# PaCkAgE DaTaStReAm less 1 1551 # end of header 0707010005a29b000081a40000000000000000000000014cad6b9d000001050000010000010036ffffffffffffffff0000000d00000000less/pkginfoPKG=less NAME=less 436 SPARC 64bit Solaris 10 VERSION=436 PSTAMP=7th October 2010 VENDOR=Mark Nudelman EMAIL=http://www.greenwoodsoftware.com/less/index.html DESC=Less pager ARCH=sparc CATEGORY=utility CLASSES=none BASEDIR=/ ISTATES=S s 1 2 3 RSTATES=S s 1 2 3 0707010005a29a000081a40000000000000000000000014cad6b9d000002f20000010000010036ffffffffffffffff0000000c00000000less/pkgmap: 1 1551 1 d none /usr ? ? ? 1 d none /usr/local ? ? ? 1 d none /usr/local/bin 0755 root root 1 f none /usr/local/bin/less 0755 root root 632544 10047 1286433611 1 f none /usr/local/bin/lessecho 0755 root root 23040 47420 1286433611 1 f none /usr/local/bin/lesskey 0755 root root 37456 30617 1286433611 1 d none /usr/local/share 0755 root root 1 d none /usr/local/share/man 0755 root root 1 d none /usr/local/share/man/man1 0755 root root 1 f none /usr/local/share/man/man1/less.1 0644 root root 64758 39463 1286433611 1 f none /usr/local/share/man/man1/lessecho.1 0644 root root 1225 37295 1286433611 1 f none /usr/local/share/man/man1/lesskey.1 0644 root root 9624 25944 1286433611 1 i checkinstall 785 2565 1286433691 1 i pkginfo 261 20551 1286433693 07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!0707010005a29b000081a40000000000000000000000014cad6b9d000001050000010000010036ffffffffffffffff0000000800000000pkginfoPKG=less NAME=less 436 SPARC 64bit Solaris 10 VERSION=436 PSTAMP=7th October 2010 VENDOR=Mark Nudelman EMAIL=http://www.greenwoodsoftware.com/less/index.html DESC=Less pager ARCH=sparc CATEGORY=utility CLASSES=none BASEDIR=/ ISTATES=S s 1 2 3 RSTATES=S s 1 2 3 0707010005a29a000081a40000000000000000000000014cad6b9d000002f20000010000010036ffffffffffffffff0000000700000000pkgmap: 1 1551 1 d none /usr ? ? ? 1 d none /usr/local ? ? ? 1 d none /usr/local/bin 0755 root root 1 f none /usr/local/bin/less 0755 root root 632544 10047 1286433611 1 f none /usr/local/bin/lessecho 0755 root root 23040 47420 1286433611 1 f none /usr/local/bin/lesskey 0755 root root 37456 30617 1286433611 1 d none /usr/local/share 0755 root root 1 d none /usr/local/share/man 0755 root root 1 d none /usr/local/share/man/man1 0755 root root 1 f none /usr/local/share/man/man1/less.1 0644 root root 64758 39463 1286433611 1 f none /usr/local/share/man/man1/lessecho.1 0644 root root 1225 37295 1286433611 1 f none /usr/local/share/man/man1/lesskey.1 0644 root root 9624 25944 1286433611 1 i checkinstall 785 2565 1286433691 1 i pkginfo 261 20551 1286433693 0707010005a2a9000041ed0000000000000000000000024cad6b9d000000000000010000010036ffffffffffffffff0000000800000000install0707010005a2aa000081ed0000000000000000000000014cad6b9b000003110000010000010036ffffffffffffffff0000001500000000install/checkinstall#!/bin/sh # expected_bits="64" expected_release="5.10" expected_platform="sparc" # release=`uname -r` platform=`uname -p` bits=`isainfo -b` # if [ ${platform} != ${expected_platform} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_platform} architecture\n" echo "\tAborting installation.\n\n\n" exit 1 fi if [ ${release} != ${expected_release} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_release} machine\n" echo "\tAborting installation.\n\n\n" exit 1 fi if [ ${bits} != ${expected_bits} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_bits} bit machine\n" echo "\tYour machine is running a ${bits} bit O.S. currently\n" echo "\tAborting installation.\n\n\n" exit 1 fi exit 0 0707010005a29c000041ed0000000000000000000000034cad6b9d000000000000010000010036ffffffffffffffff0000000500000000root0707010005a29d000041ed0000000000000000000000034cad6b9d000000000000010000010036ffffffffffffffff0000000900000000root/usr0707010005a29e000041ed0000000000000000000000044cad6b9d000000000000010000010036ffffffffffffffff0000000f00000000root/usr/local0707010005a2a3000041ed0000000000000000000000034cad6b9d000000000000010000010036ffffffffffffffff0000001500000000root/usr/local/share0707010005a2a4000041ed0000000000000000000000034cad6b9d000000000000010000010036ffffffffffffffff0000001900000000root/usr/local/share/man0707010005a2a5000041ed0000000000000000000000024cad6b9d000000000000010000010036ffffffffffffffff0000001e00000000root/usr/local/share/man/man10707010005a2a7000081a40000000000000000000000014cad6b4b000004c90000010000010036ffffffffffffffff0000002900000000root/usr/local/share/man/man1/lessecho.1.TH LESSECHO 1 "Version 436: 07 Jul 2009" .SH NAME lessecho \- expand metacharacters .SH SYNOPSIS .B lessecho .I "[-ox] [-cx] [-pn] [-dn] [-mx] [-nn] [-ex] [-a] file ..." .SH "DESCRIPTION" .I lessecho is a program that simply echos its arguments on standard output. But any argument containing spaces is enclosed in quotes. .SH OPTIONS A summary of options is included below. .TP .B \-ox Specifies "x" to be the open quote character. .TP .B \-cx Specifies "x" to be the close quote character. .TP .B \-pn Specifies "n" to be the open quote character, as an integer. .TP .B \-dn Specifies "n" to be the close quote character, as an integer. .TP .B \-mx Specifies "x" to be a metachar. .TP .B \-nn Specifies "n" to be a metachar, as an integer. .TP .B \-ex Specifies "x" to be the escape char for metachars. .TP .B \-fn Specifies "n" to be the escape char for metachars, as an integer. .TP .B \-a Specifies that all arguments are to be quoted. The default is that only arguments containing spaces are quoted. .SH "SEE ALSO" less(1) .SH AUTHOR This manual page was written by Thomas Schoepf , for the Debian GNU/Linux system (but may be used by others). .PP Send bug reports or comments to bug-less@gnu.org. 0707010005a2a8000081a40000000000000000000000014cad6b4b000025980000010000010036ffffffffffffffff0000002800000000root/usr/local/share/man/man1/lesskey.1.TH LESSKEY 1 "Version 436: 07 Jul 2009" .SH NAME lesskey \- specify key bindings for less .SH SYNOPSIS .B "lesskey [-o output] [--] [input]" .br .B "lesskey [--output=output] [--] [input]" .br .B "lesskey -V" .br .B "lesskey --version" .SH DESCRIPTION .I Lesskey is used to specify a set of key bindings to be used by .I less. The input file is a text file which describes the key bindings, If the input file is "-", standard input is read. If no input file is specified, a standard filename is used as the name of the input file, which depends on the system being used: On Unix systems, $HOME/.lesskey is used; on MS-DOS systems, $HOME/_lesskey is used; and on OS/2 systems $HOME/lesskey.ini is used, or $INIT/lesskey.ini if $HOME is undefined. The output file is a binary file which is used by .I less. If no output file is specified, and the environment variable LESSKEY is set, the value of LESSKEY is used as the name of the output file. Otherwise, a standard filename is used as the name of the output file, which depends on the system being used: On Unix and OS-9 systems, $HOME/.less is used; on MS-DOS systems, $HOME/_less is used; and on OS/2 systems, $HOME/less.ini is used, or $INIT/less.ini if $HOME is undefined. If the output file already exists, .I lesskey will overwrite it. .PP The -V or --version option causes .I lesskey to print its version number and immediately exit. If -V or --version is present, other options and arguments are ignored. .PP The input file consists of one or more .I sections. Each section starts with a line that identifies the type of section. Possible sections are: .IP #command Defines new command keys. .IP #line-edit Defines new line-editing keys. .IP #env Defines environment variables. .PP Blank lines and lines which start with a pound sign (#) are ignored, except for the special section header lines. .SH "COMMAND SECTION" The command section begins with the line .sp #command .sp If the command section is the first section in the file, this line may be omitted. The command section consists of lines of the form: .sp \fIstring\fP \fIaction\fP [extra-string] .sp Whitespace is any sequence of one or more spaces and/or tabs. The \fIstring\fP is the command key(s) which invoke the action. The \fIstring\fP may be a single command key, or a sequence of up to 15 keys. The \fIaction\fP is the name of the less action, from the list below. The characters in the \fIstring\fP may appear literally, or be prefixed by a caret to indicate a control key. A backslash followed by one to three octal digits may be used to specify a character by its octal value. A backslash followed by certain characters specifies input characters as follows: .IP \eb BACKSPACE .IP \ee ESCAPE .IP \en NEWLINE .IP \er RETURN .IP \et TAB .IP \eku UP ARROW .IP \ekd DOWN ARROW .IP \ekr RIGHT ARROW .IP \ekl LEFT ARROW .IP \ekU PAGE UP .IP \ekD PAGE DOWN .IP \ekh HOME .IP \eke END .IP \ekx DELETE .PP A backslash followed by any other character indicates that character is to be taken literally. Characters which must be preceded by backslash include caret, space, tab and the backslash itself. .PP An action may be followed by an "extra" string. When such a command is entered while running .I less, the action is performed, and then the extra string is parsed, just as if it were typed in to .I less. This feature can be used in certain cases to extend the functionality of a command. For example, see the "{" and ":t" commands in the example below. The extra string has a special meaning for the "quit" action: when .I less quits, first character of the extra string is used as its exit status. .SH EXAMPLE The following input file describes the set of default command keys used by less: .sp .nf #command \er forw-line \en forw-line e forw-line j forw-line \ekd forw-line ^E forw-line ^N forw-line k back-line y back-line ^Y back-line ^K back-line ^P back-line J forw-line-force K back-line-force Y back-line-force d forw-scroll ^D forw-scroll u back-scroll ^U back-scroll \e40 forw-screen f forw-screen ^F forw-screen ^V forw-screen \ekD forw-screen b back-screen ^B back-screen \eev back-screen \ekU back-screen z forw-window w back-window \ee\e40 forw-screen-force F forw-forever R repaint-flush r repaint ^R repaint ^L repaint \eeu undo-hilite g goto-line \ekh goto-line < goto-line \ee< goto-line p percent % percent \ee[ left-scroll \ee] right-scroll \ee( left-scroll \ee) right-scroll { forw-bracket {} } back-bracket {} ( forw-bracket () ) back-bracket () [ forw-bracket [] ] back-bracket [] \ee^F forw-bracket \ee^B back-bracket G goto-end \ee> goto-end > goto-end \eke goto-end = status ^G status :f status / forw-search ? back-search \ee/ forw-search * \ee? back-search * n repeat-search \een repeat-search-all N reverse-search \eeN reverse-search-all & filter m set-mark ' goto-mark ^X^X goto-mark E examine :e examine ^X^V examine :n next-file :p prev-file t next-tag T prev-tag :x index-file :d remove-file - toggle-option :t toggle-option t s toggle-option o _ display-option | pipe v visual ! shell + firstcmd H help h help V version 0 digit 1 digit 2 digit 3 digit 4 digit 5 digit 6 digit 7 digit 8 digit 9 digit q quit Q quit :q quit :Q quit ZZ quit .fi .sp .SH PRECEDENCE Commands specified by .I lesskey take precedence over the default commands. A default command key may be disabled by including it in the input file with the action "invalid". Alternatively, a key may be defined to do nothing by using the action "noaction". "noaction" is similar to "invalid", but .I less will give an error beep for an "invalid" command, but not for a "noaction" command. In addition, ALL default commands may be disabled by adding this control line to the input file: .sp #stop .sp This will cause all default commands to be ignored. The #stop line should be the last line in that section of the file. .PP Be aware that #stop can be dangerous. Since all default commands are disabled, you must provide sufficient commands before the #stop line to enable all necessary actions. For example, failure to provide a "quit" command can lead to frustration. .SH "LINE EDITING SECTION" The line-editing section begins with the line: .sp #line-edit .sp This section specifies new key bindings for the line editing commands, in a manner similar to the way key bindings for ordinary commands are specified in the #command section. The line-editing section consists of a list of