_castg_hash_table_destroyg_type_check_instance_castg_base_info_unrefg_direct_equalg_direct_hashg_freeg_typelib_freeg_str_equalg_str_hashg_hash_table_new_fullg_type_instance_get_privateg_once_init_leaveg_intern_static_stringg_type_register_static_simpleg_once_init_enterg_irepository_get_typeg_type_class_peek_parent_GLOBAL_OFFSET_TABLE_  L$p59D Q0d8p@LX`P(  (8!,.OXaPg(pXX x  P pL ( H $' -8P39`pOll4 ) 8"("L#8$%:H@88Fp8L8R`X@h^(Pou({-p` H 8@PX`hpx "(.4:@FLRX^(d8j@pHvP|X`px 1/842.QVi,'('3BSdtP01Rlxh4 -(H]m, , XT :.x T `0 {(      ,@l    , 3 L Z j |   4  h     , 7 @ M k x          * 5 K g y      $4<@         X\lx         04 <@ HL T `d|      ,4 8 D H `d l|           8 < DL P \` hl x           $< @ LX` d     $ ( 0< @ HTd h p04tx   ( ,   ! !      ( 8 \ p x     $& (& 0 4 <' @' P x& |&   ( (   ** ) ) ,T04X&\& dh p,t, &&  '' 8<-- .. D&H& PT \,`, p&&  ''  $L&P& X\ d,h, x&&  '' ,8p/t/ |// // / / <Td&&  ,, <&@& HL T'X' h|pt00 0 0 (Pl|<1@1 H\1`1 hp8&<& DH P,T, d&&  '' @&D& LP X,\, l&&  '' 8<`&d& lp x2|2 &&  '' x(3,3 8\l  , x   !!  !(7!,7 !46!86 !D!p!t !|7!7 !6!6 !"""##@#D#\#` #h#l #t#;#; ##<#< ###$ =$= $$0$H$X$l$$$$$%%% %(%<%d%p%%%%&&&T9&X9 &`&x&&:&: &&'''L'h't''''' '(( (X(\(&(& (( (,(, ()L)X@)\@ )x))*A*A **,*8B*<B *L*d**C*C ***++D+D +4+<+`+t+E+E ++++,,,,,G,G -x-|--H-H --...(K.,K .4L.8L .@M.DM .P}.\J.`J .h|...N.N .O.O .{.N.N /N/N /@/D/\P/`P /pQ/tQ /R/R /S/S /T/T /U/U /V/V /W/W /X0X 0Y0Y 0$Z0(Z 08[0<[ 0L\0P\ 0`]0d] 0t^0x^ 0_0_ 0`0` 0a0a 0b0b 0c0c 0d0d 1e1e 1f1f 112g2g 2h2h 2,i20i 2@j2Dj 2Tk2Xk 2hl2ll 2|m2m 2n2n 2a2a 2o2o 2p2p 2q2q 2r2r 3s3 s 3t3 t 30u34u 3Dv3Hv 3Xw3\w 3lx3px 3f3f  ( -p0 8 66@ 4(5L5X ;h9(;p1<6<?A&KCEWD%eD; mQHx yuf=8 ` X0  /545 1334039447 0 0 100644 14948 ` ELF+6`@@.shstrtab.text.rodata1.rodata.bss.data.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info0A@`@w'''H_`]Hs`]Hn`]Hi`]Hd`]H_`]HZ`]HU`]HP`]HK`]HF`]HA`]H<`]H7GH`]H.`]H)GH`]H `]HG H , < !"d?D@`]`] a@@d(<Pdx,@''GG[ w0w @_ H@_H@H H @@ O OO@@_@_@%wA@`ww_h`]`]`] @ HLw@ <  @ H;_@@@H@?`,0H&v`]?`,0Hv`]`] @H@ O, < #a_ǠD@@`@O? ,0vw_ A@`ww_h`]`]`] @ H @@@@A@`wwww_@h`]`]`] @ H7 _h`]`]`] @ H$ @@@_@H@_`]@@ @H ___@_? A@`wwwww_h`]`]`] @! H'_瀤@h`]`]`] @!  H'_t` @H/'@_'   2H '  2H H/'@_'   2H ' H#' ' H'`]`]!=@HG H  O OOOO@_@ww@_@_'G@?,@ @'GH`'G@,0wGH`]t` 'GHMG@ 'G'_@GH(w@_@w_GG@< ,0t@_H*`]_GG@< ,0Hu`]`]!e@H@ O, < #`,_D@_G GO'GH `]_G$ < ,0t@_G4 __@   "H 'G۱< @w_@\ A@`wwwww_h`]`]`] @!Hp_h`]`]`] @!H]_瀤h`]`]`] @!HJϐ 8@h `]@ H9t 0_@_2 __@ @'À H `] @@@H____@@'À H `] @@@H_ϰ@0ww__`@\ @_`0girepository/girffi.cfile %s: line %d: assertion `%s' failedcallable_info != NULLinfo != NULLinvoker != NULLCould not locate %s: %scif != NULLcallback != NULLcould not allocate closure ffi_prep_cif failed: %d ffi_prep_closure failed: %d gi_type_tag_get_ffi_type_internalg_callable_info_get_ffi_arg_typesg_function_invoker_new_for_address@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/girffi.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -DG_IREPOSITORY_COMPILATION -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c girepository/girffi.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.03) girepositorygirffi.c DD%girffi.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L49.L14gi_type_tag_get_ffi_type_internal.L82.L83.L73g_callable_info_get_ffi_arg_typesg_callable_info_get_ffi_return_type.L123.L130.L133.L137.L213.L220.L223.L226.L229g_callable_info_free_closureffi_prep_closure_locffi_closure_freeffi_closure_allocg_callable_info_prepare_closureg_freeg_function_invoker_destroyffi_prep_cifg_malloc0g_vfunc_info_get_flagsg_function_info_get_flagsg_function_invoker_new_for_addressg_module_errorg_invoke_error_quarkg_set_errorg_base_info_get_typelibg_typelib_symbolg_function_info_get_symbolg_function_info_prep_invokerg_callable_info_get_return_typeg_arg_info_get_directiong_arg_info_get_typeg_callable_info_get_argg_malloc0_ng_callable_info_get_n_argsg_logg_type_info_is_pointerg_base_info_unrefg_base_info_get_typeg_type_info_get_interfaceg_type_info_get_tagg_type_info_get_ffi_typegi_type_tag_get_ffi_typeg_assertion_messageffi_type_voidffi_type_pointerffi_type_doubleffi_type_floatffi_type_uint64ffi_type_sint64ffi_type_sint32ffi_type_uint16ffi_type_sint16ffi_type_uint8ffi_type_sint8ffi_type_uint32_GLOBAL_OFFSET_TABLE_  /g>C"Hj(o@t""yXhxD#  4'8J 08jq $$'?Pk@P1CXr< *:JZix G$GDFHF XE\E lDpD CC BB AA FF @@ ?? ??  >>  =$= 4<8< X<\< lApA << ;;    :7645`4h7t3GG      201H0h/p.8<<    :-(404GG     2,8 4HGLGt x   2    2*()(&48 @%\'x$GG     20 4 <@ HL \2x5#"     ,: |, 8 4 1 ! < < H/ \. d8 4 < <     : - 84 h< l<   8G <G h  l t x  2      2       ,2 D ` d p2 1    2 ,0 @2H66@ g" ' - 6 ?K?W[eqm u#` 600  /578 1334039449 0 0 100644 6188 ` ELF+(@@.shstrtab.text.rodata1.bss.data.rodata.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info A@`ww_@@h`]`]`] @ DH[ @@ H`]`]`] @ EHG ^\    4  ,00400H  4 ,00400H` 4 ,00400H` 4 ,00400H` 4 ,00400H` 4 ,00400H`  4  ,00400H`@@> A@`ww_h`]`]`] @ rH*@ H`]`]`] @ sH] \  w`4  ,00400H] @`H@ A@`ww_@@h`]`]`] @ H  @@ H`]`]`] @ H  _ \  w 4  ,00400?`file %s: line %d: assertion `%s' failedgirepository/gisignalinfo.cinfo != NULLGI_IS_SIGNAL_INFO (info)@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/gisignalinfo.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -DG_IREPOSITORY_COMPILATION -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c girepository/gisignalinfo.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.09/ girepositorygisignalinfo.c DD%gisignalinfo.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L23.L24.L25.L32g_signal_info_true_stops_emitg_interface_info_get_vfuncg_signal_info_get_class_closureg_base_info_get_typeg_logg_signal_info_get_flags_GLOBAL_OFFSET_TABLE_  $5D(I( NHSXX@v $HL T X ` d t   @D L P X \ l|      HLpt |         66@ 0qyy%y-y6yZ? &K EW >e Tm P u 0  /617 1334039451 0 0 100644 5212 ` ELF+@@.shstrtab.text.bss.data.rodata.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info0w_wZ`Z ` w : ': :  w'_]`Z `  X@ GH]`Z 7@2@wϖJ `2  *08208H7@@@G󀥀O7@: ': : 0w'_w\`GÐ@2  @@w0w_wZ`Z ` w : ': : w'_] \  w] \ `G >L@'_^4`@ www_wע \`\ \`\  `w``X``JL@4 < '4 `@_w0w_wZ`Z ` w 2w0w_wZ`Z ` w 2  ?*002002w0w_wZ`Z ` w 2  *00200: ': : 0w_wZ`Z ` w 2 *00200: ': : @(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/gistructinfo.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -DG_IREPOSITORY_COMPILATION -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c girepository/gistructinfo.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.09/ girepositorygistructinfo.c DD%gistructinfo.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodatag_struct_get_field_offsetg_struct_info_is_gtype_structg_struct_info_is_foreigng_struct_info_get_alignmentg_struct_info_get_size_g_base_info_find_methodg_struct_info_find_methodg_struct_info_get_methodg_struct_info_get_n_methodsg_info_newg_struct_info_get_fieldg_struct_info_get_n_fields_GLOBAL_OFFSET_TABLE_  $5Dx^X|8XXhH H0;PXSHn|( 66@ $-Z6 "&B HEN \ d( l H wh0  /656 1334039453 0 0 100644 11364 ` ELF+(`@@.shstrtab.text.rodata1.rodata.bss.data.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info A@`ww_@@h`]`]`] @ DH7 @@ H`]`]`] @ EH# _ \  w 4`,08408< H 4`,00400< H4`H _ \  w 4  ,08408?` A@`ww_@@h`]`]`] @ bH< @@ H`]`]`] @ cH( _ \  w $4  HH 4`,08408< H 4`,00400< HH `_ \  w ,08408?`A@`w'_h`]`]`] @ HQ@ H`]`]`] @ H=_`\ ` w 4`,08408< H 4`,00400< H(_`\ ` Hw__`` G,0@ @< HH ,08408< $  O, < #aĠD L    A@`ww_h`]`]`] @ Hg@ H`]`]`] @ HS $4  H$] \  H@ H'`]`] @H8` OO__  @ H+] \  @4`,08408< H 4`,00400< H ]`\  w ` ,08408< H] ]`@`H@ A@`ww_@@h`]`]`] @ HB?@@ H`]`]`] @ H.?_ \  w 4`,08408< H 4`,00400< H_ \  w4` ,00400< H 4` ,00400HH??` A@`ww_@@h`]`]`] @!HB @@ H`]`]`] @!H. _ \  w 4`,08408< H 4`,00400< H_ \  w4` ,00400< H 4` ,00400HH??` A@`ww_@@h`]`]`] @!)H> @@ H`]`]`] @!*H* _ \  w 4`,08408< H 4`,00400< H_ \  w 4` ,00400< H4` ,00H400 ?` A@`ww_@@h`]`]`] @!IHM?@@ H`]`]`] @!JH9?_ \  w 4`,08408< H 4`,00400< H$_ \  w 4` ,00400< H`]`]`] @!QH?4` ,00H400??