keys and actions, one per line as in the example below. .SH EXAMPLE The following input file describes the set of default line-editing keys used by less: .sp .nf #line-edit \et forw-complete \e17 back-complete \ee\et back-complete ^L expand ^V literal ^A literal \eel right \ekr right \eeh left \ekl left \eeb word-left \ee\ekl word-left \eew word-right \ee\ekr word-right \eei insert \eex delete \ekx delete \eeX word-delete \eekx word-delete \ee\eb word-backspace \ee0 home \ekh home \ee$ end \eke end \eek up \eku up \eej down .fi .sp .SH "LESS ENVIRONMENT VARIABLES" The environment variable section begins with the line .sp #env .sp Following this line is a list of environment variable assignments. Each line consists of an environment variable name, an equals sign (=) and the value to be assigned to the environment variable. White space before and after the equals sign is ignored. Variables assigned in this way are visible only to .I less. If a variable is specified in the system environment and also in a lesskey file, the value in the lesskey file takes precedence. Although the lesskey file can be used to override variables set in the environment, the main purpose of assigning variables in the lesskey file is simply to have all .I less configuration information stored in one file. .SH EXAMPLE The following input file sets the -i option whenever .I less is run, and specifies the character set to be "latin1": .sp .nf #env LESS = -i LESSCHARSET = latin1 .fi .sp .SH "SEE ALSO" less(1) .SH WARNINGS It is not possible to specify special keys, such as uparrow, in a keyboard-independent manner. The only way to specify such keys is to specify the escape sequence which a particular keyboard sends when such a key is pressed. .PP On MS-DOS and OS/2 systems, certain keys send a sequence of characters which start with a NUL character (0). This NUL character should be represented as \e340 in a lesskey file. .SH COPYRIGHT Copyright (C) 2000-2009 Mark Nudelman .PP lesskey is part of the GNU project and is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2, or (at your option) any later version. .PP lesskey is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. .PP You should have received a copy of the GNU General Public License along with lesskey; see the file COPYING. If not, write to the Free Software Foundation, 59 Temple Place, Suite 330, Boston, MA 02111-1307, USA. .SH AUTHOR .PP Mark Nudelman .br Send bug reports or comments to the above address or to bug-less@gnu.org. 0707010005a2a6000081a40000000000000000000000014cad6b4b0000fcf60000010000010036ffffffffffffffff0000002500000000root/usr/local/share/man/man1/less.1.TH LESS 1 "Version 436: 07 Jul 2009" .SH NAME less \- opposite of more .SH SYNOPSIS .B "less \-?" .br .B "less \-\-help" .br .B "less \-V" .br .B "less \-\-version" .br .B "less [\-[+]aBcCdeEfFgGiIJKLmMnNqQrRsSuUVwWX~]" .br .B " [\-b \fIspace\fP] [\-h \fIlines\fP] [\-j \fIline\fP] [\-k \fIkeyfile\fP]" .br .B " [\-{oO} \fIlogfile\fP] [\-p \fIpattern\fP] [\-P \fIprompt\fP] [\-t \fItag\fP]" .br .B " [\-T \fItagsfile\fP] [\-x \fItab\fP,...] [\-y \fIlines\fP] [\-[z] \fIlines\fP]" .br .B " [\-# \fIshift\fP] [+[+]\fIcmd\fP] [\-\-] [\fIfilename\fP]..." .br (See the OPTIONS section for alternate option syntax with long option names.) .SH DESCRIPTION .I Less is a program similar to .I more (1), but which allows backward movement in the file as well as forward movement. Also, .I less does not have to read the entire input file before starting, so with large input files it starts up faster than text editors like .I vi (1). .I Less uses termcap (or terminfo on some systems), so it can run on a variety of terminals. There is even limited support for hardcopy terminals. (On a hardcopy terminal, lines which should be printed at the top of the screen are prefixed with a caret.) .PP Commands are based on both .I more and .I vi. Commands may be preceded by a decimal number, called N in the descriptions below. The number is used by some commands, as indicated. .SH COMMANDS In the following descriptions, ^X means control-X. ESC stands for the ESCAPE key; for example ESC-v means the two character sequence "ESCAPE", then "v". .IP "h or H" Help: display a summary of these commands. If you forget all the other commands, remember this one. .IP "SPACE or ^V or f or ^F" Scroll forward N lines, default one window (see option \-z below). If N is more than the screen size, only the final screenful is displayed. Warning: some systems use ^V as a special literalization character. .IP "z" Like SPACE, but if N is specified, it becomes the new window size. .IP "ESC-SPACE" Like SPACE, but scrolls a full screenful, even if it reaches end-of-file in the process. .IP "RETURN or ^N or e or ^E or j or ^J" Scroll forward N lines, default 1. The entire N lines are displayed, even if N is more than the screen size. .IP "d or ^D" Scroll forward N lines, default one half of the screen size. If N is specified, it becomes the new default for subsequent d and u commands. .IP "b or ^B or ESC-v" Scroll backward N lines, default one window (see option \-z below). If N is more than the screen size, only the final screenful is displayed. .IP "w" Like ESC-v, but if N is specified, it becomes the new window size. .IP "y or ^Y or ^P or k or ^K" Scroll backward N lines, default 1. The entire N lines are displayed, even if N is more than the screen size. Warning: some systems use ^Y as a special job control character. .IP "u or ^U" Scroll backward N lines, default one half of the screen size. If N is specified, it becomes the new default for subsequent d and u commands. .IP "ESC-) or RIGHTARROW" Scroll horizontally right N characters, default half the screen width (see the \-# option). If a number N is specified, it becomes the default for future RIGHTARROW and LEFTARROW commands. While the text is scrolled, it acts as though the \-S option (chop lines) were in effect. .IP "ESC-( or LEFTARROW" Scroll horizontally left N characters, default half the screen width (see the \-# option). If a number N is specified, it becomes the default for future RIGHTARROW and LEFTARROW commands. .IP "r or ^R or ^L" Repaint the screen. .IP R Repaint the screen, discarding any buffered input. Useful if the file is changing while it is being viewed. .IP "F" Scroll forward, and keep trying to read when the end of file is reached. Normally this command would be used when already at the end of the file. It is a way to monitor the tail of a file which is growing while it is being viewed. (The behavior is similar to the "tail \-f" command.) .IP "g or < or ESC-<" Go to line N in the file, default 1 (beginning of file). (Warning: this may be slow if N is large.) .IP "G or > or ESC->" Go to line N in the file, default the end of the file. (Warning: this may be slow if N is large, or if N is not specified and standard input, rather than a file, is being read.) .IP "p or %" Go to a position N percent into the file. N should be between 0 and 100, and may contain a decimal point. .IP "P" Go to the line containing byte offset N in the file. .IP "{" If a left curly bracket appears in the top line displayed on the screen, the { command will go to the matching right curly bracket. The matching right curly bracket is positioned on the bottom line of the screen. If there is more than one left curly bracket on the top line, a number N may be used to specify the N-th bracket on the line. .IP "}" If a right curly bracket appears in the bottom line displayed on the screen, the } command will go to the matching left curly bracket. The matching left curly bracket is positioned on the top line of the screen. If there is more than one right curly bracket on the top line, a number N may be used to specify the N-th bracket on the line. .IP "(" Like {, but applies to parentheses rather than curly brackets. .IP ")" Like }, but applies to parentheses rather than curly brackets. .IP "[" Like {, but applies to square brackets rather than curly brackets. .IP "]" Like }, but applies to square brackets rather than curly brackets. .IP "ESC-^F" Followed by two characters, acts like {, but uses the two characters as open and close brackets, respectively. For example, "ESC ^F < >" could be used to go forward to the > which matches the < in the top displayed line. .IP "ESC-^B" Followed by two characters, acts like }, but uses the two characters as open and close brackets, respectively. For example, "ESC ^B < >" could be used to go backward to the < which matches the > in the bottom displayed line. .IP m Followed by any lowercase letter, marks the current position with that letter. .IP "'" (Single quote.) Followed by any lowercase letter, returns to the position which was previously marked with that letter. Followed by another single quote, returns to the position at which the last "large" movement command was executed. Followed by a ^ or $, jumps to the beginning or end of the file respectively. Marks are preserved when a new file is examined, so the ' command can be used to switch between input files. .IP "^X^X" Same as single quote. .IP /pattern Search forward in the file for the N-th line containing the pattern. N defaults to 1. The pattern is a regular expression, as recognized by the regular expression library supplied by your system. The search starts at the second line displayed (but see the \-a and \-j options, which change this). .sp Certain characters are special if entered at the beginning of the pattern; they modify the type of search rather than become part of the pattern: .RS .IP "^N or !" Search for lines which do NOT match the pattern. .IP "^E or *" Search multiple files. That is, if the search reaches the END of the current file without finding a match, the search continues in the next file in the command line list. .IP "^F or @" Begin the search at the first line of the FIRST file in the command line list, regardless of what is currently displayed on the screen or the settings of the \-a or \-j options. .IP "^K" Highlight any text which matches the pattern on the current screen, but don't move to the first match (KEEP current position). .IP "^R" Don't interpret regular expression metacharacters; that is, do a simple textual comparison. .RE .IP ?pattern Search backward in the file for the N-th line containing the pattern. The search starts at the line immediately before the top line displayed. .sp Certain characters are special as in the / command: .RS .IP "^N or !" Search for lines which do NOT match the pattern. .IP "^E or *" Search multiple files. That is, if the search reaches the beginning of the current file without finding a match, the search continues in the previous file in the command line list. .IP "^F or @" Begin the search at the last line of the last file in the command line list, regardless of what is currently displayed on the screen or the settings of the \-a or \-j options. .IP "^K" As in forward searches. .IP "^R" As in forward searches. .RE .IP "ESC-/pattern" Same as "/*". .IP "ESC-?pattern" Same as "?