`file %s: line %d: assertion `%s' failedgirepository/gitypeinfo.cinfo != NULLGI_IS_TYPE_INFO (info)blob->tag == GI_TYPE_TAG_ARRAYg_type_info_get_interface@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/gitypeinfo.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -DG_IREPOSITORY_COMPILATION -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c girepository/gitypeinfo.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.07- girepositorygitypeinfo.c DD%gitypeinfo.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L23.L24.L25.L32.L92.L227g_type_info_get_array_typeg_type_info_is_zero_terminatedg_type_info_get_array_fixed_sizeg_type_info_get_array_length_g_info_from_entryg_info_newg_assertion_messageg_type_info_get_interface_g_type_info_newg_type_info_get_param_typeg_type_info_get_tagg_base_info_get_typeg_logg_type_info_is_pointer_GLOBAL_OFFSET_TABLE_  "3B(G( LHQXV[pa | hxx  %6Q`ezL $HL T X ` d t             ,(, 4 8 @ D Tdx|     8     $ 4DX\ d h p t     $ 04 < @ H L \l               (  , < ( , P T \  ` h  l |                $ ,  0 8  < L     66@  H "'-6Z?#"KECWemP u( (00  /693 1334039456 0 0 100644 47780 ` ELF+@@.shstrtab.text.rodata1.rodata.data.bss.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info@ww_\ @__t @A@`ww_\ h`]`]`]@ 1_\ @@_t A@`ww7w_]`wH_ H@_`]@@ H $ h?@ h;B h7D h3F h/H h+J h&L h"P hN hT hV hX hZ <h \ (h^ (h @_`]@@ H9 H @_`]@@ H(  H @_`]@@ H ` H` H @_`]@@ H  = A@`www_\ _`_`_HH _``]_`,_@HH  ?  w'''w_ < _ߔ @Ȗ @ =w'''w_Z @w _ߢwǀ@hH  ` HH  =A@`ww''''w_\ @w 4  ,08408H@_ߒ`]_ ,08408< @@  H/'G瀤H@_ߒ`]@@  H'۪ H_=`,0@ < _ߔ @K H H '۪`G瀥@O 'G۱< A@`ww'''w_\ @ `4  ,08408H@_ߒ`] ` ,08408< @@ H  =A@`ww'''w_\ @4`,08408< H@4`,00400< H9 `< H H@_ߒ`] < @@  H' `< H H4` H@_ߒ`] < @@  Hu'۠ Hr'_\ @HVw_G_߀H H`'H\_G_߀H HR'HN_G_ H HC'H?_G_ H H4'H0_G5_߀H H&'H"@_ߒ`]@@  H' ,08408< $  O, < #c8_D 'G۱< hP A@`ww''w_]` h @_`]@@ H  ]`w`]]`_@HH _ < _ HH  = A@`ww'w_] `h @_`]@@ H] w H @_`]@@ H] @@@A@`ww'w_]`5 h@_`]@@  H3']`w H< _@ H H' _ H_? ,0 < D_瀢H H ' _ O 'G< A@`ww'7w_\ w_]` h@_`]@@  H!']` H@_`]@@  H '`]]`_Ԑ@H H'__ @_`]Z _瀢H H'4 ,00400H.HH*@_`]@@  H'< H  O OO H  O OOOO4` ,00400H4` ,00400H 4` ,00400HHH@_`]@@  H'< O OO c,00400H#4` ,00400H4` ,00400H4` ,00400H@_`]@@  H]'_ _瀢H HS'`4 ,00400HF_` u_wǀ@h H>'__@w@h H2' ` ,08408< H&< H H@_`]_ ,08408@< _@ @@ H'+_ 'G< A@`ww'w_\ ]` h @_`]@@ H6 ]`w H @_`]@@ H$ `]]`_@HH __ YƐ@_ _HH _ =A@`wow'w`] X`@O$H`]`]`]@$ _]` h @_`]@@ H} ]`w H @_`]@@ Hk `]]`_ @HH^ _ < _ Y HHQ _ H @_`]@@ H? _\  @ww 4`,08408< H04`,00400< H) `< H @_`]@@ H 4,0@`H_ H @_`]@@ H  ?  A@`ww'w_]` h @_`]@@ H ]`w`]]`_@HH  ?`A@`ww'w_\ w_]`w]` h @_`]@@ H7 ]`w`]]`_U@HH' _ 4  ,08408H__ J@|_瀢HH H_ < _ w HH  ?  A@`ww'w_]` h @_`]@@ H  ]`w`]]`_@HH _ < _ 5 HH  ? A@`ww''w_]` h @_`]@@ Hq ]`w`]]`_@HHa _ 4 ,00400<  2H 4 ,00400<  2H 4 ,00400<  2H  H @_`]@@ H4 4 ,00400H"_\ @` Hw`H'w`'_ GӀH @_`]@@ H  __ _瀢HH  =A@`ww''w_]` h@_`]@@  HK']``]]`_%@H H;'4 ,00400H'_\ @` Hw`H'w`'4 ,00400< GӀH@_`]@@  H'__瀢H H' 'G< A@`ww'7w_\ w_]` h@_`]@@  H']`w񀤀H@_`]@@  H'`]]`_@H H'___ hՐ@_`4  ,00400H!_`]Z `_瀢H H'_`]Z _ q_瀢H H'H`H` H@_`]@@  Hp'_\ _ϰ ,0,p,p @h@_`]@@  HS' 'Ǡ ' H'_\ Ǡ w__瀢H H='Ǡ '_ 4  ,08408HǠ 'G˦ '_ O '_ H_G˥,p,p< _瀢H H'G˦ '_ OA_ 'G< A@`ww'7w_\ w_]` h@_`]@@  H']`w񀤀H@_`]@@  H'4  ,00400H!`]]`_@H H'_`]Z _ _瀢H H'HH H@_`]@@  Hu'_`]Z _ d_瀢H Hf'_^ _,p,p@,p,p h@_`]@@  HH'`'_{@ '_ H_x_瀢H H.'G˦ 'Ǡ '_ O '_ H__ H H'G˦ 'Ǡ '_ OT_ 'G< A@`ww'w_\ w_]`w]` <h@_`]@@  H']`w H@_`]@@  H'`]]`_@H H'_`]Z _ _瀢H H'_`]Z _ _瀢H H'_ = _ H@_`]@@  H'〤H)__w@h H'`H`4  ,00400HH@_`]@@  Hs'_ `H&__ɒ@w@h Hb'` H`4  ,00400H@_`]@@  HJ'_\ _ǰ  <` @ ?$@@, <  ,0 ,0 ,p,p ,0 ,p,p ,p,p <@h@_`]@@  H'<<  ' HO_] 74@7=`H_ H@_`]@@  H'_J@w@h H'`H`4  ,00400HH@_`]@@  H'Gæ 'á7 _ O7_ <` @ ?$@, 4 __ aΐ@ '_ H_7_瀢H H'Gæ 'á7 _ O '_ H_ד7D_瀢H H'Gæ 'á7 _ O '_ H_7_: H Hc'Gæ 'á7 _ O '_ H_ד7N_瀢H HG'Gæ 'á7 _ O '_ H_ד7_瀢H H+'Gæ 'á7 _ O '_ H_ד7_瀢H H'Gæ 'á7 _ O;_ 'G< A@`ww'w_\ w_]`w]` (h@_`]@@  HY']` H@_`] @@  HE'`]]`_@H H7'_`]Z  _瀢H H)'_`]Z  }_瀢H H'_\   <` @ ?$@@, <  ,0 ,p,p ,0 ,p,p ,p,p (@h@_`]@@  H'(<  ' HJ_] 7@4@7=`H_ H@_`]@@  H'@@w`HH`4  ,00400HH@_`]@@  H'Gæ 'á7@  O7@ <` @ ?$@, 4 __ &@ ' H_ד7@_瀢H Hv'Gæ 'á7@  O ' H_7@_ H H\'Gæ 'á7@  O ' H_ד7@_瀢H HB'Gæ 'á7@  O ' H_ד7@@_瀢H H('Gæ 'á7@  O ' H_ד7@_瀢H H'Gæ 'á7@  O_ 'G< 0w'w ' : A@`ww'w_\ w_] `h@_`]@@  H'] Hsw__ H Hy'Hu_L_瀢H Hm'Hi__ (_瀢H H_'H[__ _瀢H HQ'HM__瀢H HE'HA__瀢H H9'H5_f_瀢H H-'H)_r_瀢H H!'H@_`]@@  H'$  O, < !"̠?ԠD 'G< $$\A@`www_\ ^w^_```,p,ph @_`]@@ H  `H@w`]^ _VHH{ _`4  ,00400H` H_ H @_`]@@ H^ _ H2 4  ,00400H @_`]@@ HF  H @_`]@@ H5 __ _HH+ H" 4  ,00400H @_`]@@ H `]^ _HH  _ Oy ?  A@`www_\ ^ (  ,p,ph @_`]@@ H  ?`A@`wwww@_\ @h _`]@_h_`@_`h@ /_`@o@ )@ w_`]@_@_ρ A@`www_wwߐ_H _`]H _H _`]H j_H _`]H  ? @A@`w`] H `]@`]$ `] 7@4 A@`ww_\`w_ 4H\`4H@@@hZL` HV`]@@  Z hF>,0_@@ h>,0@_@Z @ h@^" `]@^@ @ h`]>,0@_@ @@H_\ @_t >,0_@o@@@ h`]@ @@_\ @_t @w_(D`H $`b www___瀢HH 0@w_r _r  " r  www__z_瀢HH  0@w_r _r " r  ww@_@__SHH  0@w_r " r r @A@`ww_\`h@HD`H@\`_\ @h `]@@_@\ _ 0@@w_Z `,@w www6__\ @h_`__@@HH _`@o =girepository/gitypelib.cctx->context_stack != NULLInvalid directory index %dThe buffer is too shortExpected blob for typeExpected non-basic type but got %dGdkRectangleCairoRectangleIntsizeof(Header) is expected to be %d but is %lu. sizeof(DirEntry) is expected to be %d but is %lu. sizeof(SimpleTypeBlob) is expected to be %d but is %lu. sizeof(ArgBlob) is expected to be %d but is %lu. sizeof(SignatureBlob) is expected to be %d but is %lu. sizeof(CommonBlob) is expected to be %d but is %lu. sizeof(FunctionBlob) is expected to be %d but is %lu. sizeof(CallbackBlob) is expected to be %d but is %lu. sizeof(InterfaceTypeBlob) is expected to be %d but is %lu. sizeof(ArrayTypeBlob) is expected to be %d but is %lu. sizeof(ParamTypeBlob) is expected to be %d but is %lu. sizeof(ErrorTypeBlob) is expected to be %d but is %lu. sizeof(ValueBlob) is expected to be %d but is %lu. sizeof(FieldBlob) is expected to be %d but is %lu. sizeof(RegisteredTypeBlob) is expected to be %d but is %lu. sizeof(StructBlob) is expected to be %d but is %lu. sizeof(EnumBlob) is expected to be %d but is %lu. sizeof(PropertyBlob) is expected to be %d but is %lu. sizeof(SignalBlob) is expected to be %d but is %lu. sizeof(VFuncBlob) is expected to be %d but is %lu. sizeof(ObjectBlob) is expected to be %d but is %lu. sizeof(InterfaceBlob) is expected to be %d but is %lu. sizeof(ConstantBlob) is expected to be %d but is %lu. sizeof(AttributeBlob) is expected to be %d but is %lu. sizeof(UnionBlob) is expected to be %d but is %lu. size_check_okBuffer is too short while looking up nameretThe %s is too long: %sabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789-_The %s contains invalid characters: '%s'The specified typelib length %lu is too shortGOBJ METADATA Invalid magic headerTypelib version mismatch; expected 4, found %dInconsistent entry countsTypelib size %lu does not match %luBlob size mismatchMisaligned directoryMisaligned attributesWrong number of attributesnamespacePointer type exected for tag %dParameter type number mismatchInvalid non-basic tag %d in simple typeWrong tag in complex typeargumentNo return type found in signatureWrong blob type %d, expected functionfunctionfunction symbolConstructor not allowedSetter, getter or wrapper not allowedMust be setter, getter or wrapperInvalid return type '%s' for constructor '%s'Wrong blob typecallbackG_N_ELEMENTS (value_size) == GI_TYPE_TAG_N_TYPESconstantMisaligned constant valueConstant value type voidConstant value size mismatchvaluefieldpropertysignalInvalid signal run flagsInvalid class closure indexvfuncstructboxedGtype data in structenumGtype data in unregistered enumobjectInvalid parent indexParent not objectClass struct invalid type or not localInvalid interface indexNot an interfaceWrong blob type; expected interface, got %dinterfaceInvalid prerequisite indexNot an interface or objectInvalid blob typeentryInvalid entry typeToo few local directory entriesMisaligned entryToo many local directory entriesIn %s:In %s (Context: %s): In headerdirectoryattributesg-typelib-error-quark,soFailed to load shared library '%s' referenced by the typelib: %sgtypelib.c: Failed to g_module_open (NULL): %spop_contextg_typelib_check_sanityget_string_nofailvalidate_constant_blob@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/gitypelib.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -DG_IREPOSITORY_COMPILATION -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c girepository/gitypelib.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.06, girepositorygitypelib.c DD%gitypelib.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodatapush_context.L29.L30.L20pop_context.L41.L44get_dir_entry_checkedget_blob.L61.L65get_type_blobget_section_by_id.L112.L114g_printerris_aligned.L230get_string.L243.L234get_string_nofail.L254.L256.L258validate_name.L267.L269.L271.L274.L277.L280.L300.L303.L306.L310validate_header_basic.L320validate_headervalidate_array_type_blobvalidate_type_blobvalidate_iface_type_blob.L348.L351validate_param_type_blobvalidate_error_type_blob.L379.L403.L414validate_arg_blob.L428return_type_from_signaturevalidate_signature_blob.L458.L460.L463.L475.L487.L495.L509validate_function_blob.L520.L522validate_callback_blob.L532.L538.L544.L550.L556.L560.L529validate_constant_blob.L570validate_value_blob.L581validate_field_blob.L599validate_property_blob.L612.L616.L624validate_signal_blob.L636validate_vfunc_blob.L658.L663.L672validate_struct_blob.L704.L713validate_enum_blob.L743.L751.L761.L769.L780.L788validate_object_blob.L842.L844.L860.L867validate_interface_blobvalidate_union_blob.L947validate_blob.L962.L970.L975.L978.L984validate_directoryvalidate_attributes.L1004.L1012prefix_with_context.L1021.L1024.L1027.L1034.L1037.L1050.L1059.L1062.L1068_g_typelib_do_dlopen_g_typelib_ensure_openg_module_symbolg_typelib_symbolg_typelib_get_namespaceg_slice_free1g_list_freeg_module_closeg_list_foreachg_mapped_file_unrefg_typelib_freeg_mapped_file_get_lengthg_mapped_file_get_contentsg_typelib_new_from_mapped_fileg_typelib_new_from_const_memoryg_slice_alloc0g_typelib_new_from_memoryg_list_prependg_strfreevg_list_appendg_module_errorg_logg_string_overwriteg_module_openg_strsplitg_quark_from_static_stringg_typelib_validateg_freeg_string_freeg_string_append_cg_string_appendg_prefix_errorg_string_newg_type_tag_to_stringstrncmpstrspnmemchrg_typelib_check_sanityg_quark_to_stringg_typelib_get_dir_entry_by_error_domainstrleng_ascii_strncasecmpg_type_nameg_typelib_get_dir_entry_by_gtype_gi_typelib_hash_searchstrcmpg_typelib_get_dir_entry_by_nameg_typelib_get_dir_entryg_typelib_error_quarkg_set_errorg_slist_delete_linkg_assertion_message_exprg_slist_prepend_GLOBAL_OFFSET_TABLE_  !2A4N S X ]hi@ n`sx(8 h@0 |# X H0 0-H03x9?0E K(Q W8]Pch i P L $8|  pX( $ *x< 0(B]pHu X({    ( ( 0  8 HP8X X8    !`  $84 :%`N T&k q ( w H }'8 h) p x +  /    (   83PL+ P01 7 = C;[A(o uB     ( @(DG h pH        H"(/)K 8>Mp@UePtvP84OpN|<NPl\kMp I#1CSbo 83KR rXJx,pt    \h l |  $Xdh t LX\ x4T $Ttx   <d  $       ` d         p            X \  " "  # #   $ $  $ 0% 4% D h t& x&   ' ' ((  4@)D) Px** ++ (,p-t- 4@2D2 h33 `d22 (,66 ,82<2 T77  88  : : ,x|  ,0 <lx=|= >> ?? `l@p@ |htAxA 0<B@B LLXC\C x   @ L P \  E E  F F !h!l!H!H ! ! !N!N !I!I !!""  ""D"PE"TE "`"pJ"tJ "#K#K ###L#L ###M#M $$@$D$x$$ $$P$P %%%d%p%t %%R%R &&&&& &'T'T ''''' '( V(V ((W(W ()d)pX)tX )))*$*0*4 *@*\Z*`Z ++$X+(X +4++++, , ,@,LE,PE ,\,p\,t\ ,],] -,]-0] --^-^ -.. . .////0 0 0@0LE0PE 0\0`0` 0`0` 1,18a1<a 1H1``1d` 111 13X3\333 333E4E 4 4 c4$c 4\c4`c 4c4c 44d5d 5 55e5e 56<6Hf6Lf 6X77$7( 7477g7g 78D8Ph8Th 8`;;< << <(`>ll>pl >|>>>m>m ?BB BLBXB\ BhD D,pD0p D<DDEHETEX EdEErEr FF sF$s F0FtFtFt FFFuFu FG4G@vGDv GPG`-Gd- GGH,H8H< HHHHHHyHy HHI I(I4IHzILz ITI\III|I| J}J} JH~JL~ JJJJ JJ JJJ JJ K(K,KK KKKKLL L$ L,L8LHL`Ld LtLLLLMM M M M8NNNNO$OxO|OOOO OOPP66@ QQW`0"`(`-`6`?e KgBWh<ehRmqX u3 p0  /729 1334039458 0 0 100644 5508 ` ELF+@@.shstrtab.text.bss.data.rodata.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info0w_wZ`Z ` w : ': :  w'_wߢ`\`\ \`` `^G`JL4 @ w0w_wZ`Z ` w : ': : w'_w߬`]\ `  w]\  `^``JL4 G`>L4 < ']4`@ w0w_wZ`Z ` w 2 *00200: ': : 0w_wZ`Z ` wB ?`0w_wZ  @ ww'_w߬ ]\   w`4 ,00400H]\   ^` JL4 ` >L4 G PL4 < ']4` @H@ww_wע \`\ \`\  `w``^``JL@4 < '4 `@_w0w_wZ`Z ` w 2w0w_wZ`Z ` w 2  ?*002002w@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/giunioninfo.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -DG_IREPOSITORY_COMPILATION -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c girepository/giunioninfo.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.08. girepositorygiunioninfo.c DD%giunioninfo.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodatag_union_info_get_alignmentg_union_info_get_size_g_base_info_find_methodg_union_info_find_methodg_union_info_get_discriminator_g_type_info_newg_union_info_get_discriminator_typeg_union_info_get_discriminator_offsetg_union_info_is_discriminatedg_union_info_get_methodg_union_info_get_n_methodsg_info_newg_union_info_get_fieldg_union_info_get_n_fields_GLOBAL_OFFSET_TABLE_  #4C0X^Ht(8@4  X>`VHq|xlH  66@ PPP$P-PZ6 $B DN \ (d( lx w0  /767 1334039460 0 0 100644 9868 ` ELF+"@@.shstrtab.text.rodata1.rodata.bss.data.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_infow''w_\ \ wנ 'GH%_ \\ @w\\ `w@_瀢 H _Z`@ Hw_ D@'GӠ GO'w_߰ A@`ww_@@h`]`]`] @ \H@ @@ H`]`]`] @ ]H, ^\    4  ,00400H  4  ,00400H` 4 ,00400H` 4 ,00400H`@> A@`ww_@@h`]`]`] @ H @@ H`]`]`] @ H _ \  w ?` A@`ww_h`]`]`] @ H*@ H`]`]`] @ H] \  w`4 ,00400H] @`H@A@`ww_h`]`]`] @ HO@ H`]`]`] @ H;\`\ `  4  #,00400< #HH+\`@@'Ӏ`H  4  #,00400< @@H`H  4  #,00400< @@H `]`] @A@`wwww@_@w@w'ì H_@@@_@@ H@@HHGÀO@h @_`]@@ H'w@_w@@'_: \@w@@_h@_`]@_@_@ @@Hww_߰www'w'_w_w_@_w_\`hH __G_G_ǒs s s@sǪ=`file %s: line %d: assertion `%s' failedgirepository/givfuncinfo.cinfo != NULLGI_IS_VFUNC_INFO (info)Couldn't find struct field for this vfuncClass %s doesn't implement %sg_vfunc_info_get_invoker@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/givfuncinfo.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -D_REENTRANT -D_PTHREADS -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/lib/libffi-3.0.9/include -I./girepository -DG_IREPOSITORY_COMPILATION -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c girepository/givfuncinfo.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.08. girepositorygivfuncinfo.c DD%givfuncinfo.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L36.L37.L38.L45.L95.L134.L137_g_callable_info_invokeg_vfunc_info_invokeg_type_nameg_type_class_unrefg_field_info_get_offsetg_type_class_refg_invoke_error_quarkg_set_errorg_base_info_unrefg_base_info_get_nameg_struct_info_get_fieldg_struct_info_get_n_fieldsg_object_info_get_class_structg_base_info_get_containerg_vfunc_info_get_addressg_assertion_messageg_interface_info_get_methodg_object_info_get_methodg_vfunc_info_get_invokerg_interface_info_get_signalg_vfunc_info_get_signalg_vfunc_info_get_offsetg_base_info_get_typeg_logg_vfunc_info_get_flagsg_info_newstrcmp_g_base_info_find_vfunc_GLOBAL_OFFSET_TABLE_  #4C(H( MHRXW\p0bh8$<Wv '?Wlrp)(++@D L P X \ l&|%     &++     &% $ ( 0 4 D&++     &%   ( , <&"++     &,%@D L P X \ l&% (8 < D H X++)LX \ hx h66@   v" ' - 6 ?*$KNDWemx u "X0  /805 1334039512 0 0 100644 27740 ` ELF+hX@@.shstrtab.text.rodata1.rodata.bss.data.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_infow''''J '2`'ߐ `'ې  _ߑ+pw:`- : "w-@ "5@ H`2*0w:`5 : "w5@ " w'''J '2`'ߪ `5@  _ߑ+0@:`2 5@ H 7@ 2*0@:`* 7@'2 w'''2`' `'   ; *@" _+pw7@:- : @"w-@ @"5@ H`2*0w:`5 : "w5@ " w''2`' `5@   :*@" _+0@:2@7 5@ H 7@ 2*0@:`* 7@'2 wwwwwA@`ww`]@@_@ @@h@@@_@@ @@`]!@@@@@wwwwww@w'@,0_t @w_@\ @w'',p,p@_t @,0_t @_t @w''_\ ,0@ _\ @ _$ @w_@\ _@\ _@\ @w_@\ _@\ _t t  w'''_`\`*0*0@"\`*0*0@" \`*0*0@" `]`.0\`*0*0@" ]`.p\`*0*0@" ]`+p \`*0*0@" `]`" ]`"]`"`Zw ` *`Zw ` *`Z w ` *`` $`0A@`ww'' 7@H)`]7@_\ 2@,p,p```@`]_\ 7@4,p,p` ``@7@ 7@ O 7@H`]7@_\ 2@,0@7@ 7@ O A@`ww' ' 6 H_] -p-p64,0@] -@?'ߡ7@H3?H07@'_\ 4@,p,p5H H 'H H' '_\ 7@4,p,p,0@ 7@H?O7@?H`]@_ 2`I@@?