*". .IP n Repeat previous search, for N-th line containing the last pattern. If the previous search was modified by ^N, the search is made for the N-th line NOT containing the pattern. If the previous search was modified by ^E, the search continues in the next (or previous) file if not satisfied in the current file. If the previous search was modified by ^R, the search is done without using regular expressions. There is no effect if the previous search was modified by ^F or ^K. .IP N Repeat previous search, but in the reverse direction. .IP "ESC-n" Repeat previous search, but crossing file boundaries. The effect is as if the previous search were modified by *. .IP "ESC-N" Repeat previous search, but in the reverse direction and crossing file boundaries. .IP "ESC-u" Undo search highlighting. Turn off highlighting of strings matching the current search pattern. If highlighting is already off because of a previous ESC-u command, turn highlighting back on. Any search command will also turn highlighting back on. (Highlighting can also be disabled by toggling the \-G option; in that case search commands do not turn highlighting back on.) .IP "&pattern" Display only lines which match the pattern; lines which do not match the pattern are not displayed. If pattern is empty (if you type & immediately followed by ENTER), any filtering is turned off, and all lines are displayed. While filtering is in effect, an ampersand is displayed at the beginning of the prompt, as a reminder that some lines in the file may be hidden. .sp Certain characters are special as in the / command: .RS .IP "^N or !" Display only lines which do NOT match the pattern. .IP "^R" Don't interpret regular expression metacharacters; that is, do a simple textual comparison. .RE .IP ":e [filename]" Examine a new file. If the filename is missing, the "current" file (see the :n and :p commands below) from the list of files in the command line is re-examined. A percent sign (%) in the filename is replaced by the name of the current file. A pound sign (#) is replaced by the name of the previously examined file. However, two consecutive percent signs are simply replaced with a single percent sign. This allows you to enter a filename that contains a percent sign in the name. Similarly, two consecutive pound signs are replaced with a single pound sign. The filename is inserted into the command line list of files so that it can be seen by subsequent :n and :p commands. If the filename consists of several files, they are all inserted into the list of files and the first one is examined. If the filename contains one or more spaces, the entire filename should be enclosed in double quotes (also see the \-" option). .IP "^X^V or E" Same as :e. Warning: some systems use ^V as a special literalization character. On such systems, you may not be able to use ^V. .IP ":n" Examine the next file (from the list of files given in the command line). If a number N is specified, the N-th next file is examined. .IP ":p" Examine the previous file in the command line list. If a number N is specified, the N-th previous file is examined. .IP ":x" Examine the first file in the command line list. If a number N is specified, the N-th file in the list is examined. .IP ":d" Remove the current file from the list of files. .IP "t" Go to the next tag, if there were more than one matches for the current tag. See the \-t option for more details about tags. .IP "T" Go to the previous tag, if there were more than one matches for the current tag. .IP "= or ^G or :f" Prints some information about the file being viewed, including its name and the line number and byte offset of the bottom line being displayed. If possible, it also prints the length of the file, the number of lines in the file and the percent of the file above the last displayed line. .IP \- Followed by one of the command line option letters (see OPTIONS below), this will change the setting of that option and print a message describing the new setting. If a ^P (CONTROL-P) is entered immediately after the dash, the setting of the option is changed but no message is printed. If the option letter has a numeric value (such as \-b or \-h), or a string value (such as \-P or \-t), a new value may be entered after the option letter. If no new value is entered, a message describing the current setting is printed and nothing is changed. .IP \-\- Like the \- command, but takes a long option name (see OPTIONS below) rather than a single option letter. You must press RETURN after typing the option name. A ^P immediately after the second dash suppresses printing of a message describing the new setting, as in the \- command. .IP \-+ Followed by one of the command line option letters this will reset the option to its default setting and print a message describing the new setting. (The "\-+\fIX\fP" command does the same thing as "\-+\fIX\fP" on the command line.) This does not work for string-valued options. .IP \-\-+ Like the \-+ command, but takes a long option name rather than a single option letter. .IP \-! Followed by one of the command line option letters, this will reset the option to the "opposite" of its default setting and print a message describing the new setting. This does not work for numeric or string-valued options. .IP \-\-! Like the \-! command, but takes a long option name rather than a single option letter. .IP _ (Underscore.) Followed by one of the command line option letters, this will print a message describing the current setting of that option. The setting of the option is not changed. .IP __ (Double underscore.) Like the _ (underscore) command, but takes a long option name rather than a single option letter. You must press RETURN after typing the option name. .IP +cmd Causes the specified cmd to be executed each time a new file is examined. For example, +G causes .I less to initially display each file starting at the end rather than the beginning. .IP V Prints the version number of .I less being run. .IP "q or Q or :q or :Q or ZZ" Exits .I less. .PP The following four commands may or may not be valid, depending on your particular installation. .PP .IP v Invokes an editor to edit the current file being viewed. The editor is taken from the environment variable VISUAL if defined, or EDITOR if VISUAL is not defined, or defaults to "vi" if neither VISUAL nor EDITOR is defined. See also the discussion of LESSEDIT under the section on PROMPTS below. .IP "! shell-command" Invokes a shell to run the shell-command given. A percent sign (%) in the command is replaced by the name of the current file. A pound sign (#) is replaced by the name of the previously examined file. "!!" repeats the last shell command. "!" with no shell command simply invokes a shell. On Unix systems, the shell is taken from the environment variable SHELL, or defaults to "sh". On MS-DOS and OS/2 systems, the shell is the normal command processor. .IP "| shell-command" represents any mark letter. Pipes a section of the input file to the given shell command. The section of the file to be piped is between the first line on the current screen and the position marked by the letter. may also be ^ or $ to indicate beginning or end of file respectively. If is . or newline, the current screen is piped. .IP "s filename" Save the input to a file. This only works if the input is a pipe, not an ordinary file. .PP .SH OPTIONS Command line options are described below. Most options may be changed while .I less is running, via the "\-" command. .PP Most options may be given in one of two forms: either a dash followed by a single letter, or two dashes followed by a long option name. A long option name may be abbreviated as long as the abbreviation is unambiguous. For example, \-\-quit-at-eof may be abbreviated \-\-quit, but not --qui, since both \-\-quit-at-eof and \-\-quiet begin with \-\-qui. Some long option names are in uppercase, such as \-\-QUIT-AT-EOF, as distinct from \-\-quit-at-eof. Such option names need only have their first letter capitalized; the remainder of the name may be in either case. For example, \-\-Quit-at-eof is equivalent to \-\-QUIT-AT-EOF. .PP Options are also taken from the environment variable "LESS". For example, to avoid typing "less \-options ..." each time .I less is invoked, you might tell .I csh: .sp setenv LESS "-options" .sp or if you use .I sh: .sp LESS="-options"; export LESS .sp On MS-DOS, you don't need the quotes, but you should replace any percent signs in the options string by double percent signs. .sp The environment variable is parsed before the command line, so command line options override the LESS environment variable. If an option appears in the LESS variable, it can be reset to its default value on the command line by beginning the command line option with "\-+". .sp For options like \-P or \-D which take a following string, a dollar sign ($) must be used to signal the end of the string. For example, to set two \-D options on MS-DOS, you must have a dollar sign between them, like this: .sp LESS="-Dn9.1$-Ds4.1" .sp .IP "\-? or \-\-help" This option displays a summary of the commands accepted by .I less (the same as the h command). (Depending on how your shell interprets the question mark, it may be necessary to quote the question mark, thus: "\-\e?".) .IP "\-a or \-\-search-skip-screen" Causes searches to start after the last line displayed on the screen, thus skipping all lines displayed on the screen. By default, searches start at the second line on the screen (or after the last found line; see the \-j option). .IP "\-b\fIn\fP or \-\-buffers=\fIn\fP" Specifies the amount of buffer space .I less will use for each file, in units of kilobytes (1024 bytes). By default 64K of buffer space is used for each file (unless the file is a pipe; see the \-B option). The \-b option specifies instead that \fIn\fP kilobytes of buffer space should be used for each file. If \fIn\fP is \-1, buffer space is unlimited; that is, the entire file can be read into memory. .IP "\-B or \-\-auto-buffers" By default, when data is read from a pipe, buffers are allocated automatically as needed. If a large amount of data is read from the pipe, this can cause a large amount of memory to be allocated. The \-B option disables this automatic allocation of buffers for pipes, so that only 64K (or the amount of space specified by the \-b option) is used for the pipe. Warning: use of \-B can result in erroneous display, since only the most recently viewed part of the piped data is kept in memory; any earlier data is lost. .IP "\-c or \-\-clear-screen" Causes full screen repaints to be painted from the top line down. By default, full screen repaints are done by scrolling from the bottom of the screen. .IP "\-C or \-\-CLEAR-SCREEN" Same as \-c, for compatibility with older versions of .I less. .IP "\-d or \-\-dumb" The \-d option suppresses the error message normally displayed if the terminal is dumb; that is, lacks some important capability, such as the ability to clear the screen or scroll backward. The \-d option does not otherwise change the behavior of .I less on a dumb terminal. .IP "\-D\fBx\fP\fIcolor\fP or \-\-color=\fBx\fP\fIcolor\fP" [MS-DOS only] Sets the color of the text displayed. \fBx\fP is a single character which selects the type of text whose color is being set: n=normal, s=standout, d=bold, u=underlined, k=blink. \fIcolor\fP is a pair of numbers separated by a period. The first number selects the foreground color and the second selects the background color of the text. A single number \fIN\fP is the same as \fIN.M\fP, where \fIM\fP is the normal background color. .IP "\-e or \-\-quit-at-eof" Causes .I less to automatically exit the second time it reaches end-of-file. By default, the only way to exit .I less is via the "q" command. .IP "\-E or \-\-QUIT-AT-EOF" Causes .I less to automatically exit the first time it reaches end-of-file. .IP "\-f or \-\-force" Forces non-regular files to be opened. (A non-regular file is a directory or a device special file.) Also suppresses the warning message when a binary file is opened. By default, .I less will refuse to open non-regular files. Note that some operating systems will not allow directories to be read, even if \-f is set. .IP "\-F or \-\-quit-if-one-screen" Causes .I less to automatically exit if the entire file can be displayed on the first screen. .IP "\-g or \-\-hilite-search" Normally, .I less will highlight ALL strings which match the last search command. The \-g option changes this behavior to highlight only the particular string which was found by the last search command. This can cause .I less to run somewhat faster than the default. .IP "\-G or \-\-HILITE-SEARCH" The \-G option suppresses all highlighting of strings found by search commands. .IP "\-h\fIn\fP or \-\-max-back-scroll=\fIn\fP" Specifies a maximum number of lines to scroll backward. If it is necessary to scroll backward more than \fIn\fP lines, the screen is repainted in a forward direction instead. (If the terminal does not have the ability to scroll backward, \-h0 is implied.) .IP "\-i or \-\-ignore-case" Causes searches to ignore case; that is, uppercase and lowercase are considered identical. This option is ignored if any uppercase letters appear in the search pattern; in other words, if a pattern contains uppercase letters, then that search does not ignore case. .IP "\-I or \-\-IGNORE-CASE" Like \-i, but searches ignore case even if the pattern contains uppercase letters. .IP "\-j\fIn\fP or \-\-jump-target=\fIn\fP" Specifies a line on the screen where the "target" line is to be positioned. The target line is the line specified by any command to search for a pattern, jump to a line number, jump to a file percentage or jump to a tag. The screen line may be specified by a number: the top line on the screen is 1, the next is 2, and so on. The number may be negative to specify a line relative to the bottom of the screen: the bottom line on the screen is \-1, the second to the bottom is \-2, and so on. Alternately, the screen line may be specified as a fraction of the height of the screen, starting with a decimal point: .5 is in the middle of the screen, .3 is three tenths down from the first line, and so on. If the line is specified as a fraction, the actual line number is recalculated if the terminal window is resized, so that the target line remains at the specified fraction of the screen height. If any form of the \-j option is used, forward searches begin at the line immediately after the target line, and backward searches begin at the target line. For example, if "\-j4" is used, the target line is the fourth line on the screen, so forward searches begin at the fifth line on the screen. .IP "\-J or \-\-status-column" Displays a status column at the left edge of the screen. The status column shows the lines that matched the current search. The status column is also used if the \-w or \-W option is in effect. .IP "\-k\fIfilename\fP or \-\-lesskey-file=\fIfilename\fP" Causes .I less to open and interpret the named file as a .I lesskey (1) file. Multiple \-k options may be specified. If the LESSKEY or LESSKEY_SYSTEM environment variable is set, or if a lesskey file is found in a standard place (see KEY BINDINGS), it is also used as a .I lesskey file. .IP "\-K or \-\-quit-on-intr" Causes .I less to exit immediately when an interrupt character (usually ^C) is typed. Normally, an interrupt character causes .I less to stop whatever it is doing and return to its command prompt. Note that use of this option makes it impossible to return to the command prompt from the "F" command. .IP "\-L or \-\-no-lessopen" Ignore the LESSOPEN environment variable (see the INPUT PREPROCESSOR section below). This option can be set from within \fIless\fP, but it will apply only to files opened subsequently, not to the file which is currently open. .IP "\-m or \-\-long-prompt" Causes .I less to prompt verbosely (like \fImore\fP), with the percent into the file. By default, .I less prompts with a colon. .IP "\-M or \-\-LONG-PROMPT" Causes .I less to prompt even more verbosely than .I more. .IP "\-n or \-\-line-numbers" Suppresses line numbers. The default (to use line numbers) may cause .I less to run more slowly in some cases, especially with a very large input file. Suppressing line numbers with the \-n option will avoid this problem. Using line numbers means: the line number will be displayed in the verbose prompt and in the = command, and the v command will pass the current line number to the editor (see also the discussion of LESSEDIT in PROMPTS below). .IP "\-N or \-\-LINE-NUMBERS" Causes a line number to be displayed at the beginning of each line in the display. .IP "\-o\fIfilename\fP or \-\-log-file=\fIfilename\fP" Causes .I less to copy its input to the named file as it is being viewed. This applies only when the input file is a pipe, not an ordinary file. If the file already exists, .I less will ask for confirmation before overwriting it. .IP "\-O\fIfilename\fP or \-\-LOG-FILE=\fIfilename\fP" The \-O option is like \-o, but it will overwrite an existing file without asking for confirmation. .sp If no log file has been specified, the \-o and \-O options can be used from within .I less to specify a log file. Without a file name, they will simply report the name of the log file. The "s" command is equivalent to specifying \-o from within .I less. .IP "\-p\fIpattern\fP or \-\-pattern=\fIpattern\fP" The \-p option on the command line is equivalent to specifying +/\fIpattern\fP; that is, it tells .I less to start at the first occurrence of \fIpattern\fP in the file. .IP "\-P\fIprompt\fP or \-\-prompt=\fIprompt\fP" Provides a way to tailor the three prompt styles to your own preference. This option would normally be put in the LESS environment variable, rather than being typed in with each .I less command. Such an option must either be the last option in the LESS variable, or be terminated by a dollar sign. -Ps followed by a string changes the default (short) prompt to that string. -Pm changes the medium (\-m) prompt. -PM changes the long (\-M) prompt. -Ph changes the prompt for the help screen. -P= changes the message printed by the = command. -Pw changes the message printed while waiting for data (in the F command). All prompt strings consist of a sequence of letters and special escape sequences. See the section on PROMPTS for more details. .IP "\-q or \-\-quiet or \-\-silent" Causes moderately "quiet" operation: the terminal bell is not rung if an attempt is made to scroll past the end of the file or before the beginning of the file. If the terminal has a "visual bell", it is used instead. The bell will be rung on certain other errors, such as typing an invalid character. The default is to ring the terminal bell in all such cases. .IP "\-Q or \-\-QUIET or \-\-SILENT" Causes totally "quiet" operation: the terminal bell is never rung. .IP "\-r or \-\-raw-control-chars" Causes "raw" control characters to be displayed. The default is to display control characters using the caret notation; for example, a control-A (octal 001) is displayed as "^A". Warning: when the \-r option is used, .I less cannot keep track of the actual appearance of the screen (since this depends on how the screen responds to each type of control character). Thus, various display problems may result, such as long lines being split in the wrong place. .IP "\-R or \-\-RAW-CONTROL-CHARS" Like \-r, but only ANSI "color" escape sequences are output in "raw" form. Unlike \-r, the screen appearance is maintained correctly in most cases. ANSI "color" escape sequences are sequences of the form: .sp ESC [ ... m .sp where the "..." is zero or more color specification characters For the purpose of keeping track of screen appearance, ANSI color escape sequences are assumed to not move the cursor. You can make .I less think that characters other than "m" can end ANSI color escape sequences by setting the environment variable LESSANSIENDCHARS to the list of characters which can end a color escape sequence. And you can make .I less think that characters other than the standard ones may appear between the ESC and the m by setting the environment variable LESSANSIMIDCHARS to the list of characters which can appear. .IP "\-s or \-\-squeeze-blank-lines" Causes consecutive blank lines to be squeezed into a single blank line. This is useful when viewing .I nroff output. .IP "\-S or \-\-chop-long-lines" Causes lines longer than the screen width to be chopped rather than folded. That is, the portion of a long line that does not fit in the screen width is not shown. The default is to fold long lines; that is, display the remainder on the next line. .IP "\-t\fItag\fP or \-\-tag=\fItag\fP" The \-t option, followed immediately by a TAG, will edit the file containing that tag. For this to work, tag information must be available; for example, there may be a file in the current directory called "tags", which was previously built by .I ctags (1) or an equivalent command. If the environment variable LESSGLOBALTAGS is set, it is taken to be the name of a command compatible with .I global (1), and that command is executed to find the tag. (See http://www.gnu.org/software/global/global.html). The \-t option may also be specified from within .I less (using the \- command) as a way of examining a new file. The command ":t" is equivalent to specifying \-t from within .I less. .IP "\-T\fItagsfile\fP or \-\-tag-file=\fItagsfile\fP" Specifies a tags file to be used instead of "tags". .IP "\-u or \-\-underline-special" Causes backspaces and carriage returns to be treated as printable characters; that is, they are sent to the terminal when they appear in the input. .IP "\-U or \-\-UNDERLINE-SPECIAL" Causes backspaces, tabs and carriage returns to be treated as control characters; that is, they are handled as specified by the \-r option. .sp By default, if neither \-u nor \-U is given, backspaces which appear adjacent to an underscore character are treated specially: the underlined text is displayed using the terminal's hardware underlining capability. Also, backspaces which appear between two identical characters are treated specially: the overstruck text is printed using the terminal's hardware boldface capability. Other backspaces are deleted, along with the preceding character. Carriage returns immediately followed by a newline are deleted. other carriage returns are handled as specified by the \-r option. Text which is overstruck or underlined can be searched for if neither \-u nor \-U is in effect. .IP "\-V or \-\-version" Displays the version number of .I less. .IP "\-w or \-\-hilite-unread" Temporarily highlights the first "new" line after a forward movement of a full page. The first "new" line is the line immediately following the line previously at the bottom of the screen. Also highlights the target line after a g or p command. The highlight is removed at the next command which causes movement. The entire line is highlighted, unless the \-J option is in effect, in which case only the status column is highlighted. .IP "\-W or \-\-HILITE-UNREAD" Like \-w, but temporarily highlights the first new line after any forward movement command larger than one line. .IP "\-x\fIn\fP,... or \-\-tabs=\fIn\fP,..." Sets tab stops. If only one \fIn\fP is specified, tab stops are set at multiples of \fIn\fP. If multiple values separated by commas are specified, tab stops are set at those positions, and then continue with the same spacing as the last two. For example, \fI-x9,17\fP will set tabs at positions 9, 17, 25, 33, etc. The default for \fIn\fP is 8. .IP "\-X or \-\-no-init" Disables sending the termcap initialization and deinitialization strings to the terminal. This is sometimes desirable if the deinitialization string does something unnecessary, like clearing the screen. .IP "\-y\fIn\fP or \-\-max-forw-scroll=\fIn\fP" Specifies a maximum number of lines to scroll forward. If it is necessary to scroll forward more than \fIn\fP lines, the screen is repainted instead. The \-c or \-C option may be used to repaint from the top of the screen if desired. By default, any forward movement causes scrolling. .IP "\-[z]\fIn\fP or \-\-window=\fIn\fP" Changes the default scrolling window size to \fIn\fP lines. The default is one screenful. The z and w commands can also be used to change the window size. The "z" may be omitted for compatibility with some versions of .I more. If the number .I n is negative, it indicates .I n lines less than the current screen size. For example, if the screen is 24 lines, \fI\-z-4\fP sets the scrolling window to 20 lines. If the screen is resized to 40 lines, the scrolling window automatically changes to 36 lines. .IP "\-\fI\(dqcc\fP\ or\ \-\-quotes=\fIcc\fP" Changes the filename quoting character. This may be necessary if you are trying to name a file which contains both spaces and quote characters. Followed by a single character, this changes the quote character to that character. Filenames containing a space should then be surrounded by that character rather than by double quotes. Followed by two characters, changes the open quote to the first character, and the close quote to the second character. Filenames containing a space should then be preceded by the open quote character and followed by the close quote character. Note that even after the quote characters are changed, this option remains \-" (a dash followed by a double quote). .IP "\-~ or \-\-tilde" Normally lines after end of file are displayed as a single tilde (~). This option causes