߀H_\ 7@4,p,p64,0@ 4,p,p,0@H$` _] 7@4,p,p64,0@ ] 54,0$@_\ 54@w `$ ,`6 6  OpA@`w''ww  '4 4@ w4 4 @  'HK_] ߥ,p,p']  ']  '] @ H  @ H @ H"_ߡ5 4 4`] @ <<@H_7@4@,0$`w `] @@-ߠ ' Oˣ7@H_ˡ,p'Ǡ`'__] ǥ,p,p']  ']  '] @ H&],@'_á5 4 4`] @ <<@H_7@4@,0$`w `] @@-_\ @ H&\-0@'_á5 4 4`] @ <<@H_7@4@,0$`w `] @@-_\ @ H&\-0@'_á5 4 4`] @ <<@H_7@4@,0$`w `] @@-ˣ7@Oa@_7@$@< '< < 0A@`wߐ @@h `]`]@ HH  @  @@@$`8t`t`$`  ,`$$`(t`0w@@0A@`ww_\ `]@@0A@`ww'_\  H H ':`/ $`]u ww_Z _ G H7@H G &8 G OСA@`ww?w_\ `] HH`] ?`];*[_ \ '`\ wH`] @@`$ ` H`$`,`@'` `$ ,` $``] ``w` w@@`($``]`````]`]```;[#_ H `]!`]``@`]G`8@ w`_@_'H 6$ @_`w``]6_ H `]!`]@66 HHHO6 HHh_ H `]!`]``@_@ڐ@֐_ H `]!`]``@@0@ @_D "  8@wע`\`r t``\`r t``0\`r 0t``(" (` " `$* $`" `" `" u`%`])_ H `]!`]@@www '_\ _  W_\ \` \` '_\  HMϪw_\ \`\`@_ _@Ϣ `tL$'`tL$'`tL$,`'_\ \`\`__Oߠ '_\   O  __'ۀ  "H '< < A@`wwww_ '_ 4 4@ _ w`] @@'Ò @_t``4 4 @ _\ @ ߠ$ '   H&_,0@'_ ] ۥ,p,p']  ']  '`]_\ 2`4  `, < <4 < ,08408< 24  , < <4 < ,08408< 24  , < <4 < ,08408< sס44  4`] @ <<@Hӡ5`4 `4`]  <<@H"_\ 5`4w   `,`< ,4@`] @< ,08408< - w `] @. ϡ5 4 4`]  <<@H"_\ 5 4w `  ,`< ,4@`] @< ,08408< -`w `] @. _ ] ס6 4w ] ӡ44  , < <@4 < ,08408< ϡ4`4  `, < <4 < ,08408<   <``.! L $@ ,`< ,4@`] @,08408< @-6 4w  4`] @H,ӡ44  4`] @ <<@Hϡ5`4 `4`]  <<@H"_\ 5`4w   `,`< ,4@`] @< ,08408< - w `] @. _ ] ӡ6 4w ] ס44  , < <@4 < ,08408< ϡ4`4  `, < <4 < ,08408<   <``.! L $@ ,`< ,4@`] @,08408< @-6 4w  4`] @HQ,_ ] ϡ6 4w ] ס44  , < <@4 < ,08408< ӡ4`4  `, < <4 < ,08408<   <``.! L $@ ,`< ,4@`] @,08408< @-6 4w  4`] @,`]_\ 2`4  `, < <4 < ,08408< 24  , < <4 < ,08408< 24  , < <4 < ,08408< :s$ '  O@A@`ww ' _` 4 '`wǕ`] @@_ ( @_ 0t \ $  '_ (H16@(H@'׸ 7H5_\ @75 `] @ 76 O5_\ 0-p$6@'6$@`O'A@`wwww_Z @__ @`]_  @__ @@_ߐ _  @_  @ _  @ w`] @@_ 54_ @ _  @ $_  @ (_  @_ 0 (,0_ @ ' < A@`www 8@`]2_t`_  @`]#@_ @@w`@`]`_  @_@  @`_  @`w`] @@5@4 @`t \ 5@4_ @` _  @`$_  @`(_  @`( @`0t \ `(,0_ @A@`w'ww': 3 '_ۑ*@* 7@2 3 '˓5ˀ@H5@_52 @2`] @5ˀ@ O5* 7@〢@H_7@22 @: * : :@2 : *08208: H5@ 7@ 7@〢@ O5@'߱2 ww'_\ _`_@ˢ``tL$'`tL$'`tL$,`'Ӫ˰`^ ˡ44  , < <@4 < ,08408< ϡ44  , < <@4 < ,08408< ӡ4`4  `, < <4 < ,08408< <``.! L $@< ,0@`$_`0^ 67'4 @w_\ @_`@_`@_`0@@@_A@`www_\ _@_ 2 '``_ @@@2@ '`` (`'``_ 0`,0@@ (,0@ $/`` wǕ`] @@_ 64@@ A@`ww_\ @_`@'2`(,0`wϕ`] @@2 < 74 ww'_`< 'ߢ`@wס2@`'˺```-p@  _G_@ˁt@L$@'t@L$@'t@L$@,@'44 , < <@4 < ,08408< 44 , < <@4 < ,08408< 44 , < <@4 < ,08408< <``.! L $@< ,0'-8408< @!'4 %s:%d edge %d %d %d %d nexts %d %d %d first for vertice %d %d error remove edge %d dump graphbdzgirepository/cmph/bdz.cDestroying algorithm dependent data b: %u c: %f b: %u -- k: %u ranktablesize: %u Created hypergraph m (edges): %u n (vertices): %u r: %u c: %f Entering mapping step for mph creation of %u keys with graph sized %u linear hash function %u iterations remaining acyclic graph creation failure - %u iterations remaining Entering assigning step for mph creation of %u keys with graph sized %u Entering ranking step for mph creation of %u keys with graph sized %u Successfully generated minimal perfect hash Successfully generated minimal perfect hash function B:%u %u %u -- %u %u %u A:%u %u %u -- %u %u %u Dumping hash state with %u bytes to disk Loading bdz mphf Hash state has %u bytes Reading m and n  @?zG@?@ @ @ @ @@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/cmph/bdz.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/bdz.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.05+ girepository/cmphbdz.c DD%bdz.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodatabitmaskbitmask32valuemaskset_bits_valueget_bits_valueset_bits_at_posget_bits_at_pos.L49debugprintfdummyprintfbdz_alloc_queuebdz_free_queuebdz_alloc_graph3bdz_init_graph3bdz_free_graph3bdz_partial_free_graph3bdz_add_edge.L110.L111.L117bdz_dump_graph.L145bdz_remove_edgebdz_generate_queue.L194.L195.L203.L214.L236.L239.L240.L241.L242.L245.L249.L252.L255.L263.L266.L267.L270.L_cseg0.L_cseg1.L_cseg2bdz_mappingassigningranking.L292.L305.L_cseg3.L332.L339.L340.L341rank__dtouhash_vector_packedbdz_search_packedbdz_packed_sizehash_state_packed_sizehash_state_packhash_get_typebdz_packbdz_destroybdz_searchhash_state_loadfreadbdz_loadfwritehash_state_dump__cmph_dumpbdz_dumpcallochash_vectorhash_state_destroyhash_state_newfprintfceilbdz_newbdz_config_set_hashfuncsbdz_config_set_bbdz_config_destroy__assertbdz_config_newexitprintfmemsetbdz_lookup_tablefreevfprintfmemcpymallocstrlen__iob_GLOBAL_OFFSET_TABLE_  ,0;C0M Wf u,0@$dTp<< x'- 30 9<HP(N ^ pqxw}(0@H @PPH08xp $ |(%00+`1x 7=*\BI\/n.~--`H+x'< %%1DS[`hdx|P80  ff ddc8bHdXb`ede ta|`cL`ccc ^4^|`````ff $] , 0 d]   ] f f h l x] \ f f c ^      $ hl   x|  `@fDfTcl p x!|! Z^ff4"8" H`ff## ff11 22 $$ @3D3 TU\?%% U?& & D'H' X(\( ee )) T** SR+ + DeHe T,X, `Tee -- T4e8e D.H. XTlcc// (e,e 80<0 DT$Qxf|fc99 U?P$^8^77   8 < lp    04 ( , lp   D  H x | !p !t !! " " "" # 8#8 #`$(f$,f$h9$l9 $|U$?$P%(_%,_ %f%f%N%M%:&: &$L&@L&L`&dL&L&L&9&9 &U&?&L'L',L'HL'hL'f'f'c';'; (J(<(< (0c(HJ(XI(d`(l=(p= (J(J(J(9(9 (U)?)P)<J)XJ)tJ)J)P)J*f* f*_*_ +Q-p`-xR-`-`-`-f-f-E.D.C.Hb.x9.|9 .U.?.b.f.f/E/ C/49/89 /HU/P?/C/@66@ 12p6 "7'7-767b?>2K?AW@8e@N mDp ?uN h(0  /823 1334039512 0 0 100644 27108 ` ELF+e@@.shstrtab.text.rodata1.rodata.data.bss.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_infow''''J '2`'ߐ `'ې  _ߑ+pw:`- : "w-@ "5@ H`2*0w:`5 : "w5@ " w'''J '2`'ߪ `5@  _ߑ+0@:`2 5@ H 7@ 2*0@:`* 7@'2 w'''2`' `'   ; *@" _+pw7@:- : @"w-@ @"5@ H`2*0w:`5 : "w5@ " w''2`' `5@   :*@" _+0@:2@7 5@ H 7@ 2*0@:`* 7@'2 wwwwwA@`ww`]@@_@ @@h@@@_@@ @@`]!@@@@@wwwwww@w'@,0_t @w_@\ @w'',p,p@_t @,0_t @_t @w''_\ ,0@ _\ @ _$ @w_@\ _@\ _@\ @w_@\ _@\ _t t  w'''_`\`*0*0@"\`*0*0@" \`*0*0@" `]`.0\`*0*0@" ]`.p\`*0*0@" ]`+p \`*0*0@" `]`" ]`"]`"`Zw ` *`Zw ` *`Z w ` *`` $`0A@`ww'' 7@H)`]7@_\ 2@,p,p```@`]_\ 7@4,p,p` ``@7@ 7@ O 7@H`]7@_\ 2@,0@7@ 7@ O A@`ww' ' 6 H_] -p-p64,0@] -@?'ߡ7@H3?H07@'_\ 4@,p,p5H H 'H H' '_\ 7@4,p,p,0@ 7@H?O7@?H`]@_ 2`I@@?߀H_\ 7@4,p,p64,0@ 4,p,p,0@H$` _] 7@4,p,p64,0@ ] 54,0$@_\ 54@w `$ ,`6 6  OpA@`w''ww  '4 4@ w4 4 @  'HK_] ߥ,p,p']  ']  '] @ H  @ H @ H"_ߡ5 4 4`] @ <<@H_7@4@,0$`w `] @@-ߠ ' Oˣ7@H_ˡ,p'Ǡ`'__] ǥ,p,p']  ']  '] @ H&],@'_á5 4 4`] @ <<@H_7@4@,0$`w `] @@-_\ @ H&\-0@'_á5 4 4`] @ <<@H_7@4@,0$`w `] @@-_\ @ H&\-0@'_á5 4 4`] @ <<@H_7@4@,0$`w `] @@-ˣ7@Oa@_7@< < $@'< < 0A@`wߐ @h `]`]@ HH  @  @@$ t t w0A@`ww_\ `]@@ ww_Z _ G H7@H G & G OСA@`ww?w_\ `] HH`] ?`];T[_ \ '`\ wH`] @@` $ ` H`$` ,`@`$`````:`]#`]``` ;[ d_ H `]!`]``@`]G`@ w`_@_'H 6$ @_`w``]6_ H `]!`]@66 HHHO6 H=H]O_ H `]!`]``@_@ϐ@א!_ H `]!`]@@ǐ@ @_D "  @wע`\`r t``\`r t`` " `" ` " u %`]_ H `]!`]@@www '_\ _  _\ \` \` '_\  HMϪw_\ \`\`@_ _@Ϣ `tL$'`tL$'`tL$,`'_\ \`\`__ߠ '_\   O  __'ۀ  "H '< < A@`wwww_ '_ 4 4@ _ w`] @@'Ò @_t``4 4 @ ߠ$ '   H_,0@'_ ] ۥ,p,p']  ']  '`]_\ 2`4  `, < <4 < ,08408< 24  , < <4 < ,08408< 24  , < <4 < ,08408< jsס44@ 4`] @ <<@H~ӡ44@ ` 4`]  <<@H w ``] @-`ϡ44 ` 4`]  <<@H w ``] @-`_ ] ס6 4w ] ӡ44  , < <@4 < ,08408< ϡ4`4  `, < <4 < ,08408<   <``.! L $@ , < ,,08408< @-6 4w  4`] @H,ӡ64@4`] @ <<@Heϡ44@ ` 4`]  <<@H w ``] @-`_ ] ӡ6 4w ] ס44  , < <@4 < ,08408< ϡ4`4  `, < <4 < ,08408<   <``.! L $@ , < ,,08408< @-6 4w  4`] @HJ,_ ] ϡ6 4w ] ס44  , < <@4 < ,08408< 64 , < <@4 < ,08408<   <``.! L $@ , < ,,08408< @-6 4w  4`] @,`]_\ 2`4  `, < <4 < ,08408< 24  , < <4 < ,08408< 24  , < <4 < ,08408< s$ '  O:@A@`ww _ wǕ`] @@' @ 7_ H37u`'ר _]5`4  `, < <4 /ޡ.8408< ށu`L %@4`] @L.8408- `7 O_@\ _t`A@`wwww߬ _Z @__ @`]`_  @__ @@_ߐ _  @_  @ _  @ w`] @@_ 54_ @ ' < A@`www  @`]_t`_  @`]@_ @@@w`@@`]`_  @_@  @`_  @`w`] @@54 @`t \ 54_ @A@`www'_\ ]`_@Ӣ``tL$'`tL$'`tL$,`'ۦ`\Ӂt 4 @\ׁt 4 @\ہt 4 @Ӂt`L $@4,0`]@-84084 @ׁt`L $@4,0`]@/084084 @ہt`L $@4,0`]@/p84084 @ӡ-8408< /08408< @/p8408< @<``.! L $@< ,0''4 @w_\ @_`@_`@@@_A@`www_\ _@_ 2 '``_ @@@2@ '`` wǕ`] @@_ 64@@ A@`ww_\ @_``wϕ`] @@@274@ < 64 A@`www'_`< '`@wס2@w`'ˠ`w_G_@ˁt@L$@'t@L$@'t@L$@,@'_t 4 @t 4 @t 4 @t`L $@4,0`]@-84084 @t`L $@4,0`]@/084084 @t`L $@4,0`]@/p84084 @-8408< /08408< @/p8408< @<``.! L $@< ,0'4 %s:%d edge %d %d %d %d nexts %d %d %d first for vertice %d %d error remove edge %d dump graphbdz_phgirepository/cmph/bdz_ph.cDestroying algorithm dependent data c: %f Created hypergraph m (edges): %u n (vertices): %u r: %u c: %f Entering mapping step for mph creation of %u keys with graph sized %u linear hash function %u iterations remaining acyclic graph creation failure - %u iterations remaining Entering assigning step for mph creation of %u keys with graph sized %u Starting optimization step Successfully generated minimal perfect hash Successfully generated minimal perfect hash function B:%u %u %u -- %u %u %u A:%u %u %u -- %u %u %u Dumping hash state with %u bytes to disk Loading bdz_ph mphf Hash state has %u bytes Reading m and n  @?zG@@@ @ @ @ @? Q@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/cmph/bdz_ph.