lines after end of file to be displayed as blank lines. .IP "\-# or \-\-shift" Specifies the default number of positions to scroll horizontally in the RIGHTARROW and LEFTARROW commands. If the number specified is zero, it sets the default number of positions to one half of the screen width. Alternately, the number may be specified as a fraction of the width of the screen, starting with a decimal point: .5 is half of the screen width, .3 is three tenths of the screen width, and so on. If the number is specified as a fraction, the actual number of scroll positions is recalculated if the terminal window is resized, so that the actual scroll remains at the specified fraction of the screen width. .IP "\-\-no-keypad" Disables sending the keypad initialization and deinitialization strings to the terminal. This is sometimes useful if the keypad strings make the numeric keypad behave in an undesirable manner. .IP "\-\-follow-name" Normally, if the input file is renamed while an F command is executing, .I less will continue to display the contents of the original file despite its name change. If \-\-follow-name is specified, during an F command .I less will periodically attempt to reopen the file by name. If the reopen succeeds and the file is a different file from the original (which means that a new file has been created with the same name as the original (now renamed) file), .I less will display the contents of that new file. .IP \-\- A command line argument of "\-\-" marks the end of option arguments. Any arguments following this are interpreted as filenames. This can be useful when viewing a file whose name begins with a "\-" or "+". .IP + If a command line option begins with \fB+\fP, the remainder of that option is taken to be an initial command to .I less. For example, +G tells .I less to start at the end of the file rather than the beginning, and +/xyz tells it to start at the first occurrence of "xyz" in the file. As a special case, + acts like +g; that is, it starts the display at the specified line number (however, see the caveat under the "g" command above). If the option starts with ++, the initial command applies to every file being viewed, not just the first one. The + command described previously may also be used to set (or change) an initial command for every file. .SH "LINE EDITING" When entering command line at the bottom of the screen (for example, a filename for the :e command, or the pattern for a search command), certain keys can be used to manipulate the command line. Most commands have an alternate form in [ brackets ] which can be used if a key does not exist on a particular keyboard. (Note that the forms beginning with ESC do not work in some MS-DOS and Windows systems because ESC is the line erase character.) Any of these special keys may be entered literally by preceding it with the "literal" character, either ^V or ^A. A backslash itself may also be entered literally by entering two backslashes. .IP "LEFTARROW [ ESC-h ]" Move the cursor one space to the left. .IP "RIGHTARROW [ ESC-l ]" Move the cursor one space to the right. .IP "^LEFTARROW [ ESC-b or ESC-LEFTARROW ]" (That is, CONTROL and LEFTARROW simultaneously.) Move the cursor one word to the left. .IP "^RIGHTARROW [ ESC-w or ESC-RIGHTARROW ]" (That is, CONTROL and RIGHTARROW simultaneously.) Move the cursor one word to the right. .IP "HOME [ ESC-0 ]" Move the cursor to the beginning of the line. .IP "END [ ESC-$ ]" Move the cursor to the end of the line. .IP "BACKSPACE" Delete the character to the left of the cursor, or cancel the command if the command line is empty. .IP "DELETE or [ ESC-x ]" Delete the character under the cursor. .IP "^BACKSPACE [ ESC-BACKSPACE ]" (That is, CONTROL and BACKSPACE simultaneously.) Delete the word to the left of the cursor. .IP "^DELETE [ ESC-X or ESC-DELETE ]" (That is, CONTROL and DELETE simultaneously.) Delete the word under the cursor. .IP "UPARROW [ ESC-k ]" Retrieve the previous command line. .IP "DOWNARROW [ ESC-j ]" Retrieve the next command line. .IP "TAB" Complete the partial filename to the left of the cursor. If it matches more than one filename, the first match is entered into the command line. Repeated TABs will cycle thru the other matching filenames. If the completed filename is a directory, a "/" is appended to the filename. (On MS-DOS systems, a "\e" is appended.) The environment variable LESSSEPARATOR can be used to specify a different character to append to a directory name. .IP "BACKTAB [ ESC-TAB ]" Like, TAB, but cycles in the reverse direction thru the matching filenames. .IP "^L" Complete the partial filename to the left of the cursor. If it matches more than one filename, all matches are entered into the command line (if they fit). .IP "^U (Unix and OS/2) or ESC (MS-DOS)" Delete the entire command line, or cancel the command if the command line is empty. If you have changed your line-kill character in Unix to something other than ^U, that character is used instead of ^U. .SH "KEY BINDINGS" You may define your own .I less commands by using the program .I lesskey (1) to create a lesskey file. This file specifies a set of command keys and an action associated with each key. You may also use .I lesskey to change the line-editing keys (see LINE EDITING), and to set environment variables. If the environment variable LESSKEY is set, .I less uses that as the name of the lesskey file. Otherwise, .I less looks in a standard place for the lesskey file: On Unix systems, .I less looks for a lesskey file called "$HOME/.less". On MS-DOS and Windows systems, .I less looks for a lesskey file called "$HOME/_less", and if it is not found there, then looks for a lesskey file called "_less" in any directory specified in the PATH environment variable. On OS/2 systems, .I less looks for a lesskey file called "$HOME/less.ini", and if it is not found, then looks for a lesskey file called "less.ini" in any directory specified in the INIT environment variable, and if it not found there, then looks for a lesskey file called "less.ini" in any directory specified in the PATH environment variable. See the .I lesskey manual page for more details. .P A system-wide lesskey file may also be set up to provide key bindings. If a key is defined in both a local lesskey file and in the system-wide file, key bindings in the local file take precedence over those in the system-wide file. If the environment variable LESSKEY_SYSTEM is set, .I less uses that as the name of the system-wide lesskey file. Otherwise, .I less looks in a standard place for the system-wide lesskey file: On Unix systems, the system-wide lesskey file is /usr/local/etc/sysless. (However, if .I less was built with a different sysconf directory than /usr/local/etc, that directory is where the sysless file is found.) On MS-DOS and Windows systems, the system-wide lesskey file is c:\e_sysless. On OS/2 systems, the system-wide lesskey file is c:\esysless.ini. .SH "INPUT PREPROCESSOR" You may define an "input preprocessor" for .I less. Before .I less opens a file, it first gives your input preprocessor a chance to modify the way the contents of the file are displayed. An input preprocessor is simply an executable program (or shell script), which writes the contents of the file to a different file, called the replacement file. The contents of the replacement file are then displayed in place of the contents of the original file. However, it will appear to the user as if the original file is opened; that is, .I less will display the original filename as the name of the current file. .PP An input preprocessor receives one command line argument, the original filename, as entered by the user. It should create the replacement file, and when finished, print the name of the replacement file to its standard output. If the input preprocessor does not output a replacement filename, .I less uses the original file, as normal. The input preprocessor is not called when viewing standard input. To set up an input preprocessor, set the LESSOPEN environment variable to a command line which will invoke your input preprocessor. This command line should include one occurrence of the string "%s", which will be replaced by the filename when the input preprocessor command is invoked. .PP When .I less closes a file opened in such a way, it will call another program, called the input postprocessor, which may perform any desired clean-up action (such as deleting the replacement file created by LESSOPEN). This program receives two command line arguments, the original filename as entered by the user, and the name of the replacement file. To set up an input postprocessor, set the LESSCLOSE environment variable to a command line which will invoke your input postprocessor. It may include two occurrences of the string "%s"; the first is replaced with the original name of the file and the second with the name of the replacement file, which was output by LESSOPEN. .PP For example, on many Unix systems, these two scripts will allow you to keep files in compressed format, but still let .I less view them directly: .PP lessopen.sh: .br #! /bin/sh .br case "$1" in .br *.Z) uncompress -\c $1 >/tmp/less.$$ 2>/dev/null .br if [ \-s /tmp/less.$$ ]; then .br echo /tmp/less.$$ .br else .br rm \-f /tmp/less.$$ .br fi .br ;; .br esac .PP lessclose.sh: .br #! /bin/sh .br rm $2 .PP To use these scripts, put them both where they can be executed and set LESSOPEN="lessopen.sh\ %s", and LESSCLOSE="lessclose.sh\ %s\ %s". More complex LESSOPEN and LESSCLOSE scripts may be written to accept other types of compressed files, and so on. .PP It is also possible to set up an input preprocessor to pipe the file data directly to .I less, rather than putting the data into a replacement file. This avoids the need to decompress the entire file before starting to view it. An input preprocessor that works this way is called an input pipe. An input pipe, instead of writing the name of a replacement file on its standard output, writes the entire contents of the replacement file on its standard output. If the input pipe does not write any characters on its standard output, then there is no replacement file and .I less uses the original file, as normal. To use an input pipe, make the first character in the LESSOPEN environment variable a vertical bar (|) to signify that the input preprocessor is an input pipe. .PP For example, on many Unix systems, this script will work like the previous example scripts: .PP lesspipe.sh: .br #! /bin/sh .br case "$1" in .br *.Z) uncompress \-c $1 2>/dev/null .br ;; .br esac .br .PP To use this script, put it where it can be executed and set LESSOPEN="|lesspipe.sh %s". When an input pipe is used, a LESSCLOSE postprocessor can be used, but it is usually not necessary since there is no replacement file to clean up. In this case, the replacement file name passed to the LESSCLOSE postprocessor is "\-". .PP For compatibility with previous versions of .I less, the input preprocessor or pipe is not used if .I less is viewing standard input. However, if the first character of LESSOPEN is a dash (\-), the input preprocessor is used on standard input as well as other files. In this case, the dash is not considered to be part of the preprocessor command. If standard input is being viewed, the input preprocessor is passed a file name consisting of a single dash. Similarly, if the first two characters of LESSOPEN are vertical bar and dash (|\-), the input pipe is used on standard input as well as other files. Again, in this case the dash is not considered to be part of the input pipe command. .SH "NATIONAL CHARACTER SETS" There are three types of characters in the input file: .IP "normal characters" can be displayed directly to the screen. .IP "control characters" should not be displayed directly, but are expected to be found in ordinary text files (such as backspace and tab). .IP "binary characters" should not be displayed directly and are not expected to be found in text files. .PP A "character set" is simply a description of which characters are to be considered normal, control, and binary. The LESSCHARSET environment variable may be used to select a character set. Possible values