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/bdz_ph.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.08. girepository/cmphbdz_ph.c DD%bdz_ph.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodatabitmaskbitmask32valuemaskset_bits_valueget_bits_valueset_bits_at_posget_bits_at_pos.L49debugprintfdummyprintfpow3_tablelookup_tablebdz_ph_alloc_queuebdz_ph_free_queuebdz_ph_alloc_graph3bdz_ph_init_graph3bdz_ph_free_graph3bdz_ph_partial_free_graph3bdz_ph_add_edge.L110.L111.L117bdz_ph_dump_graph.L145bdz_ph_remove_edgebdz_ph_generate_queue.L194.L195.L203.L225.L228.L229.L232.L236.L239.L242.L250.L253.L254.L257.L_cseg0.L_cseg1.L_cseg2bdz_ph_mappingassigningbdz_ph_optimization.L279.L292.L_cseg3.L_cseg4.L311.L318.L319.L320__dtouhash_vector_packedbdz_ph_search_packedbdz_ph_packed_sizehash_state_packed_sizehash_state_packhash_get_typebdz_ph_packbdz_ph_destroybdz_ph_searchhash_state_loadfreadbdz_ph_loadfwritehash_state_dump__cmph_dumpbdz_ph_dumpcallochash_vectorhash_state_destroyhash_state_newfprintfceilbdz_ph_newbdz_ph_config_set_hashfuncsbdz_ph_config_destroy__assertbdz_ph_config_newexitprintfmemsetfreevfprintfmemcpymallocstrlen__iob_GLOBAL_OFFSET_TABLE_  /0>F0PZi x,0@$dTp<,<G xW] c0 i<{P(  tx (0H`x @P( H0x8 (2!HtFLR [(d0jp( vH|**)((@&(,2$X>EUa"dmthdP@ (/6= Ccc aa`8_HaX_`bdb t^|]`L]``` \4\|]]]]]cc $[ , 0 d[   [ c c h l x[ Z c c ` \      $ hl   x|  ]HcLc\`t"x" ## X\c c$$($ 8]cc0 0 81<1 L%P% 22 T>&& ,'0' lbpb |(( S)) RQ** bb (+,+ 4Sbb ,, Sb b -- $S8`T`.. bb // SP c$cX`x8|8 T>O\L6P6 ,0 pt    (, \`      07 47 !]!Pc!Tc!|9!9 !T!>!O"\"` "]"c"c#M#L# :#$: #HK#dK#p]#K#K#K#9#9 #T#>$K$`c$dc$`$;$; $I$<$< $`$I% H%]% =%$= %DI%`I%|I%9%9 %T%>%O%I&0c&4c&`P'' '' (( (](Q(](])0c)4c)TD)pC)xB)9)9 )T)>)_*c*c*,D*H9*L9 *\T*d>*pB*c*c*B+$?,4,8 ,|, ,, 66@ -`.8Y1"2L(7Q-7Q67Qb?=K?~DW?e?YmD8 ` >uM e0  /844 1334039512 0 0 100644 28740 ` ELF+l@@@.shstrtab.text.rodata1.rodata.bss.data.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_infow''''J '2`'ߐ `'ې  _ߑ+pw:`- : "w-@ "5@ H`2*0w:`5 : "w5@ " w'''J '2`'ߪ `5@  _ߑ+0@:`2 5@ H 7@ 2*0@:`* 7@'2 w'''2`' `'   ; *@" _+pw7@:- : @"w-@ @"5@ H`2*0w:`5 : "w5@ " w''2`' `5@   :*@" _+0@:2@7 5@ H 7@ 2*0@:`* 7@'2 wwwwwA@`ww`]@@_@ @@h@@@_@@ @@`]!@@@@@wwwwww0A@`wߺ (@h `]`]@ HH  @  (@@$ $ t t t w0A@`ww_\ `]@@ ww_Z _ G H7@H G 2*0& G OСA@`ww?wwנ 'w /w_\ `] HH`] ?`];Z[_ \ '`\ w@H@` $``]``;@[` `@w``]6 @w`  6 H _` 64@,0t`6  O ' ' d_ H `]!`]`` @`] G`` @_` t `]G`` @_` t `]@E_'H(5$ _` @\ ` \`t \`@\ _` t `]ۓ5_ H `]!`]@55 HHHO5 H@_`Hw_ H `]!`]@@_`_ H`]!`]@`]!`]@`]` 40@ w` 40 @ `40@ w`40 @ @_``  @`t \ h `]`]@ H H' ' 6` H?_`@6*08408H0_65 4 @ 4`] @ <<@H`] H _@@@H /_@@@/H 6 6`  OH_ H `]!`]@__@@Hˠ$ '_ H `]!`]@@_@_Hˀ O@_`w`ˀ HH3w @w_D "  @wע`\`r t`` \`r t`` " `" _t`$``]_ H `]!`]@_w_㾰A@`wow'wwww_@\ @ w`]_ wgg`] @@" _\ -p$_ϡ5`4w `4`] @,_ 4 4wgg@@'_@@_*08408H5@_'_\ w@tD$D$D"`D"`_@\ 'À?H_\ @*08408H_á4`4  `4`] @ <<@H /Hs_  '_\ æw@tD$D$D"`D"` /_@\ '?HI_\ @*08408H6_5 4  4`] @ <<@H%_]`5,0@` H@_ H/_ס5 4  4`] @ <<@H H /_\ @'?O_H$O_\ æw@tD$D$D"`D"`_@\ '?HH_\ @*08408H5_5 4  4`] @ <<@H$__ ]`5,0@4 4w ]` 4`] @- ]`_H$_\ @'?O_\ å*p$_ϡ2`4w `4`] @,@__\ @'À?O@_*08408O@_ /α4 㾠A@`wWw'wwwww ' '_@\ 2wOO`] @H@ w`]_ wOO`] @@" _\ -p$_ϡ5`4w `4`] @,_ 4 4wOO@@'_@@_*08408Hy@_'_\ _@tD$D$D"`D"`_@\ 'À?HV_\ @*08408HC_á4`4  `4`] @ <<@H2 '{ /H{H _4,0@'{ H'{_  'Ǡ?'{_\ æ_@tsD$D$D"`D"` /_@\ '?HK_\ @*08408H8_5 4  4`] @ <<@H'_]`5,0@` H @_@_ H/_ס5 4  4`] @ <<@H H /_\ @'?OH_ HH _d4@,0w$'_,p$`'_H$O`{$ '{{H $ '_,0@{,0$@_\ æ_@tsD$D$D"`D"`_@\ '?HH_\ @*08408H5_5 4  4`] @ <<@H$__ ]`5,0@4 4wg ]` 4`] @- ]`_H$_\ @'?O_\ å*p$_ϡ2`4wg `4`] @,@__\ @'À?O@_*08408O@_@_ /α4  A@`www'_  H `]`]@!eH H' '_5 4  4`] @ <<@H H'HO74 A@`www'ww_\ @tD$D$D"`D"` _@\ 5?HE_ף54`4  `4`] @ <<@H+___ _"_Z ,0@$54,0$@_ס54 4w 5 4`] @, "_5_\ @Ϭ5?OA@`wwww '`]h 7@_ Hy_\ 7@@ '_\ 7@@ '_ߡ44  4`] @ <<@Hۡ4`4  `4`] @ <<@H#_ߡ44  4`] @ <<@Hۡ4`4  `4`] @ <<@HH!_ߡ5 4 @ 4`] @ <<@H __ה@H__ۖ @7@ 7@_  O 7@_ H._7@54 ` 4`]  <<@H_Z 5,0$w ``] @-`_ה٘7@ 7@_  OA@`ww_\  `] @_ _\ \` \` 5_\  Hw_\ \`\`ϔן_ \ _@ rL"_ \ _@ `rL"66H  6` H 66H_ H `]!`]@5_\ \`\`_ן H<'_\ \`\`_ן_ 6@6_ H-p8408H `]!`]@-p8408H H'_ 6@65 5_\   O}-p8408`?'G< A@`wwwwߠ '_Z @__  @_ \ @`]_  @__ @@__ \ @`]_  @__ @@_ߐ _  @_  @_  ,0_ @ ' < A@`www @`]z_t`_  @ 4@,0`t \ ,0t@`]` 6뀤H-w_  @`]K@_ @@@w_`64,0t@@@6 6뀤 O`]*`_  @_@  @`@,0`t \ `,0_ @ A@`www'_\ _ \ _@ rL"_ \ _@ rL"`]_5֗7@57@H  7@ H `]__ 54,0@7@4,0@ _ 54,0@7@4,0@'4 @w_\ @_`_`@\ _`@\ @_`@@@_ ww_\ __ @\ 2 '``_ \ @@@2@_ @\ 2 '``_ \ @@@2@ `'``_ `,0@@0w_\ _`@\ _`@\ @2@2@`,0@ < 64 ww'_w`< 'ۢ`@wߡ2@w`< 'ˢ`@wϡ2@w``w_G_@rL"_G_@5rL"77@H 7@H _74,0@7@4,0@'4 %s:%d bmzgirepository/cmph/bmz.cDestroying algorithm dependent data c: %f m (edges): %u n (vertices): %u c: %f Created graph Entering mapping step for mph creation of %u keys with graph sized %u hash function 1 hash function 2 Generating edges %u iterations remaining simple graph creation failure - %u iterations remaining Starting ordering step Starting Searching step. Traversing critical vertices. Searching step bmz->g Traversing non critical vertices. Restarting mapping step. %u iterations remaining. Successfully generated minimal perfect hash Successfully generated minimal perfect hash function Labelling critical vertices unused_edge_index < bmz->mLabelling non critical vertices Generating edges for %u vertices Self loop for key %u A non simple graph was generated Dumping hash state with %u bytes to disk Loading bmz mphf Reading %u hashes Hash state has %u bytes Reading m and n key: %s h1: %u h2: %u key: %s g[h1]: %u g[h2]: %u edges: %u  @?ffffff?=p =@? @ @ @ @?@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/cmph/bmz.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/bmz.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.05+ girepository/cmphbmz.c DD%bmz.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodatabitmaskbitmask32valuemaskset_bits_valueget_bits_valueset_bits_at_posget_bits_at_pos.L49debugprintfdummyprintf.L67.L68.L76.L98.L99.L100.L111.L115.L116.L117.L120.L123.L131.L134.L135.L136.L140.L159.L163.L169.L172.L_cseg0.L_cseg1bmz_gen_edges.L_cseg2bmz_traverse_critical_nodesbmz_traverse_critical_nodes_heuristicbmz_traverse_non_critical_nodes.L179.L_cseg3.L_cseg4.L292next_unused_edgebmz_traverse.L316.L345.L358.L362.L375.L382.L383.L388.L390.L397.L401__dtouhash_packedbmz_search_packedbmz_packed_sizehash_state_packed_sizehash_state_packhash_get_typebmz_packbmz_destroybmz_searchhash_state_loadfreadbmz_loadhash_state_dumpfwrite__cmph_dumpbmz_dumpgraph_add_edgegraph_contains_edgehashgraph_clear_edgesgraph_vertex_idreallocvqueue_destroygraph_next_neighborgraph_neighbors_itvqueue_removevqueue_is_emptyvqueue_insertfloorgraph_ncritical_nodesvqueue_newgraph_node_is_criticalcallocgraph_obtain_critical_nodesgraph_destroyhash_state_destroyhash_state_newfprintfgraph_newceilbmz_newbmz_config_set_hashfuncsbmz_config_destroymemset__assertbmz_config_newfreevfprintfmemcpymallocstrlen__iob_GLOBAL_OFFSET_TABLE_  ,0;C0MWf u,((PX(H @@   (8P0%8+4="KT0,px   ( ( (H`( 0 "( .8'4;G,@Y+xpi**(X(d&$ ,1CS[j~,?NV`e\m0lP tt rrq8pHrXp`sds to|nttq04 <@ Hlpktt ntt''  ($( 48 |g? f qTsXs dh xe d d c (c 8 < `s ds p t |e b s s   e a s $s 0 4 <e Ds Hs T  X `e h! l! q k q k n ` " "   l T_   * * hs ls x# |# e s s $ $ e n n b Dq `q % % s s & & e8t<td]l^x.|. // g? 0\8?L[TZpYXW_$( XW_$( xV W8XpW_ DH W [W Z<Vtt]00 ?^.. $/(/ 8g@? \?[ZYXHWp_ PXW_ DVLnx| WUXW,_dh  Wpt [WZVnttL1P1 X\ dl  t$tTXW dh Wtt44 @TXT    D H   !L!P !! "t" t"(5",5 "@S"R"R#ps#ts #6#6 #e#Q$s$ s $,7$07 $8e$hP$t$t%N%M%4L%<8%@8 %dM%M%n%L%8%8 %M%M%n&M&,M&LM&t&t&q&9&9 &J'q' :'$: 'hJ't;'x; 'q'J'I'n'<(< ( J(<J(Lq(pJ(t(t(R)R)D=)H= )>)> *8n*Dc*Pc*Xn*`n*hn*E*D*C*E+D+C+Dp+E+E+C+C,(C,LC,|@,@66@ -@._2x"3,'3,-3,63,b?9K;SAW;e;m@ ?uK p l0  /862 1334039512 0 0 100644 29324 ` ELF+n@@.shstrtab.text.rodata1.rodata.bss.data.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_infow''''J '2`'ߐ `'ې  _ߑ+pw:`- : "w-@ "5@ H`2*0w:`5 : "w5@ " w'''J '2`'ߪ `5@  _ߑ+0@:`2 5@ H 7@ 2*0@:`* 7@'2 w'''2`' `'   ; *@" _+pw7@:- : @"w-@ @"5@ H`2*0w:`5 : "w5@ " w''2`' `5@   :*@" _+0@:2@7 5@ H 7@ 2*0@:`* 7@'2 wwwwwA@`ww`]@@_@ @@h@@@_@@ @@`]!@@@@@wwwwww0A@`wߐ (@h `]`]@ HH  @  (@@$ $ t t t w0A@`ww_\ `]@@ ww_Z _ G H/p828: H G 2*0& G OA@`ww?wwנ /wǠ /w_\` \` ! H`H `]!`]@Hw`] HH`] ?`];F[_ \ < /`\ w@H@'G` ,``]` `;*[` @`w``]! @w`  .8408< H_` .84p84@,0t`.8408< O / / d_ H `]!`]`@` `]G`@` _` t `]G`@` _` t `]@N_'H/-8408$ _` @\ ` \`t \`@\ _` t `]-8408< _ H `]!`]-8408@< -8408< HHHO-8408< H@_`Hw_ H `]!`]@@_`_ H`]!`]@`]!`]@`]o` 40@ w` 40 @ `40@ w`40 @ @_``  @`t \ h `]`]@ H H' ' .8408< ` HE_`.8408@< *08408H1_.8408< = < @ <`] @ <H`] H _ǐ@@@H /Ɣ_ǐ@@@/ƀH .8408 .8408< ` OƀH_ H `]!`]@__@@HԠ$ /_ H `]!`]@@_@_ƀHԀ O@_`w`Ԁ HH3w @w_D "  @wע`\`r t`` \`r t`` * ` * _t` $``]_ H `]!`]@_w_A@`www'wwww_@\ @w`]e_ woo`] @`] HH'oGo_\ ,_ϡ5`4w `4`] @,_ <` @< 'oo@@'oGo/_@@_*08408H1@_'_\ @tD$D$D"`D"`_@\ 'ǀ?H_\ @*08408H_ǡ4`4  `4`] @ <<@H /€Hq_  /_\ Ǧ@tD$D$D"`D"` /_@\ 'À?HG_\ @*08408H4_á5 4  4`] @ <<@H#_]`5 @ `H@_ H/_ס= <  <`] @ <H H /_\ @'À?O_ @H- €O_\ Ǧ@tD$D$D"`D"`_@\ 'À?HG_\ @*08408H4_á5 4  4`] @ <<@H#__ ]`5 @< < w ]`  < `] @- ]` _ H,_\ @'À?O_\ , _ϡ2`4w `4`] @,@__\ @'ǀ?O@_*08408O@_ /α4 㾠A@`w_w'wwwww / /_@\ @w`]_ wWW`] @`] HH'WGW_\ ,_ϡ5`4w `4`] @,_ <` @< 'WW@@'WGW/_@@_*08408Hm@_'_\ g@tD$D$D"`D"`_@\ 'ǀ?HJ_\ @*08408H7_ǡ4`4  `4`] @ <<@H& / /€HH _4 @/ H/_  /͠ /_\ Ǧg@t{D$D$D"`D"` /_@\ 'À?HI_\ @*08408H6_á5 4  4`] @ <<@H%_]`5 @ `H @_@_ H/_ס= <  <`] @ <H H /_\ @'À?O€H_ HH_d@< w_, /_ @H- €Oh$ /H $ /_ @,@_\ Ǧg@t{D$D$D"`D"`_@\ 'À?HG_\ @*08408H4_á5 4  4`] @ <<@H#__ ]`5 @< < wo ]`  < `] @- ]` _ H,_\ @'À?O_\ , _ϡ2`4wo `4`] @,@__\ @'ǀ?O@_*08408O@_@_ /α4  A@`www'_  H `]`]@!rH H' '_5 4  4`] @ <<@H H'HO/084084 A@`www'ww_\ @tD$D$D"`D"` _@\ 5?HB_ף54`4  `4`] @ <<@H(___ _* _Z  @$54,@_ס54 4w 5 4`] @,  *_5_\ @Ϭ5?O A@`wwww /`]R /p8408< _ H{_\ /p8408< @ /_\ /p8408< @ /_<<  <`] @ <H<`<  `<`] @ <H!_<<  <`] @ <H<`<  `<`] @ <HH _= < @ <`] @ <H __@H__ @/p8408 /p8408< _ O /p8408< _ H2_/p8508= > < @  <`] @ <H _Z 5,@w `] @@-_Ԙ@/p8408 /p8408< _ O A@`ww_\  `] @_ _\ \` \` .8408< _\  Hw_\ \`\`הߟ_ \ _@ rL"_ \ _@ rL"-8408< .8408< H  .8408< H -8408< .8408< H_ H `]!`].8408@< _\ \`\`_ߟ HI'_\ \`\`_ߟ_ -8408< .8408@< _ H-p8408H `]!`]@-p8408H H'_ -8408< .8408@< .8408 .8408< _\   Of-p8408`?'G'G< A@`wwwwߠ /_Z @__  @_ \ @`]_  @__ @@__ \ @`]_  @__ @@_ߐ _  @_  @_  _ @ ' < A@`www @`]@_t`_  @ < @,0`t \ ,0t@`]' .8408< H1w_  @`]@_ @@@w_`.84084,0t@@@.8408 .8408< O`]`_  @_@  @@``t \ `_ @ A@`www'_\ _ \ _@ rL"_ \ _@ rL"`]_-8408< /p8408< -8408< /p8408< H  /p8408<  H `]__ -84084 @/p84084 @u _ -84084 @/p84084 @/4 @w_\ @_`_`@\ _`@\ @_`@@@_ ww_\ __ @\ 2 '``_ \ @@@2@_ @\ 2 '``_ \ @@@2@  `/``_  `@@0w_\ _`@\ _`@\ @2@2@`@ < 64 A@`www'_w`< 'ۢ`@wߡ2@w`< 'ˢ`@wϡ2@w ``w_G_@-8408< rL"_G_@-8408< rL"`]_/08408< /p8408< /08408< /p8408< H  /p8408< -8408< H _/084084 @/p84084 @/4 %s:%d bmz8girepository/cmph/bmz8.cDestroying algorithm dependent data The number of keys in BMZ8 must be lower than 256. c: %f m (edges): %u n (vertices): %u c: %f Created graph Entering mapping step for mph creation of %u keys with graph sized %u hash function 1 hash function 2 Generating edges %u iterations remaining simple graph creation failure - %u iterations remaining Starting ordering step Starting Searching step. Traversing critical vertices. Searching step bmz8->g Traversing non critical vertices. Restarting mapping step. %u iterations remaining. Successfully generated minimal perfect hash Successfully generated minimal perfect hash function Labelling critical vertices unused_edge_index < bmz8->mLabelling non critical vertices Generating edges for %u vertices Self loop for key %u A non simple graph was generated Dumping hash state with %u bytes to disk Loading bmz8 mphf Reading %u hashes Hash state has %u bytes Reading m and n key: %s h1: %u h2: %u key: %s g[h1]: %u g[h2]: %u edges: %u  @?ffffff?=p =@ @ @ @ @?@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/cmph/bmz8.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/bmz8.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.06, girepository/cmphbmz8.c DD%bmz8.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodatabitmaskbitmask32valuemaskset_bits_valueget_bits_valueset_bits_at_posget_bits_at_pos.L49debugprintfdummyprintf.L67.L68.L76.L100.L103.L104.L105.L116.L120.L121.L122.L125.L128.L136.L139.L140.L141.L145.L164.L168.L174.L177.L_cseg0.L_cseg1bmz8_gen_edges.L_cseg2bmz8_traverse_critical_nodesbmz8_traverse_critical_nodes_heuristicbmz8_traverse_non_critical_nodes.L184.L_cseg3.L_cseg4.L297next_unused_edgebmz8_traverse.L321.L350.L363.L367.L380.L387.L388.L393.L395.L402.L406hash_packedbmz8_search_packedbmz8_packed_sizehash_state_packed_sizehash_state_packhash_get_typebmz8_packbmz8_destroybmz8_searchhash_state_loadfreadbmz8_loadhash_state_dumpfwrite__cmph_dumpbmz8_dumpgraph_add_edgegraph_contains_edgehashgraph_clear_edgesgraph_vertex_idreallocvqueue_destroygraph_next_neighborgraph_neighbors_itvqueue_removevqueue_is_emptyvqueue_insertfloorgraph_ncritical_nodesvqueue_newgraph_node_is_criticalcallocgraph_obtain_critical_nodesgraph_destroyhash_state_destroyhash_state_newgraph_newceilfprintfbmz8_newbmz8_config_set_hashfuncsbmz8_config_destroymemset__assertbmz8_config_newfreevfprintfmemcpymallocstrlen__iob_GLOBAL_OFFSET_TABLE_  -0<D0NXg v, 0(X8(H0H` @   (0("X8(0.84=F" U^4{@04  ( px8(`( (0$*( 0H6`<x'BN-a,lr++8X)'p %&:?Qaix ,:M\fks|(tP tt rrq8pHrXp`sds to|nttq,0 8< Dllktt ntt$s(s 48 @gT(X( p)t)  f e $ 8qss  g d   $d 4 8 pc c   s s   g <b `s ds p t |g a s s  g s s ! ! g " " q k ,q Dk Ln \` |# #   l _ $ ( L+ P+ s s $ $ $g ds hs t% x% g n n b q qL&P& tsxs '' gtt]^// 80<0 LfT1X1  \[Z Y<XtW_ 4XtW_ $VPT WXW@_x|  ,W| [WZV t$t`]h^t/x/ 00 f11   @\`[hZYXW_8< XWD_| Vn 8WU4XlW_ <@ W [WZ0V8nxt|t22  l ttXW(,  W8t<t\5`5 TT , 0 l p     !! "" "t"t"6"6 "S#8R#pR$s$ s $,7$07 $@g$Q$s$s $8$8 $g%<P%t%t%N&M&L&$9&(9 &LM&hM&tn&L&9&9 &M&M&n&M'M'0M'xt'|t'q':': 'J'q(;( ; (TJ(`<(d< (|q(J(I(n(=(= )J)8J)Dq)dJ)t)t)R* R*4>*8> *?*? +Hn+Tc+`c+hn+pn+xn+E+D+C,E, D,(C,Pp,E,E,C,C-t-t-DC-hC-@-@.>. > 66@ ./48"4'4-464b?;NK=BW=We=m mBx @uMp nX0  /881 1334039512 0 0 100644 35916 ` ELF+H@@.shstrtab.text.rodata1.rodata.bss.data.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_infow''''J '2`'ߐ `'ې  _ߑ+pw:`- : "w-@ "5@ H`2*0w:`5 : "w5@ " w'''J '2`'ߪ `5@  _ߑ+0@:`2 5@ H 7@ 2*0@:`* 7@'2 w'''2`' `'   ; *@" _+pw7@:- : @"w-@ @"5@ H`2*0w:`5 : "w5@ " w''2`' `5@   :*@" _+0@:2@7 5@ H 7@ 2*0@:`* 7@'2 wwwwwA@`ww`]@@_@ @@h@@@_@@ @@`]!@@@@@wwwwww0A@`wߺ p@ "  * 8" " " r r (r 0r @r Hr P!" X  @``t w`h\ `]@@h `]`]@ .HH  @w0A@`ww_\ @_```]@@ ww_Z _ G H7@H G 2*0& G O0w'_Z  H* '`X A@`www_\ _h*@@_ `_$`  /H` @ `t \ `]@_` @ `t \ `]@_ A@`www_\ _`ht \ h `]`]@ fH  0w'_Z  @H H ': / 80w'G H H_Z G' A@`ww?ww׶ `];[_H8\ `] HH `] H`] ?H+`] H`] ?H`]`]@ H H'à 'H G` O OO?`_\  `$``]`Y`w`8w@@`<$``]`D`< @w` _ H `]!`]@`],G``<@w`P`]"@_'ÀH 6$ @_`Pw`P`]6_ H `]!`]@66 HHHO6 H `]@_` Hkw`]`< @w`( '`<H_` Ӡ%4 < _`(-0@-%@'`< O @w_D "  H@wע`0\`r t``@\`r 0t``H\`r 8t``P\`r @t`` \`r t``(\`r t``<" (`: ` " G` " _t` $``]_ H `]!`]@_w_pA@`w/w_\   '`X@w`< @wwww 'wwww 'w wg_\ \` \``]`L '`HC_\ \`\`{6{@4 `Xh_ H `]!`]@_`'c '_ '[$` 7`<H_ǡ74,0@ H _c@'_'c_$7 7`< O ג @w 7׀H4[_ϡ64@@ @_`P_ϡ64@ [@`<rL"'6__,0@`,0$wO` $`[ 7 7׀ O@_``  @w`]_``@_`]@w@_w 7׀H#[__74,0@ @__74,0@[ _ @w7 7׀ O '׶ _`<,0@  '@_@__ϡ64@{ @_ϡ64@ _{@6{ @_`P_{@@<rL"' ] @ ` HD H!`] H `w''HH''G',08408< ] H @_@_Ǡ H'_` @ ` ,`_ǡ,@w_` $`נ '_\ \`\`_{ '` O6 H_ H `]!