for LESSCHARSET are: .IP ascii BS, TAB, NL, CR, and formfeed are control characters, all chars with values between 32 and 126 are normal, and all others are binary. .IP iso8859 Selects an ISO 8859 character set. This is the same as ASCII, except characters between 160 and 255 are treated as normal characters. .IP latin1 Same as iso8859. .IP latin9 Same as iso8859. .IP dos Selects a character set appropriate for MS-DOS. .IP ebcdic Selects an EBCDIC character set. .IP IBM-1047 Selects an EBCDIC character set used by OS/390 Unix Services. This is the EBCDIC analogue of latin1. You get similar results by setting either LESSCHARSET=IBM-1047 or LC_CTYPE=en_US in your environment. .IP koi8-r Selects a Russian character set. .IP next Selects a character set appropriate for NeXT computers. .IP utf-8 Selects the UTF-8 encoding of the ISO 10646 character set. UTF-8 is special in that it supports multi-byte characters in the input file. It is the only character set that supports multi-byte characters. .IP windows Selects a character set appropriate for Microsoft Windows (cp 1251). .PP In rare cases, it may be desired to tailor .I less to use a character set other than the ones definable by LESSCHARSET. In this case, the environment variable LESSCHARDEF can be used to define a character set. It should be set to a string where each character in the string represents one character in the character set. The character "." is used for a normal character, "c" for control, and "b" for binary. A decimal number may be used for repetition. For example, "bccc4b." would mean character 0 is binary, 1, 2 and 3 are control, 4, 5, 6 and 7 are binary, and 8 is normal. All characters after the last are taken to be the same as the last, so characters 9 through 255 would be normal. (This is an example, and does not necessarily represent any real character set.) .PP This table shows the value of LESSCHARDEF which is equivalent to each of the possible values for LESSCHARSET: .sp ascii\ 8bcccbcc18b95.b .br dos\ \ \ 8bcccbcc12bc5b95.b. .br ebcdic 5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b .br \ \ \ \ \ \ 9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b. .br IBM-1047 4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc .br \ \ \ \ \ \ 191.b .br iso8859 8bcccbcc18b95.33b. .br koi8-r 8bcccbcc18b95.b128. .br latin1 8bcccbcc18b95.33b. .br next\ \ 8bcccbcc18b95.bb125.bb .PP If neither LESSCHARSET nor LESSCHARDEF is set, but any of the strings "UTF-8", "UTF8", "utf-8" or "utf8" is found in the LC_ALL, LC_TYPE or LANG environment variables, then the default character set is utf-8. .PP If that string is not found, but your system supports the .I setlocale interface, .I less will use setlocale to determine the character set. setlocale is controlled by setting the LANG or LC_CTYPE environment variables. .PP Finally, if the .I setlocale interface is also not available, the default character set is latin1. .PP Control and binary characters are displayed in standout (reverse video). Each such character is displayed in caret notation if possible (e.g. ^A for control-A). Caret notation is used only if inverting the 0100 bit results in a normal printable character. Otherwise, the character is displayed as a hex number in angle brackets. This format can be changed by setting the LESSBINFMT environment variable. LESSBINFMT may begin with a "*" and one character to select the display attribute: "*k" is blinking, "*d" is bold, "*u" is underlined, "*s" is standout, and "*n" is normal. If LESSBINFMT does not begin with a "*", normal attribute is assumed. The remainder of LESSBINFMT is a string which may include one printf-style escape sequence (a % followed by x, X, o, d, etc.). For example, if LESSBINFMT is "*u[%x]", binary characters are displayed in underlined hexadecimal surrounded by brackets. The default if no LESSBINFMT is specified is "*s<%X>". The default if no LESSBINFMT is specified is "*s<%02X>". Warning: the result of expanding the character via LESSBINFMT must be less than 31 characters. .PP When the character set is utf-8, the LESSUTFBINFMT environment variable acts similarly to LESSBINFMT but it applies to Unicode code points that were successfully decoded but are unsuitable for display (e.g., unassigned code points). Its default value is "". Note that LESSUTFBINFMT and LESSBINFMT share their display attribute setting ("*x") so specifying one will affect both; LESSUTFBINFMT is read after LESSBINFMT so its setting, if any, will have priority. Problematic octets in a UTF-8 file (octets of a truncated sequence, octets of a complete but non-shortest form sequence, illegal octets, and stray trailing octets) are displayed individually using LESSBINFMT so as to facilitate diagnostic of how the UTF-8 file is ill-formed. .SH "PROMPTS" The \-P option allows you to tailor the prompt to your preference. The string given to the \-P option replaces the specified prompt string. Certain characters in the string are interpreted specially. The prompt mechanism is rather complicated to provide flexibility, but the ordinary user need not understand the details of constructing personalized prompt strings. .sp A percent sign followed by a single character is expanded according to what the following character is: .IP "%b\fIX\fP" Replaced by the byte offset into the current input file. The b is followed by a single character (shown as \fIX\fP above) which specifies the line whose byte offset is to be used. If the character is a "t", the byte offset of the top line in the display is used, an "m" means use the middle line, a "b" means use the bottom line, a "B" means use the line just after the bottom line, and a "j" means use the "target" line, as specified by the \-j option. .IP "%B" Replaced by the size of the current input file. .IP "%c" Replaced by the column number of the text appearing in the first column of the screen. .IP "%d\fIX\fP" Replaced by the page number of a line in the input file. The line to be used is determined by the \fIX\fP, as with the %b option. .IP "%D" Replaced by the number of pages in the input file, or equivalently, the page number of the last line in the input file. .IP "%E" Replaced by the name of the editor (from the VISUAL environment variable, or the EDITOR environment variable if VISUAL is not defined). See the discussion of the LESSEDIT feature below. .IP "%f" Replaced by the name of the current input file. .IP "%i" Replaced by the index of the current file in the list of input files. .IP "%l\fIX\fP" Replaced by the line number of a line in the input file. The line to be used is determined by the \fIX\fP, as with the %b option. .IP "%L" Replaced by the line number of the last line in the input file. .IP "%m" Replaced by the total number of input files. .IP "%p\fIX\fP" Replaced by the percent into the current input file, based on byte offsets. The line used is determined by the \fIX\fP as with the %b option. .IP "%P\fIX\fP" Replaced by the percent into the current input file, based on line numbers. The line used is determined by the \fIX\fP as with the %b option. .IP "%s" Same as %B. .IP "%t" Causes any trailing spaces to be removed. Usually used at the end of the string, but may appear anywhere. .IP "%x" Replaced by the name of the next input file in the list. .PP If any item is unknown (for example, the file size if input is a pipe), a question mark is printed instead. .PP The format of the prompt string can be changed depending on certain conditions. A question mark followed by a single character acts like an "IF": depending on the following character, a condition is evaluated. If the condition is true, any characters following the question mark and condition character, up to a period, are included in the prompt. If the condition is false, such characters are not included. A colon appearing between the question mark and the period can be used to establish an "ELSE": any characters between the colon and the period are included in the string if and only if the IF condition is false. Condition characters (which follow a question mark) may be: .IP "?a" True if any characters have been included in the prompt so far. .IP "?b\fIX\fP" True if the byte offset of the specified line is known. .IP "?B" True if the size of current input file is known. .IP "?c" True if the text is horizontally shifted (%c is not zero). .IP "?d\fIX\fP" True if the page number of the specified line is known. .IP "?e" True if at end-of-file. .IP "?f" True if there is an input filename (that is, if input is not a pipe). .IP "?l\fIX\fP" True if the line number of the specified line is known. .IP "?L" True if the line number of the last line in the file is known. .IP "?m" True if there is more than one input file. .IP "?n" True if this is the first prompt in a new input file. .IP "?p\fIX\fP" True if the percent into the current input file, based on byte offsets, of the specified line is known. .IP "?P\fIX\fP" True if the percent into the current input file, based on line numbers, of the specified line is known. .IP "?s" Same as "?B". .IP "?x" True if there is a next input file (that is, if the current input file is not the last one). .PP Any characters other than the special ones (question mark, colon, period, percent, and backslash) become literally part of the prompt. Any of the special characters may be included in the prompt literally by preceding it with a backslash. .PP Some examples: .sp ?f%f:Standard input. .sp This prompt prints the filename, if known; otherwise the string "Standard input". .sp ?f%f .?ltLine %lt:?pt%pt\e%:?btByte %bt:-... .sp This prompt would print the filename, if known. The filename is followed by the line number, if known, otherwise the percent if known, otherwise the byte offset if known. Otherwise, a dash is printed. Notice how each question mark has a matching period, and how the % after the %pt is included literally by escaping it with a backslash. .sp ?n?f%f\ .?m(file\ %i\ of\ %m)\ ..?e(END)\ ?x-\ Next\e:\ %x..%t .sp This prints the filename if this is the first prompt in a file, followed by the "file N of N" message if there is more than one input file. Then, if we are at end-of-file, the string "(END)" is printed followed by the name of the next file, if there is one. Finally, any trailing spaces are truncated. This is the default prompt. For reference, here are the defaults for the other two prompts (\-m and \-M respectively). Each is broken into two lines here for readability only. .nf .sp ?n?f%f\ .?m(file\ %i\ of\ %m)\ ..?e(END)\ ?x-\ Next\e:\ %x.: ?pB%pB\e%:byte\ %bB?s/%s...%t .sp ?f%f\ .?n?m(file\ %i\ of\ %m)\ ..?ltlines\ %lt-%lb?L/%L.\ : byte\ %bB?s/%s.\ .?e(END)\ ?x-\ Next\e:\ %x.:?pB%pB\e%..%t .sp .fi And here is the default message produced by the = command: .nf .sp ?f%f\ .?m(file\ %i\ of\ %m)\ .?ltlines\ %lt-%lb?L/%L.\ . byte\ %bB?s/%s.\ ?e(END)\ :?pB%pB\e%..%t .fi .PP The prompt expansion features are also used for another purpose: if an environment variable LESSEDIT is defined, it is used as the command to be executed when the v command is invoked. The LESSEDIT string is expanded in the same way as the prompt strings. The default value for LESSEDIT is: .nf .sp %E\ ?lm+%lm.