`]@_`'c '_ '[$` 7`<H_ǡ74,0@ H _c@'_'c_$7 7`< O ג @w 7׀H4[_ϡ64@@ @_`P_ϡ64@ [@`<rL"'6__,0@`,0$wO` $`[ 7 7׀ O@_``  @w`]_``@_`]@w@_w 7׀H#[__74,0@ @__74,0@[ _ @w7 7׀ O '׶ _`<,0@  '@_@_@_@_$H H'_ H `]!`]@`]\ `]@\  _`h@ @w`_`h  @w`_`h  @w` _`h  @w`<_`h  @w_` `<_`h @w`X@w @w @w  7H;{@_``  @w`]_``@7_7@_@_w_7@w_`P {@@`<rL"'_75@,p$__,puw`7 O '  @wg  '`HV_@m_72@,0'w_@{whgh0_`P_ {@`<rL"'_75@,0H__g.84084,0t@.8408 w '_{@@wo_h3.8408< _` w @H `]`]@!H H'c 'c_74-p]_g.84084,0t@.8408 u '_-p$@_u_h2.8408< _` w @H `]`]@!H H'c 'c_74-]`_g.84084,0t@.8408 u` '?4 _-$@.8408< _` w @Hw_wWwOwG 'C_g.8408@< @w_wW@G` _W@`@_WwOh _ H`]!`]w `<@ '@_W_g.8408@< @__Hj_ HwtcL#$@ H `]!`]``<@H)w7_O\ w7_7wC@@H'wGw7_O\ w7_7wC@@HwG`]`]@!H H'? '?H G` O OO_GC_`h @w@_GwG@_W_g.8408@Q< @_O@__ ` O@_@_g@_@_瀤H H' 'G< 0w'  7@@H_7@2*0@72*0@H7@ 7@@ O752 @w' /p8408< H_/p84084,0@\@_/p84p84@,0t`/p8408<  Oww'w߬  'Ϡ 'ww_`\`0@_\ 8@ˢ@@ _$  @ϔ @`_@Ϡ@ ˔ @Ϡ@ _@ 5HϢ@ˢ@54@ _\ (,@ @5 55@ O@_@_@wװww'wߠ 'Ӡ 'ww_ \  @w@H@_\ \ @_\ \ @Ϣ@5@@ _$  @Ӕ @`_@Ӡ@ ϔ @Ӡ@ _@Ӣ@Ϡ@ _\ 5@@4@_@_@wװA@`www_\ w`]_ @@`]_  @__ @@_א _  @_  (,0_ @ ' < A@`www H@`]_t``_  @_@  @`(_  @`(@`t \ `(_ @`(@,0w`0`(@,0w`8`( @w` `]``(G`;w[ 6`(H_  @`]d@_ @@_`064,0t@@_  @`]C@_ @@_`864,0t@@H*`_`64@ @H+'`_`64 @w@H@'H`]`]@"pH H'à 'H G` O OO`]ϒ @` \64,0t@\\_ @6 6`( On_  @`]@_ @@w`@@`_  @`(@,0`t \ `(,0_ @A@`www'w_\ @_@__ _ (tL$] 54 @' w@H@'_\ 054,0\@_@ρrL"'_\ 854,0\@_@ρrL"'ǀH  'ǀ H '_\ 53,0\  /`]4_`]__]` 54-0\ @ @]`-0@` `]_\ 54,0@_\ 54,0@'۱4 ww'w_\ @_@__ _ (tL$']  @ @7@'@7@?@?_\ 0ס,0\@_@rL"'_\ 8ס,0\@_@rL"' /@'_]` ס-\ @t@L$@/]`-@'۱4 A@`www'_H!\ _@H$_֐@H`]`]@"H H'Ϡ 'H G` O OO 74 0w_\ @\` h' 7`(H_` 74,0@\@_`074,0@\@_`874,0@\@7 7`( O@_` @_`0@_`8@_`@@_`@_`@@@_A@`www_\ _@ @ @_`@'ӒӐ @ _`@@@Gӡ2`( @ @`w  _`0@\ 'ϒϐ @ _`8@\ '˒ː @ _``(@`(`_``,0@`(`,0w`,0 6`Ha_$  w_`064,0\@@@Gϡ2_`864,0\@@@Gˡ2H*`_`64@ @H+`_`64 @w@H@H`]`]@#$H H' 'H G` O OO_` 64,0\@5@4@5@46 6`( OA@`ww _\ @_`@'_`0@\ _`8@\ @Gۧ2`( ,p < 7 , @7@@`(J@7@`(`J  6`H?H*`_`64@ @H+`_`64 @w@H@H`]`]@#QH H'ˠ 'H G` O OO76@6 6`( O7'4 㾠A@`w_ww'w_`< 'ע`w@wϡ2@w`'˦`w\wW`]`W``] H`[ʑHH?w`'`w`'`wwˢ@ww,@w_G_@__ ˁt@L$@_54 @'wWW@H@'_w54,0@4w@G2@w@G2@ww_G_@rL"'s_G_@rL"s5@H 5@ H _ws 5@2 /n`]_&5`]n_54,0@n_54,0@'۱4 㾐A@`wOww'w_`< 'ע`w@wϡ2@w`'˦`w\wG`]`G``] H`KʑHH?w`'`w`'`wwˢ@ww,@w_G_@__ ˁt@L$@_5@4 @@5'@5?@?_w5@4,0@4ww@G2@wo@G2@wg_wG_@rL"'c_oG_@rL"'_ /^c@'c__gc @t@L$@/^^_5@4,0@'۱4 A@`www'_`'H!`_;@H#_p@H`]`]@#H H'ˠ 'H Gۀ O OO5@4 %s:%d /var/tmp/brzgirepository/cmph/brz.cDestroying algorithm dependent data %s/%sbrz->mphf_fdc: %f 0m: %u k: %u Partioning the set of keys. hash function 3 Generating graphs %u iterations remaining to create the graphs in a external file Failure: A graph with more than 255 keys was created - %u iterations remaining Graphs with more than 255 keys were created in all 20 iterations Graphs generated Successfully generated minimal perfect hash Successfully generated minimal perfect hash function Generating graphs from %u keys Flushing %u %s%u.cmphwb MPHF generation nkeys_vd < brz->size[cur_bucket]ERROR: Can't generate MPHF for bucket %u out of %u MPHF for bucket %u out of %u was generated. Dumping brzf Dumping hash state with %u bytes to disk Loading brz mphf Reading c = %f k = %u algo = %u Hash state 1 has %u bytes Hash state 2 has %u bytes g_i has %u bytes Hash state has %u bytes key: %s h1: %u h2: %u h0: %u key: %s g[h1]: %u g[h2]: %u offset[h0]: %u edges: %u Address: %u @?@ @ @ @ @ @?C0A@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/cmph/brz.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/brz.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.05+ girepository/cmphbrz.c DD%brz.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodatabitmaskbitmask32valuemaskset_bits_valueget_bits_valueset_bits_at_posget_bits_at_pos.L49debugprintfdummyprintf.L64.L68.L69.L77.L109.L111.L121.L149.L163.L166.L167.L170.L174.L175.L178.L181.L187.L188.L194.L197.L_cseg0.L_cseg1.L_cseg2.L_cseg3brz_gen_mphf.L204.L213.L226.L227.L265.L289.L303.L308brz_min_indexbrz_destroy_keys_vdbrz_copy_partial_fch_mphfbrz_copy_partial_bmz8_mphf.L368.L369.L376.L377.L382.L383.L393.L395.L405.L406.L407brz_bmz8_searchbrz_fch_searchbrz_bmz8_search_packedbrz_fch_search_packed.L_cseg4.L_cseg5__dtoul__dtoubrz_search_packedhash_packedhash_vector_packedbrz_packed_sizehash_state_packed_sizehash_state_packhash_get_typebrz_packbrz_destroybrz_searchmixh10h11h12fch_calc_p2fch_calc_p1hash_vectorfch_calc_bhash_state_loadfreadbrz_loadbrz_dumphash_state_dumpbuffer_manager_destroycmph_destroycmph_io_byte_vector_adapter_destroycmph_config_destroycmph_newcmph_config_set_graphsizecmph_config_set_algocmph_config_newcmph_io_byte_vector_adapterbuffer_manager_read_keybuffer_manager_openbuffer_manager_newfclosememsetfwritefopenhashcmph_nameshash_state_destroyhash_state_newfprintfceilbrz_newbrz_config_set_algobrz_config_set_bbrz_config_set_mphf_fdsprintfbrz_config_set_tmp_dirbrz_config_set_memory_availabilitybrz_config_set_hashfuncsbrz_config_destroy__assertstrcpycallocbrz_config_newfreevfprintfmemcpymallocstrlen__iob_GLOBAL_OFFSET_TABLE_  , ; C(MWf u, 8(`hp H8PH0 8&/8AJ8WP ]pciou({80  !h#x@P0(   8 X8  *0l0,?5V8lu~;h30 /.#0<HT_ou%h~$+;Wo  pH  TX4<`S<vlX  8HX`d t|h ~  }4<@ Phl x  (x`d  }     (& ,& D' H' `( d( ' ' ) )     } < @ xs I       r   q   Pp \  `  ! ! r " "  # #   T$X$ | %% rp+t+   ,, r,n-- x.. mTlkj(Ln((   ,, rn-- x.. m$Xlkj  // r o$o 0o4o <TlpllllliHXd-h- txhgn8gnXg00  }x0|0  }\fdepd|cb 11 ra`TX d2h2 xr  }Xldpa_`^!!]!]!!"","H"""#Xs#`I#|]#]###$$ $H$P$X$$$7$7 $]$8$8 %l%,l%8%Pl%pl%%%%9%9 &Z&,Z&HZ&X&xZ&&&&:&: 'Z';'; ','DZ'TY'p'Z'<'< ''Z'Y'(X(Ds(LI(`(d (l(p (x}(=(= ()Z)TZ)`>)d> )|)Z)Y))Z))Z*8*<*hW*s*I*n+Dn+?+? +@+@ ,8A,<A ,W-$X-0V-@U-hn-n-T.... .. /}//p/p0 0(0008p0@0H0P0X0000P00O0N11$H18P1P1`P1x112O2N2<O2DN2hX2s2I22 22 2}38333P3P3P3N4N40N4|X4s4I44 44 4}555N5F5F 6G6G 6L6s6I7 N74N7XK7K8?8 ? 8 A8$A 888N9F9F 9 G9$G 9L9X9V:U:0N:DN:hK:K:T;p;t;; ;; ;}66@ 4 girepository/cmphbuffer_entry.c DD%buffer_entry.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L20.L21.L29buffer_entry_loadfclosebuffer_entry_destroymemcpybuffer_entry_read_keyfreadcallocfreebuffer_entry_get_capacitybuffer_entry_set_capacityfopenbuffer_entry_open__assertmallocbuffer_entry_new_GLOBAL_OFFSET_TABLE_  $5DI(N8SelTh H(P  $8PT \ ` h  P4 66@ ;%-6? K JW e 3m  up 0  /926 1334039512 0 0 100644 5652 ` ELF+@@.shstrtab.text.rodata1.bss.data.rodata.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info A@`w'' (@h `]`]@ H H'۠ ''` @w` @w`?'` `$```t  7`H@5_`74@,0t`7` O@w0w'w_\ ,0\@@_w'ww_ D` HwD`%`$`\,0@\@_\-p@\,0\@@5_\ ,0\@@_w׀h_ D` $`\,0@\@_\ =,0$@_w߰@w 7_ H_\ 74,0@\@7 7_  O_@\ _@\ @_buff_managergirepository/cmph/buffer_manager.c@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/cmph/buffer_manager.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/buffer_manager.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0@6 girepository/cmphbuffer_manager.c DD%buffer_manager.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L20.L21freebuffer_entry_destroybuffer_manager_destroybuffer_entry_read_keybuffer_entry_set_capacitybuffer_entry_get_capacitybuffer_manager_read_keybuffer_entry_openbuffer_manager_openbuffer_entry_newcalloc__assertmallocbuffer_manager_new_GLOBAL_OFFSET_TABLE_  &7FK#PUjx< !*1HD $<TX ` d l D` ( T ` h 66@ X3%-6? K LW 2e HZm X u 0  /955 1334039512 0 0 100644 13444 ` ELF+0@@.shstrtab.text.rodata1.rodata.bss.data.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_infow''''J '2`'ߐ `'ې  _ߑ+pw:`- : "w-@ "5@ H`2*0w:`5 : "w5@ " w'''J '2`'ߪ `5@  _ߑ+0@:`2 5@ H 7@ 2*0@:`* 7@'2 w'''2`' `'   ; *@" _+pw7@:- : @"w-@ @"5@ H`2*0w:`5 : "w5@ " w''2`' `5@   :*@" _+0@:2@7 5@ H 7@ 2*0@:`* 7@'2 wwwwwA@`ww`]@@_@ @@h@@@_@@ @@`]!@@@@@wwwwww A@`ww_\  @h `]`]@ HH  @  @@w`_`@ @w0A@`ww_\ `]_`h@w`@@0ww_\ _`@_0w'_\ _`@0w'_\ _`@㾐A@`w?w?ww_\ w_\`\ ww w '{wowG\`@_\ @_ H `]!`];@[_@\ whHw@`]554 @w@_@__ H `]!`]@@_`` 'cc%@'__ @_\ 0wG  'g7H_G75 4,0 4,0`]@ Hg,p&`'g7 75@ O_@@@'{{ @wo@@ @w_D "  @w_or wo_r w5" {" _t`c$``]_ H `]!`]@_w_ A@`www @`]q_t``_  @`]`b` @`t \ `_ @_@  @`]`H` @`t \ `_ @ A@`www_Z @_`]``_  @_``_ @_@  @_``_ @ ' < @w_\ @_`@_`@@@_ www'__@_@7@7@5$@5@4 0ww'_\ _`_`_74  ww_\ _ %``_  @@ @@ `'``_ `@@0w_Z `` : 72  ww'_w``wߠ@ w_74 %s:%d chdgirepository/cmph/chd.cDestroying algorithm dependent data Generating a CHD_PH perfect hash function with a load factor equal to %.3f packed_chd_phf_size = %u Compressing the range of the resulting CHD_PH perfect hash function Successfully generated minimal perfect hash Successfully generated minimal perfect hash function Loading chd mphf Loading CHD_PH perfect hash function with %u bytes to disk Loading Compressed rank structure, which has %u bytes Dumping CHD_PH perfect hash function with %u bytes to disk  @ @ @ @ @?@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)float.h 1.22 04/09/28 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/cmph/chd.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/chd.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.05+ girepository/cmphchd.c DD%chd.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodatabitmaskbitmask32valuemaskset_bits_valueget_bits_valueset_bits_at_posget_bits_at_pos.L49debugprintfdummyprintf.L67.L68.L76.L105.L108.L111.L119.L122.L129.L130.L131.L138_chd_searchchd_search_packedchd_packed_sizechd_packchd_searchcompressed_rank_query_packedcmph_search_packedchd_destroyfwrite__cmph_dumpchd_dumpfreadchd_loadcompressed_rank_destroycompressed_rank_packcompressed_rank_packed_sizecompressed_rank_generatecompressed_rank_initcmph_destroycmph_packcalloccmph_packed_sizecmph_newfprintfcmph_config_set_graphsizecmph_config_set_verbositychd_newcmph_config_set_keys_per_binchd_config_set_keys_per_bincmph_config_set_bchd_config_set_bcmph_config_set_hashfuncschd_config_set_hashfuncscmph_config_destroychd_config_destroycmph_config_set_algocmph_config_newmemset__assertchd_config_newfreevfprintfmemcpymallocstrlen__iob_GLOBAL_OFFSET_TABLE_  ,;CMWf u,((PP H088p@8< 8XT4%p. D9Vi @u|  ,$.5FOWq@X44 X0"6lI^nu~ LL JJI8HHJXH`KdK tG|FLL I8< DH PDxCBALL ?$Fp=; 9HLLL76KK  54,38< X2h1p0KK  5/2 4  8 . F - 2 , + I I 4 8 \K `K l p x5 L L I   )   82 X) t)   2 ) L L ' ( , P& l& & & F F F F X$ h#4H`H66@ 8<L"'-6b?:KAW@eVm(8 u&` 0P0  /973 1334039512 0 0 100644 27916 ` ELF+i@@.shstrtab.text.rodata1.rodata.bss.data.picdata.comment.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_infow''''J '2`'ߐ `'ې  _ߑ+pw:`- : "w-@ "5@ H`2*0w:`5 : "w5@ " w'''J '2`'ߪ `5@  _ߑ+0@:`2 5@ H 7@ 2*0@:`* 7@'2 w'''2`' `'   ; *@" _+pw7@:- : @"w-@ @"5@ H`2*0w:`5 : "w5@ " w''2`' `5@   :*@" _+0@:2@7 5@ H 7@ 2*0@:`* 7@'2 wwwwwA@`ww`]@@_@ @@h@@@_@@ @@`]!@@@@@wwwwww0' @ww0A@`ww' _h `]`]@ LHH   7@H_7@4@,0$ `7@ OA@`wwww''߬ _ߥ,p,pw_`,0w_`,0wϬ 5`H!_ _`H `H `]r H/_Ϡ wϡ5 5_  O_ _$` $`_ ` $` /ޱ4 @w@_A@`w''wϝ?wϡ?`] ?`] H`] `] HȿH?`] @I@HH?`]@ I?HHСA@`ww'' @`] ?Ϻ 7@H_7@5@,0,0w` $``7@ O 7@H07@4,0` H!?`w?`ww@I@?`]@ IH?ϡ7@ 7@ O@?灠HH0A@`wߐ 8@h `]`]@ HH  @  8@@$`t`$`$`t`$`  ,`$ $`( $`,t`0w@@0A@`ww_\ `]>_`0h@w`0@@ ww_Z _ G H7@H G & G O0A@`ww'_h `]`]@ HH  _\   H  H '&,0A@`ww'_h `]`]@ HH  _\  H H '&(wwwwߠ 'נ '_\ w '` ,p,p@w#'_$ $ '_`h@G`` @w`_`_\ \` \` '` HY_\ \`\`_`_@_ץ,p,pw`tL$'˨` tL$%` $ t@L$@ %`%`_\ \`\`__ӡ,0@ w` $``_H$נ '`  O_$  '`H_נ%4,0```-$%`'` O_נ$ 4,0@$  '` H_ץ+0+0@w__`A*08408H נ '`  O` H@_ H / O:@_@_`w` /ޱ4 СA@`www''' 4 @w_\ w_\ w`] '뀤H_,0@ '`H _ϡ4@,0 w` $` '뀤 O_$  '〤H_%4,0```-$%`'〤O_$ 4,0@$  @w '뀤H(_-0`'`H_ϡ4@,0``'_,0@$``$`w $ '뀤 O@___t` @w ' ' '〤HL_,0@`'``H7_,0@`'$` 'H_-`_,$``$`'' ' O '_,0@`` O '〤O@___t`_wװA@`wwww''''__ۑ*0@*0_ ( H, 5׀@H$@  J@ߔ@_jJ@"'Z0Ô@ (@Hw  * 5 5׀@ OH8 5׀@H2@  J@ߔ@_jJ@"'Z0Ñ22*0@ 2*0`] @Hw`]@" 5 5׀@ O5׀@HS__ۑ*0@*0_ ( H5`H``J@ߔ@_jJ@"'Z0Ò@w `" *``O#`H'5 H#``J@ߔ@_jJ@"'Z0Ñ22*0@w 2*0`]@# `Oݬ$  H/֐ /ֱ2 www'w''Ϭ   '___55@s*08408H55@_ L@__ӡ,0@ ,0$ H /Ρ5 5_ @ H$@5@  '〤H5@_  H H/Oα4 www'w'_wǬ  〥H4_ס54,0@```@H"____Ǜ5@54s*08408H H/ơ5@ 5@_ס54,0@`` O5$ 5 O /Ʊ4 A@`wwww'w'_w`]' H ' ' '_,0@ `'` H_,0@`' ' '`HF___Bs*08408H_ L@__,0@ ,0H$_,0 _,0@`4,0% `4,0$` ' ' '_,0@  O_,0@$` '_ @ H$@' ' 'ӀH_  H _,0@$` H/_,0@  O|_,$`$' O_ /Ʊ4 www'w'_w_ `$H ___Ӑ@$sH /___Ӑ@s/Ʊ4 A@`wwwwww'Ӡ '_`( H\`0`@ H \`0` 4 4,0@  5ӀH_ס54,0@`'``H5'__ǡ,0@`,0w_ߨ` ,0@_ `tL$' ,0@`t'À HM '_``4L@@_ lL$' (H] 0@ ` H HK/w ` H,`] 044,0` 4,0`]H H2/w``]@%`_ wà$ 'À OǠ '_ס54,0@`` O5 5ӀOj`]y /ұ4 㾠A@`ww?ww_\` ?Ǡ /!' dww / '`] ?\` ` $``]`B` `,t `$``]`2`] H`] ?`] H`] ?`];[` www`(wwwǑH @ `$ ` H`$`@*08408< H`` O$``]`@`( H` `?_ H `]!`];@[`w`  @wwww?W` www@@?g`]@ gI`] W@IH'@`( H ` 4 4 @w`0H` @w`0` @5@$ _ H `]!`]` `@___Ζ*08408H_ H `]!`]@ H/_ H `]!`]@h@`` _ H `]!`]@__@s/ƀH,@`( H\`0`@ H \`0` 4 4,0@ 5@ H_ H `]!`]@ H$/Ot_ H `]!`]@_`h@  8@`t @\ _``@_@_@@H _`h@w`H3w @w_D "  @wע`\`r t``\`r t`` " `" _t` $``]_ H `]!`]@_w_A@`www @`]|_t`_  @`]m@_ @@w @_  @`]P@_ @  8@w _ @@`]6 _  @ _  @A@`wwww_Z @__ @`]_  @__ @@__ @`]_  @__ @@_ߐ _  @ _  @ ' < @w_\ @_`@_`@_`@@@_ww'_\ _`_@`tL$ע` `tL$'`$ tL$ _`@5@7`  tL$'ǥ7 t'54ǠL@â@ l@L$@''4  ww_\ _@_ 2 '``_ @@@2@ '`` '``_ @@ w_\ @_`@'@_`6474@ < 64 ww'_`< '`@wס2@'Ǭ_G_@ǁt@L$@'t@L$@'ä' t@L$@ @7@t@L$@'7@t'5@4L@@l@L$@''4 %s:%d bucketsgirepository/cmph/chd_ph.cItem not added chd_phDestroying algorithm dependent data mphMAX BUCKET SIZE = %u USING HEURISTIC TO PLACE BUCKETS We were able to place m = %u keys m = %u nbuckets = %u load_factor = %.3f n = %u space lower bound is %.3f bits per key Starting mapping step for mph creation of %u keys with %u bins Failure in mapping step Starting ordering step Starting searching step Failure because the max trials was exceeded Starting compressing step Successfully generated minimal perfect hash Successfully generated minimal perfect hash function Loading chd_ph mphf Hash state has %u bytes Compressed sequence structure has %u bytes Reading n and nbuckets Dumping hash state with %u bytes to disk Dumping compressed sequence structure with %u bytes to disk ?@ @ @ @ @??zG@4 @?@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)float.h 1.22 04/09/28 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.44 10/01/04 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.11 SunOS_sparc 145354-01 2010/10/11girepository/cmph/chd_ph.c /var/tmp/gobject-introspection-1.32.0 /opt/solstudio12.2/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -DHAVE_CONFIG_H -I. -Icmph -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include -I/usr/local/include -L/usr/local/lib -I/usr/local/include -c -KPIC -DPIC girepository/cmph/chd_ph.cXa;P;R=Sun C 5.11 SunOS_sparc 145354-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.08. girepository/cmphchd_ph.c DD%chd_ph.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodatabitmaskbitmask32valuemaskset_bits_valueget_bits_valueset_bits_at_posget_bits_at_pos.L49debugprintfdummyprintfchd_ph_bucket_new.L73.L74chd_ph_bucket_clean.L94chd_ph_bucket_insertchd_ph_bucket_destroychd_ph_space_lower_bound.L_cseg0.L_cseg1.L_cseg2chd_ph_get_entropy.L_cseg3.L135.L143.L168chd_ph_mapping.L229chd_ph_orderingplace_bucket_probeplace_bucketplace_buckets1.L343place_buckets2chd_ph_searching.L407chd_ph_check_bin_hashing.L414.L415.L420.L428.L433.L442.L447.L451.L456.L466.L469.L476.L479.L_cseg4.L_cseg5.L_cseg6.L486.L487.L488.L489.L496.L497__dtoucompressed_seq_query_packedhash_vector_packedchd_ph_search_packedcompressed_seq_packed_sizechd_ph_packed_sizecompressed_seq_packhash_state_packed_sizehash_state_packhash_get_typechd_ph_packcompressed_seq_querychd_ph_searchcompressed_seq_destroychd_ph_destroycompressed_seq_dumpfwritehash_state_dump__cmph_dumpchd_ph_dumpcompressed_seq_loadhash_state_loadfreadchd_ph_loadcompressed_seq_generatecompressed_seq_initfprintfcheck_primalitychd_ph_newhash_vectorhash_state_newhash_state_destroychd_ph_config_set_keys_per_binchd_ph_config_set_bchd_ph_config_set_hashfuncschd_ph_config_destroymemsetchd_ph_config_newlog__assertcallocfreevfprintfmemcpymallocstrlen__iob_GLOBAL_OFFSET_TABLE_  />F PZi x,< P0 L  .7@I\e@kH(qpwxXh8((,"( (.H@4 :@ F0L R00X`8^gpy 00H=0l0\*AQ_/xk.P-H,@T !*-EYaq#\| P  d l (,5<AJQX_ err ppo8nHpXn`qdq tm|lkXr\r  j(r,r lrr   $ 48 DH dh xi irr k  $ i   (i `l r r o     j g r r  l l r r ! !   j Xr \r ! !   jToba`lllbrrk8#<# pk0lLklrr