\ %f .sp .fi Note that this expands to the editor name, followed by a + and the line number, followed by the file name. If your editor does not accept the "+linenumber" syntax, or has other differences in invocation syntax, the LESSEDIT variable can be changed to modify this default. .SH SECURITY When the environment variable LESSSECURE is set to 1, .I less runs in a "secure" mode. This means these features are disabled: .RS .IP "!" the shell command .IP "|" the pipe command .IP ":e" the examine command. .IP "v" the editing command .IP "s \-o" log files .IP "\-k" use of lesskey files .IP "\-t" use of tags files .IP " " metacharacters in filenames, such as * .IP " " filename completion (TAB, ^L) .RE .PP Less can also be compiled to be permanently in "secure" mode. .SH "COMPATIBILITY WITH MORE" If the environment variable LESS_IS_MORE is set to 1, or if the program is invoked via a file link named "more", .I less behaves (mostly) in conformance with the POSIX "more" command specification. In this mode, less behaves differently in these ways: .PP The \-e option works differently. If the \-e option is not set, .I less behaves as if the \-E option were set. If the \-e option is set, .I less behaves as if the \-e and \-F options were set. .PP The \-m option works differently. If the \-m option is not set, the medium prompt is used, and it is prefixed with the string "--More--". If the \-m option is set, the short prompt is used. .PP The \-n option acts like the \-z option. The normal behavior of the \-n option is unavailable in this mode. .PP The parameter to the \-p option is taken to be a .I less command rather than a search pattern. .PP The LESS environment variable is ignored, and the MORE environment variable is used in its place. .SH "ENVIRONMENT VARIABLES" Environment variables may be specified either in the system environment as usual, or in a .I lesskey (1) file. If environment variables are defined in more than one place, variables defined in a local lesskey file take precedence over variables defined in the system environment, which take precedence over variables defined in the system-wide lesskey file. .IP COLUMNS Sets the number of columns on the screen. Takes precedence over the number of columns specified by the TERM variable. (But if you have a windowing system which supports TIOCGWINSZ or WIOCGETD, the window system's idea of the screen size takes precedence over the LINES and COLUMNS environment variables.) .IP EDITOR The name of the editor (used for the v command). .IP HOME Name of the user's home directory (used to find a lesskey file on Unix and OS/2 systems). .IP "HOMEDRIVE, HOMEPATH" Concatenation of the HOMEDRIVE and HOMEPATH environment variables is the name of the user's home directory if the HOME variable is not set (only in the Windows version). .IP INIT Name of the user's init directory (used to find a lesskey file on OS/2 systems). .IP LANG Language for determining the character set. .IP LC_CTYPE Language for determining the character set. .IP LESS Options which are passed to .I less automatically. .IP LESSANSIENDCHARS Characters which may end an ANSI color escape sequence (default "m"). .IP LESSANSIMIDCHARS Characters which may appear between the ESC character and the end character in an ANSI color escape sequence (default "0123456789;[?!"'#%()*+\ ". .IP LESSBINFMT Format for displaying non-printable, non-control characters. .IP LESSCHARDEF Defines a character set. .IP LESSCHARSET Selects a predefined character set. .IP LESSCLOSE Command line to invoke the (optional) input-postprocessor. .IP LESSECHO Name of the lessecho program (default "lessecho"). The lessecho program is needed to expand metacharacters, such as * and ?, in filenames on Unix systems. .IP LESSEDIT Editor prototype string (used for the v command). See discussion under PROMPTS. .IP LESSGLOBALTAGS Name of the command used by the \-t option to find global tags. Normally should be set to "global" if your system has the .I global (1) command. If not set, global tags are not used. .IP LESSHISTFILE Name of the history file used to remember search commands and shell commands between invocations of .I less. If set to "\-" or "/dev/null", a history file is not used. The default is "$HOME/.lesshst" on Unix systems, "$HOME/_lesshst" on DOS and Windows systems, or "$HOME/lesshst.ini" or "$INIT/lesshst.ini" on OS/2 systems. .IP LESSHISTSIZE The maximum number of commands to save in the history file. The default is 100. .IP LESSKEY Name of the default lesskey(1) file. .IP LESSKEY_SYSTEM Name of the default system-wide lesskey(1) file. .IP LESSMETACHARS List of characters which are considered "metacharacters" by the shell. .IP LESSMETAESCAPE Prefix which less will add before each metacharacter in a command sent to the shell. If LESSMETAESCAPE is an empty string, commands containing metacharacters will not be passed to the shell. .IP LESSOPEN Command line to invoke the (optional) input-preprocessor. .IP LESSSECURE Runs less in "secure" mode. See discussion under SECURITY. .IP LESSSEPARATOR String to be appended to a directory name in filename completion. .IP LESSUTFBINFMT Format for displaying non-printable Unicode code points. .IP LESS_IS_MORE Emulate the .I more (1) command. .IP LINES Sets the number of lines on the screen. Takes precedence over the number of lines specified by the TERM variable. (But if you have a windowing system which supports TIOCGWINSZ or WIOCGETD, the window system's idea of the screen size takes precedence over the LINES and COLUMNS environment variables.) .IP PATH User's search path (used to find a lesskey file on MS-DOS and OS/2 systems). .IP SHELL The shell used to execute the ! command, as well as to expand filenames. .IP TERM The type of terminal on which .I less is being run. .IP VISUAL The name of the editor (used for the v command). .SH "SEE ALSO" lesskey(1) .SH COPYRIGHT Copyright (C) 1984-2009 Mark Nudelman .PP less is part of the GNU project and is free software. You can redistribute it and/or modify it under the terms of either (1) the GNU General Public License as published by the Free Software Foundation; or (2) the Less License. See the file README in the less distribution for more details regarding redistribution. You should have received a copy of the GNU General Public License along with the source for less; see the file COPYING. If not, write to the Free Software Foundation, 59 Temple Place, Suite 330, Boston, MA 02111-1307, USA. You should also have received a copy of the Less License; see the file LICENSE. .PP less is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. .SH AUTHOR .PP Mark Nudelman .br See http://www.greenwoodsoftware.com/less/bugs.html for the latest list of known bugs in less. .br Send bug reports or comments to the above address or to .br bug-less@gnu.org. .br For more information, see the less homepage at .br http://www.greenwoodsoftware.com/less. 0707010005a29f000041ed0000000000000000000000024cad6b9d000000000000010000010036ffffffffffffffff0000001300000000root/usr/local/bin0707010005a2a0000081ed0000000000000000000000014cad6b4b0009a6e00000010000010036ffffffffffffffff0000001800000000root/usr/local/bin/lessELF+`@ @8@! @@X~~~~\HH/usr/lib/sparcv9/ld.so.1  !"$%&')*-/123457:<>?BDGIJKMOPRSTUWXYZ\_ceghmqrtuwz{~   !$%&')*+,-/34589:<=>?@ABCDGIKLMPQSTUWZ\]_`acdefhjkmpqsuwxyz}   !"%&(+,/0124678:;>?@ABCDEGIJKLMNQRSTUXZ[\]`aeghijmoqrtuvwxz{}~ #(+,.0689;=@ACEFHLNQV[]^`abdfijklnopsvxy|}   "#(.01267;EFHJNORVXY[^bgilnortv{|~   #$')*-.359<=FHOPVWY^_bcdfklnpsy| PL '% f, P6 4AL@Sa  h   Hx` ( VMX (\ب- P:B JR ΀4^ xhn` T ` PPx  (-= 4C XHOi|Pۈ    \  * n-7XV tc &op 8 * | C" @@+hG `RHnw )  p h  ٸ8 X`T.(JQ@i 8r1 ܠ` SX H ڸ iPX v0T th~$ z,+5<X (d @pl )xxh`8  V H  H!";pUxm r ? 8 0 (ˠP ˰5 @?Fbj Aw؈h X Hx d h  \ \ # 4 .d 8x T 0 \  k8       ː   H  @  3ˀ U Ex c l9 X m f0 u   `    0 ( X  pT $  PD   p , װ 5 . = E  UT ] e  ` q`  (   ` ٘ H ( 0 K g  w     x  X  pp (  D     (  Pt ) (| 0 :8| 9 J@ R` X d m  x  8    X  [<  4  XX ` X  @8 y` p k0 rp"" j@(3 *9 g? uI \O[ s<a ((jy {XH L @hژ$ 1 (; ,I@h Hr Ș( X ( \p   ,8E ptRfj`o0 (| #@X =$HlX  x,$ ՈP28Mh ؘ` 008  @q )/:Td] 8Pj  p ` h@@X`P ] @h H`   0P, p4 d0;AI hS d^gۼ xˈ X ې` ( /h @&/ Xh<I`fr Op  x`     h cP ,H8& X3 PX=  I  @Q`Yڸy _pl ې 0hX/ qT C0H^j Xo y ~P $@  l\ 8  `4 d@& <`0 8B@J QZbx lX H  h  e (D|    % XL/ H4; hJ c(<R n d hye x4    @,      ܈@ X$˨(3 g@ E (< $DXPHs xو ?pl 8 7ظR ` 0Pm v `P 4˘ "xd9U`t  Ҙ@p(    נ Jp0 80: S   #@]w (Hpx  He i    n     ,)@FNT  ] Xh  s P@|x V X HH(0 @ a@L ) 60Ri   ATp 4|(ۀ =|x L  W0"  4 (ڈX3d 0Lo \ X p | @pC  P aW (` h  8  وT   p  |  P< * 1  Ni *+ e  4  0 sڨ  ؀  hH  d   0 T   H! $0! <! dHl!% !3 WDf!LX !d`!k!u c!} d(! 8! P! (`! x!!h!٨" "("B"Lʸ"gH"" """"T## #"@#)#3 X#8#>#] B #c X#m,#t@#{#(#`# (# `# p   ###$$ WT$ D$%$=$E V;$a E4$n$$  $ @h$ V4  $ $ې$ V4$ WP$@$h%% X%0 (%7%> بd%H\%i%s(% XN$XAoAMiKDtWrMUzy.sc_homecmd_acceptunmarkjump_forwclr_filterhow_searchstrstrcan_goto_lineinttoa$XAoAMiKEtWrM05y.prompt_colireadfcloseclr_linenumstrlencurr_inoget_swindow$XAoAMiKJtWrMkZz.m_proto$XAoAMiKItWrMUUz.p_optname$XAoAMiKItWrMUUz.x_optnameget_ifile$XAoAMiKItWrMUUz.h_optnameadd_back_posno_initutf_len__xargvend_logfileget_meta_escape$XAoAMiKDtWrMUzy.sc_bl_inat_exit$XAoAMiKEtWrMU1y.ch_ungotcharnexttag$XAoAMiKHtWrMUNz.mbc_buf_lenisoptpending$XAoAMiKJtWrMkZz.mpstart_attnpos$XAoAMiKFtWrM0_y.curr_altpipereedit_ifilesigprocmaskopt_queryinit_search$XAoAMiKHtWrMkOz.startimequit_if_one_screenscreen_trashedabove_mem$XAoAMiKHtWrMUNz.attrdohelpml_shell$XAoAMiKItWrMUUz.optionis_utf8_well_formedback_lineset_status_coladd_linech_initforw_promptcalc_jump_slineauto_wrap$XAoAMiKItWrMUUz.quote_optnameedit_tagfilecmd_addhist$XAoAMiKItWrMUUz.L__optname$XAoAMiKHtWrMUNz.mid_ansi_chars$XAoAMiKItWrMUUz.K__optnameprogname__xargcno_back_scrolldel_ifilesnprintf_lib_versionch_ungetcharforw_raw_linejump_loc$XAoAMiKItWrMUUz.P__optnameget_scrpos$XAoAMiKItWrMUUz.O__optnameneed_clrclose_getchrget_wcharerrno_messageecalloc$XAoAMiKItWrMUUz.T__optnamefindopt$XAoAMiKItWrMUUz.S__optname$XAoAMiKItWrMUUz.B__optnamestrncpycvt_text$XAoAMiKEtWrM06y.search_type$XAoAMiKItWrMUUz.X__optnamememcpy$XAoAMiKGtWrMEIz.ifilesget_term$XAoAMiKItWrMUUz.V__optnamefind_posquiteof_displayedopt__O$XAoAMiKKtWrMEdz.taglistopt__Popt__T$XAoAMiKItWrMUUz.m_optname$XAoAMiKItWrMUUz.u_optname_GLOBAL_OFFSET_TABLE_opt__Vat_promptatexit$XAoAMiKItWrMUUz.J__optnameshell_quotelesskeyopen_getchr$XAoAMiKItWrMUUz.e_optnameevery_first_cmdsetjmp$XAoAMiKJtWrMEbz.filter_infoget_quit_at_eofsize_helpdatain_mca$XAoAMiKDtWrMUzy.sc_clearpercentagebs_mode_environ$XAoAMiKEtWrMk3y.chardef$XAoAMiKEtWrM06y.fraction$XAoAMiKKtWrMEdz.totalfopen$XAoAMiKDtWrMUzy.sc_pad$XAoAMiKEtWrM05y.cmd_offsetget_cmdbufunsave_ifile$XAoAMiKEtWrM05y.cpget_indexcurr_altfilename$XAoAMiKJtWrMEbz.is_caselessquitting$XBoAMiKFtWrMEBz.metachars.mcharsforw_linefchmod$XAoAMiKEtWrMk3y.wide_tablestrncmpinit_cmdhist$XAoAMiKItWrMUUz.F__optnameopenquoteprevtagbelow_memchg_caselesscmd_putstr$XBoAMiKEtWrMk3y.prutfchar.bufautobufclear_cmdch_setbufspace$XAoAMiKEtWrM06y.optgetnameclr_hilitentabstops$XAoAMiKItWrMUUz.q2_optnameget_pos__environ_lock$XAoAMiKEtWrM05y.tk_trial$XAoAMiKHtWrMUNz.columnwscrollgettagtype$XAoAMiKFtWrM09y.list_var_tableslgetenv$XAoAMiKHtWrMUNz.linebuf$XAoAMiKDtWrMUzy.sc_deinitsignal$XBoAMiKDtWrMUzy.get_term.sbuf$XAoAMiKFtWrM09y.list_fcmd_tablesback_raw_lineinit_linemarkposprev_ifile_startquietless_is_morejump_line_loc$XAoAMiKDtWrMUzy.sc_move$XAoAMiKEtWrM05y.curr_mlistvbell$XAoAMiKEtWrM06y.save_hshiftseekableis_hilited$XAoAMiKKtWrMEdz.curtagbad_filepappendeqprotocvt_alloc_chposbinattrtgetentecmd_decode$XAoAMiKEtWrM06y.numbertop_scroll$XBoAMiKDtWrMUzy.special_key_str.tbuf$XAoAMiKEtWrM05y.tk_textinit_option$XAoAMiKItWrMUUz.r_optname$XAoAMiKItWrMUUz.z_optname$XAoAMiKItWrMUUz.b_optname$XAoAMiKItWrMUUz.j_optname_PROCEDURE_LINKAGE_TABLE_uncompile_pattern$XAoAMiKHtWrMkOz.sparewait_messagenamelogfileinit_charsetcat_filehomefilemlist_examinetowlowereditprotogetpidis_ansi_end$XAoAMiKJtWrMEbz.hilite_anchorsave_curr_ifileskipspcmd_char__fsr_init_value___Argvwritecfgetospeedchopline$XAoAMiKDtWrMUzy.costcountopt_bclear_attn$XAoAMiKDtWrMUzy.sc_returnshell_unquotepipe_markis_null_patternis_ubin_charcreatsize_linebufat_enteropt_ihold_ifileopt_jopt_kopt_lcs_aliases_finiopt_oopt_ppos_clearsigemptysetopt_tget_timeinitial_scrposopt_x$XAoAMiKHtWrMUNz.end_ansi_chars$XAoAMiKJtWrMkYz.table_sizeputbs$XAoAMiKEtWrM05y.cmd_mbc_buf_lennifile$XAoAMiKDtWrMUzy.sc_bl_out$XAoAMiKItWrMUUz.keypad_optnamejump_percentedit_listback_textlist$XAoAMiKJtWrMEbz.filter_anchoredit_lastopen_altfilemlist_shell$XAoAMiKEtWrM05y.curr_cmdflags$XAoAMiKJtWrMkZz.message__iobprutfcharis_ttypipe_data$XAoAMiKJtWrMEbz.search_infoput_wchar$XBoAMiKGtWrMECz.forw.first_time$XAoAMiKHtWrMUNz.mbc_posgetoff_ifilejump_sline_fractiondupputc$XAoAMiKDtWrMUzy.sc_s_inheld_ifile$XAoAMiKKtWrMEdz.curseqis_ansi_middle$XAoAMiKDtWrMUzy.sc_u_inerase2_charcmd_interrno_DYNAMIC$XAoAMiKDtWrMUzy.sc_b_outfexpandgetfractionclose_altfile$XAoAMiKItWrMUUz.o_optname$XAoAMiKItWrMUUz.w_optname$XAoAMiKHtWrMUNz.pendc$XAoAMiKItWrMUUz.g_optname$XAoAMiKEtWrMk3y.utfbinfmt$XAoAMiKHtWrMUNz.overstrikefgetcwerase_charinit_prompt$XAoAMiKDtWrMUzy.sc_s_outforw_textlist$XAoAMiKGtWrMEIz.anchortabdefault$XAoAMiKEtWrM06y.shellcmdsquishedch_beg_seekierror$XAoAMiKItWrMkVz.read_labeluse_logfile$XAoAMiKHtWrMkOz.poolcharsetsregfreesecurecleantags$XAoAMiKJtWrMEbz.is_ucase_patternchg_hiliteinit_textlistforward$XAoAMiKDtWrMUzy.sc_b_insprefixgomarkignawerrmsgsopt_quoteopt_promptlinenums$XAoAMiKDtWrMUzy.hardcopyedit_index$XAoAMiKFtWrM09y.list_ecmd_tablesbinary_charentire_file_displayed$XAoAMiKEtWrM05y.in_completionch_flush$XAoAMiKEtWrM05y.tk_tlistnl_langinforegcompsc_widthis_filteringquit_on_intr$XAoAMiKJtWrMEbz.prep_endposmissing_capfind_linenum__1cG__CrunMdo_exit_code6F_v_apply_at_specialsml_searchsetlocalech_forw_getsingle_char_optiontabstopungetccreopen_curr_ifile$XAoAMiKDtWrMUzy.sc_u_outprprotois_wide_charedit_prevcheck_winchprewindreading$XAoAMiKItWrMUUz.follow_optnameinit_mark$XBoAMiKItWrMUTz.propt.buf$XBoAMiKDtWrMUyy.quit.save_statuspclosetagoption$XAoAMiKItWrMUUz.t_optnameis_filtered$XAoAMiKEtWrMk3y.comp_table$XAoAMiKItWrMUUz.d_optnamecalc_shift_count$XAoAMiKHtWrMUNz.is_null_lineeditorjump_backclr_hlistforce_logfileclear_bg_etext$XAoAMiKEtWrM06y.mcaget_filestate$XAoAMiKEtWrMk3y.comb_tablepshift_alllen_cmdbuf$XBoAMiKHtWrMURz.getmark.smclosequotesqueezebo_s_widthpflushmbcis_combining_charfprintfstrcatnew_filesprintf$XAoAMiKItWrMUUz.query_optnamecurr_devch_getflagsfstat$XAoAMiKEtWrM05y.literal$XAoAMiKEtWrM06y.optflagundo_searchset_filestatesigs$XAoAMiKHtWrMkOz.loopcountso_s_widthonscreenpsignalsclear_eolprep_hiliterepaint_hilitebadmark$XBoAMiKEtWrMk3y.prchar.bufget_returnplusoption$XAoAMiKItWrMkWz.intr_to_abortsync_logfileset_filter_pattern$XAoAMiKDtWrMUzy.sc_s_keypadcmd_resetfindtagiswuppereditcharsc_heightpr_stringch_back_getfd0bo_e_widthcommandsscrsizeany_display$XAoAMiKEtWrM05y.cmd_mbc_buf_indexmain$XAoAMiKEtWrM05y.tk_ipoint$XAoAMiKItWrMUUz.q_optnamecmd_lastpatternforw_scroll$XAoAMiKItWrMUUz.y_optnamefgetsignore_eoiscan_option$XAoAMiKItWrMUUz.a_optname$XAoAMiKEtWrMU1y.thisfile$XAoAMiKItWrMUUz.i_optnameadd_hometableempty_screenbackwardadjsline$XBoAMiKDtWrMUzy.raw_mode.curr_onutf_mode$XAoAMiKJtWrMkYz.table$XAoAMiKDtWrMUzy.sc_initpos_initforce_open$XAoAMiKFtWrM09y.list_sysvar_tablessleepinit_cmds$XAoAMiKEtWrM06y.ungot$XAoAMiKDtWrMUzy.sc_addlinebl_s_width$XBoAMiKEtWrMU1y.end_logfile.triedregexecdispversionempty_linesch_seekmlist_searchso_e_widthget_back_scrollwprotoat_switchch_lengthadd_lnum$XAoAMiKEtWrMU1y.maxbufs$XAoAMiKDtWrMUzy.sc_visual_bellstore_pos$XAoAMiKItWrMUTz.pendoptfcomplete$XAoAMiKFtWrM09y.cmdtableeq_message$XAoAMiKKtWrMEdz.circularuse_lessopen$XAoAMiKDtWrMUzy.sc_backspaceset_open$XAoAMiKDtWrMUzy.sc_eol_clearnext_ifilepostoaopt_shiftis_dirkillstrchrch_end_seek$XAoAMiKEtWrM05y.cmd_mbc_buflongjmpioctlput_lineedit_stdinmatch_braccurr_tagul_s_widthbin_filetgototgetstrcontrol_charedit_first$XAoAMiKHtWrMUNz.mbc_bufpr_typestrerrortgetflaghilite_search$XAoAMiKEtWrM06y.bottomposbl_e_widthpercent_posinit_signals$XAoAMiKEtWrMk3y.ubin_table$XAoAMiKHtWrMURz.marksch_getset_attnpos__ctype$XAoAMiKItWrMUUz.n_optnameml_examinepdone$XAoAMiKItWrMUUz.f_optnameline_leftlsystemrepaintspecial_key_str$XAoAMiKItWrMUUz.pound_optname$XAoAMiKJtWrMEbz.prep_startpos$XAoAMiKDtWrMUzy.sc_e_keypad$XAoAMiKDtWrMUzy.sc_lower_left$XAoAMiKEtWrM05y.cmdbufis_at_equivraw_modeadd_ecmd_tableeditfollow_modeadd_fcmd_tableabsul_e_widthprcharno_keypadtwiddlelinenumtoaintreadfilesizeplinenumtgetnumstep_charstrcmp$XAoAMiKEtWrM05y.tk_original$XAoAMiKEtWrM06y.pipecis_ascii_char$XAoAMiKItWrMUUz.oldbot_optnamech_telllglobch_closetagsearch$XAoAMiKHtWrMUNz.pendposfinal_attr$XAoAMiKEtWrM06y.ungotp$XAoAMiKItWrMkWz.obufset_mlistget_filenameungetsctoggle_option$XAoAMiKJtWrMkZz.M_proto$XAoAMiKEtWrMk3y.binfmtfilenoshow_attnsetmarklastmarkshell_coptionadd_forw_possquish_checkclear_bot$XAoAMiKItWrMUUz.k_optname$XAoAMiKItWrMUUz.tilde_optname$XAoAMiKItWrMUUz.s_optname$XAoAMiKDtWrMUzy.init_done$XAoAMiKHtWrMkOz.freelistknow_dumb$XAoAMiKFtWrM09y.edittable$XAoAMiKItWrMUUz.c_optname_get_exit_frame_monitor$XAoAMiKDtWrMUzy.attrmodeend_attnpos$XBoAMiKItWrMkWz.error.return_to_continue$XAoAMiKJtWrMEbz.hide_hilite$XAoAMiKItWrMkWz.obputchrstrcpykill_charsavepopen$XAoAMiKHtWrMUNz.mbc_buf_indexglineedit_nextoldbothprototcsetattr$XAoAMiKHtWrMkOz.anchoratoipositionfcmd_decodematch_pattern$XAoAMiKDtWrMUzy.sc_eos_clearfsync$XAoAMiKHtWrMUNz.lmargin$XAoAMiKJtWrMkZz.e_protonopendopt$XAoAMiKHtWrMUNz.cshiftctldisp$XAoAMiKJtWrMkZz.more_protosave_cmdhistshift_count_fractionPCfindopt_namecvt_length$XAoAMiKJtWrMkZz.s_prototputs_edatacurrline$XAoAMiKJtWrMkZz.h_protolseek$XAoAMiKEtWrM06y.optchar$XAoAMiKEtWrM05y.cmd_colis_composing_charopenedisattypr_expand$XAoAMiKHtWrMUNz.last_overstriketcgetattr$XAoAMiKHtWrMUNz.curr$XAoAMiKJtWrMkZz.w_protolibcurses.so.1SUNW_1.1SUNWprivate_1.1libc.so.1libz.so.1libintl.so.8libgen.so.1/usr/local/lib%0 ='% Nq%% ='% Nq%8@p!0#P` kQ I@x`^ @`_ @`_ W@`cDU# @``0 ~@`.{vY )@`r& @X`>; q [`+p @ "cآ`+p @ rc`+p @ ra@, @`+p ' \ t+``+p ) -`-!8 `?-!8 =--%!8 !8#0@J`+p ʐ @C"`*p  Z!H `*p  Z!P@/@/@ @/@5A@`Ԯw'w_\ cX]t`_ wG$ ' bH]$``]@DFw_׀h _L H bH]$`@ b]$ @@B'@@`)@.@W@ScX]\ cX]\ @@w_cX]\ h_L?`]L HH _נ$ w_cX]\ o_`]@@Ԓ H `]$`@`]D H` ]Hw`(]w_@CՐw_׀h_@@~G HL_\ L -H_\ L +H_\ L  H@H5_\ w_ wG$ '_`0]@@‚ HH _@~dG H_\ L -H_\ L +H_\ L  O@O@H@@  `]D H @uH b]$``8]@C^c ]t c ]\ h c ]\ L H!`@]@CFc ]t c ]\ h c ]\ L H `H]c ]t``P]@C'`]t `]\ h `]\ L H `X]`]t`wc ]D H ``]_ߐ@@XbwG'G$ 'G'Gǀ H$_\ @Mw_h_\ w_ w__ߐ@@XB@WwG'G$ 'G'G Ob]D H@W H @J H@KH@Ie H @K @I  O@Y b]D Hb]D H`h]@@t@@ @[ c]\ hc]\ `p]@@b H5@W H `x]@Ԓ@ c]\ @@,H@ @=a@]t a@]\ ?h@ a0]D a@]$`H@Wb H @JsH@ H @HH@ @@6@ې  'G< 0w_@  @w__@@_w_0A@c\w''G@@w_瀤h_H w`]@M@ w_@w_L H_L H_ w_L O_L O_w_ ww' '_L HL_L 'G뀤HGۀ H G〤 aH G〤 zH?H8'G〤 AH G〤 ZHG '_L 'Gۀ H G߀ AH G߀ ZHGߠ 'GG߀HHG۠ '_ w_w_ w_L OG'G< @A@`w'G H c]D 'HGc]$` c]$`@Er@,`]D H b]D H@ @J@>@ @G@ݐ A@cw'G`8]D HH a]$`GHa]D א@@`]D H`] $`@O$ `]$`Hp bP]H|4` bP]Hv4` bP]Hp4` bP]Hj4` bP]Hd4` bP]H^4` bP]HX4` bP]HR4` bP]HL4` bP]HF4` bP]H@4` bP]H:4` bP]H44` bP]H.4` bP]H(4` bP]H"4` bP]H4` bP]H4`H@j O, 4#`<_ϠDa]$`bH]$`b]$` ?'! @'۠ ?'۠ / / / /H `]ׂ $`@O$a]D @0a]D א@`@.G`8]$`(@Xp0H`xA@c4ww`]@?w_׀hQ_L HL`]\ w_πh_\ _@@ H_\ HFw_\ w_πo  w__t _@  _t _\ `]_@@Ŕ`]\ _t`_`]t`_\ Hw`]@@_@@@?w_ A@aLww_~w_瀤h_L H _L 0H H' 'GH'b]D H H'_@~'G< 0A@`dww_Dw_瀤h_@hH'b]D H?H'_@a'G<  A@cwww_w_߀h_Hwb]D HHw__@@;w_ A@bwנ ' ' `h@( H〤 H'値 H'G H Gc]$`H+`]@>w_h _@c]$ H`]f'G뀤 H Gc]$`H c]$`G H Gb]$`H+`]@>w_h _@b]$ H`]2'G뀤 H Gb]$`H Pb]$` A@`w'`]wH`]ߐ@2wH`]ߐ@(wH`]ߐ@wHy`]ߐ@wHo`]ߐ@ wHea]ߐ@wH[a]ߐ@wHQa]ߐ@wHGa]ߐ@w_瀤h `],` `],``]wH+ `],` `],``]wHHwG (H$  O, < #b_נܠDOO_w_0X HpA@aܮwa ]@=w_߀ha(]wߠ b]$`_ߐ@@ڒ H b]$`a0]H b]$`@=a8]cH]$ a@]bh]$ aH]ؐc]$ aP]ϐ`]$ aX]Ɛc0]$ a`]'Gc]$`Gۀ H c]$`c]D `]$`c]D 'G`]$`Gcp]$`c]D 'Ga]$`Ga]$`c]D 'Ga0]$`G`x]$`c]D H `]D H a ]$``x]wah]@Òc]t c]\ h c]\ L b],`ap]@c]t c]\ h ax]c]t`a]@a`]t a`]\ h a]a`]t`a]@v`P]t `P]\ h a]`P]t`a]@]`p]t `p]\ h a]`p]t`a]@D`]t `]\ h `]\ L H b]$`a]`]t`a]@bp]t `]D Hbp]\ h bp]\ L H b]$`a]bp]t`a]@c]t c]\ h c]\ L H b]$`a]c]t`a]@˒`]t `]\ h `]\ L Ha]`]t` b]$`H b]$`a]a]a]b]b]b]@@@sb]b]a]b]a]\ b]\ @@@sb ]b(]b`]a]a]\ b]\ @@@sb0]b(]b]a`]a]\ b]\ @@@sb8]@,`]t `]\ h b@]`]t`bH]H bP]`]t`H#bX]@`]t `]\ h `]\ L H bP]`]t`b`]@w_hbh]w`]\ L Hbp]wH_`]\  @3 @@_w_@@ @w__bx]@@c]t b]@w_hb]w`]\ L Hb]wH_`]\ c]D $ @ @@z_w_@e@ @w__b]@@a]t b]@\a]t a]\ h b]a]t`b]@Cw_hb]wb]@3w_瀤hb]wc]D H _`p]t`H__b]@@a`p]t `p]\ L H c`]$`@A@cw'a]D  a]$`G'G< 0A@cww a]$`_c]D b]@@>a]D 'G<  A@btwwww_L H_L H  b]$`_H!w_L H_Hw_L H_Hw__@H_Hw_w_߰A@adwwwwwww_w__ǐ@]_t _\ h __t`__t`H!__ǐ@I_t _\ h b(]_ǐ@;_t _\ hb]_t`@A@`<wb]D H`P]\ c]D b@]@@a]D Hc]\ c]D b@]@@n`]D H ' c]D H@}U G 'Gc]D OH@ a]$`@A@bwa]D HH3a]D Ha`]\ c]D b@]@@b]D H`p]\ c]D b@]@@ a]$`@A@awc]\ b@]@ @@A@a,w`p]\ c]D b@]@@ǔ@A@`wa]\ b@]@ @@A@`Lwa]\ b@]@ @P@A@cw'`]\ G@ @hb@] @j@A@cDw`]\ L HH`]\ c]D b@]@@CP@|1 @A@btw`]D HH@A@bwc]\ c]D b@]@@@A@aw`]\ b@]@ @@A@a$w`]D Hbp]\ b@]@ @”H `]\ b@]@ @@A@`lwbX]D HHb]D HHb]D '@cG@ @A@cw'G@'G H a]\ b@]@ @`G H b`]\ b@]@ @QG H b]\ b@]@ @BG H a]\ b@]@ @3Gb]$`@A@bTwb]D H b]\ b@]@ @b]D H a`]\ b@]@ @b]D H a]\ b@]@ @b]D H b]\ b@]@ @ؔ b]$`0A@`w'G@<' 'GG< @b]D HG4@''G@'G@'GG@ "H 'G< @A@cԮw'G H G`]D @'G @HG 'G ?'G'G< @A@c,w`]\ b@]@ @KA@bĮw''''G@ ?'G@~w_߀?h_@HGH b]@|Hb]@|H}@'G뀤 HG뀤?HGH b]@{Hb]@{H^GGOG$ 'G OGH@.GHb]Hwc]w_wנ '_ן'G뀤?H-GGHG 'HGGHG$ 'G瀤 HG@?  `?@'G@OH_ן'G뀤?Oc]@{㾀A@cw7`0]\ h?H'`0]\ \ `0]\ h&`0]\ \ w`0]\ \(8_\ h`0]\ (@_ (H _`0]\ (@@ ,Ht' '`0]\ \(8 ?'`0]\ Gۡ,0@\ 0w_`0]\ Gۡ,0@ h+_w_\ `0]\ \(8h`0]\ (@_ ( HHH_\ w_`0]\ Gۡ,0@ o_`0]\ Gۡ,0@ h`0]\ \ `0]\ h `0]\ \ \ ?h.`(]D H `0]\ D($ H`]D H`0]\ D(0`]D H @6H `(]$``0]\ \ w_w_\`\`t`_\`\`t``0]\ \(8_t` _$ (`0]\ Gۡ,0@\ 0_t``0]\ Gۡ,0@ _t`_`0]\ Gۡ,0@\ 0t`_`0]\ Gۡ,0@t`0`0]\ \(8,0 _ (@w@w_ǀ?h __ǀh?H'_`0]\ \((h,`0]\ D($ H ?Hr'`0]\ D( _ϐ@@J ?h c]@z9E?HZ'_`0]\ th(b]D ?Hb]D _`(@,`, '?b]$`H,`0]\ D($ H`0]\ \((a]L@_`(@,`, 'H`0]\ D( _( , !@@v'G〤?H?H 'G〤 H c]@yے 'bH]D Ha]D HG〤 Ha]D _`(@ ,G@@Ȕ`0]\ \((G@`0]\ th(_ (G4 @$G〤 HX_`0]\ thH`(]D HAG߀H @wc]@@z@  'ap]D H(c]\ @HG@'CGC H_Ob]\ h _Gc]\ h  c]$`?H{'c]D H?Hq'`0]\ \ _瀤hS_\`\`t`_\`\`t``0]\ \ _t``0]\ _t`_`0]\ \ t`_`0]\ t`_\`\`t`_\`\`t``0]\ Gۡ,0@\ 0_t``0]\ Gۡ,0@ _t`_`0]\ Gۡ,0@\ 0t`_`0]\ Gۡ,0@t`0`0]\ (@_ ( HOm_`0]\ (@@ ,'G< @A@`w'G?Hb]D ?Hc ]@xGb]$`@A@`dwa]D HH>`]D H(`0]\ \(H?h  `]$`c(]@x@?Hc]D HH@q?Oa]D @?a]$``]t A@cwǠ '`0]\ \((!#@<0?0p38p ww_׀hL '`0]\ \ w_`0]\ h$_w_\ _߀ha]D _`,`(@) 'H _\ w_`0]\ oGӀHG뀤H c0]@w '_ߠ w__׀o A@adww_ ?'`0]\ Gۡ,0@\ 0w_`0]\ Gۡ,0@ h_w_\ _h H'_\ w_`0]\ Gۡ,0@ o 'G<  A@`Lww`0]\ h H|'@1w_ h _߀?h __߀h Hi'_<0?0p38p w`0]\ D($ HD_`0]\ \((h;_}H5`0]\ \((_h H?'`0]\ \((_h@K?H H.'c]D H H$'`0]\ \((_o H'_`0]\ th8_H'@?Hc]D H H '@?O 'G< 0A@`w H HC'`0]\ \ w_`0]\ h H2'`0]\ \ w_`0]\ h_\ _\ h_w_\ w_`0]\ o_\ `0]\ th8`0]\ $(@ 'G< @A@cDw`0]\ h?H w`(]D H?Hw`0]\ D($ Hc]D Hw`0]\ \(Hw_@A@bdw`0]\ h?Hw`0]\ \(8,0 `0]\ (@@w_@A@aĮw`0]\ h?H5'd'G?H?H+'`0]\ (@#cH`0]\ (@ `0]\ $h@H`0]\ \(8 `0]\ th8`0]\ $(@G'G< @A@`w`0]\ h?HN'`0]\ (@ H`0]\ (@$ `0]\ $h@H6`0]\ \(8 h?H.'`0]\ D($ H`0]\ \(8$ H?H'`0]\ \(8$ `0]\ th8'`0]\ $h@'G< @A@bw'G H ?`]$`HG, !#@<`4 @< `]$``]D H `]$`@A@bw`0]\ hHu`0]\ D($ H ?`0]\ thHHd`0]\ \ w_`0]\ h?_t` _\ w_`0]\ o`0]\ D( @>`0]\ t(H`0]\ t((`0]\ t(8`0]\ $(@`0]\ \(H h?`0]\ thH`0]\ D($ ?`0]\ $h$`0]\ D( @ ?hc8]@t0A@cwߐ `0@w_h HI'`0]\ D(0 `0]\ $h0?_t` _w`0]\ _t``0]\ \ _t`_`0]\ \ t`_`0]\ t``0]\ \ 0_t``0]\  _t`_`0]\ \ 0t`_`0]\ t`0 'G< @A@b\w '`0]\ G,0@ `0]\ t`0`0]\ G,0@ `0]\ t`8G 'G @O@A@aw`0]\ \ `0]\ h`0]\ \ w_\`\`t`_\`\`t`_@`0]\ \ `0]\ o`0]\ $(0@'G @ ? 2h 'G< 0A@`4w''c]\ @C:`0]t `0]\ hh (P@`0]t `0]\ w_`0]\ t`_`0]\ t``0]\ $(0`0]\ $($`0]\ t((`0]\ t(8`0]\ $(@?`0]\ $h ?`0]\ thHG`0]\ $h$G HGH `0]\ D($ ?`0]\ $h$c]\ `0]\ @@Bْ`0]\ D( ?HG`0]\ $h @A@aԮw '`0]\ hHH`0]\ D($ HH '`0]\ D($ H`0]\ D($ H `0]\ D( @?`0]\ $h H 'GH`0]\ @`0]t c]\ @Bi@A@`Tw`0]\ h H'`0]\ D($'G<  A@c̮ww ' /c]w_L HiH# /H? /H; /H7G,`,`_L?$ 0@'HKcX]@rQꙐ H"_w_ w_L `bH%`. O, < #bx_נРDO`cOO_c]! h c`]@rg O_,`_ wG$ 'G뀤 O '_L O_c]!hO_,`_ w_c]! oT A@a4ww'_h_L H HY'a8]w_\ h__\ @@; H_\ wH _ߠ w_\ ob@]w_\ h#__\ @@ H_\ _\ h _\ $` H'_ w_\ oGH ch]@qw鿐  'G< @A@c\w 'GaH]  @ WH  Gc],@HGaH]  @ H  Gc],@H Gc],@G 'G!O A@b\wwww_h&`@]D H_w_L H_L H_L ~H_wH8_ߠ w_L O_h*_L H%_L *H_L  H_L  H_ @ nh_L *H _@ nh_w_L *H9H  `]H.$` `]H($` `]H"$` `]H$` `]H$`_L  sH  dO kOOO uOO_ w__t`@A@cĮwcp]@*w_ HH{cx]@*w_h _L H_ِHg@ 1w_v HH[c]@)w_hc]@)ܐw_h c]@)Ґw_h5_cH]@@ph _c@]@@fh_c]@@\h _c]@@Rh c@]% HH cP] @A@alwc] @0^c]@)ww_a]c]@c]@)fw_a]c]@0A@`ww`@]D H_@1H '_ w_c]L@ 'G< 0A@cww_ w_c]L@ 'G< 0A@c|ww_ w_ h `@]D H_ΐHc]c]_< @ @H9_ h c]c]@@H*_ h_ @Hc]c]_ @< @ @vHc]a]\ _@ @gc]w_ A@aww_ h ` ]c]@@tH_ h3_YH-_ @RH` ]c]_< ,08<08 @@ @!H` ]a]\ _< ,08<08@ @H_@@H` ]a]\ _@ @H_#  h  '!?#wH4_ h H+'_(h H"'_#@h H'_#h H'_#h H'נ 'G'G'G'G'G' G` ],@G뀤 H _` ],`H0 G,@$   ,@` ],`G$ 'G뀤 H_ ? G` ],@_40wG$ 'G뀤 O` ]L _@` ],`` ]w_@/O H H,'O H H$'O H H'O H H'O H H 'O H H' 'G< 0w_ H HR'_ ,08<08'G뀤 H HD'G뀤 H _ H H8'H G  ,@$ < /_ ꀤH _  @ H H' ' G뀤H_G @ H H 'G 'GG뀤O 'G< 0A@ctwwHb_L < How_L` , L` ?< Hew_L` , L` ?, L` ?< HWw_L` , L` ?, L` ?, L` ?< HEw_L` , L` ?, L` ?, L` ?, L` ?< H/w_L` , L` ?, L` ?, L` ?, L` ?, L` ?< Hw_L "  O, < #b_D_ 8`8СA@aDwww`@]D H_ h_w_\ w_ߠ _t`__,`HD_(h!_w_\ w_ߠ _t`_40  _,`_w_\ w_Ϡ _t`_ ? _,`H!_#@h0_w_\ w_ߠ _t`_40  _,`_w_\ w_Ϡ _t`_40 ? _,`_w_\ w_ _t`_ ? _,`H_#h?_w_\ w_ߠ _t`_40  _,`_w_\ w_Ϡ _t`_40 ? _,`_w_\ w_ _t`_40 ? _,`_w_\ w_ _t`_ ? _,`H_#hN_w_\ w_ߠ _t`_40  _,`_w_\ w_Ϡ _t`_40 ? _,`_w_\ w_ _t`_40 ? _,`_w_\ w_ _t`_40 ? _,`_w_\ w_ _t`_ ? _,`H[_w_\ w_ߠ _t`_40  _,`_w_\ w_Ϡ _t`_40 ? _,`_w_\ w_ _t`_40 ? _,`_w_\ w_ _t`_40 ? _,`_w_\ w_ _t`_40 ? _,`_w_\ w_ _t`_ ? _,`A@cww'w_\ w`@]D H.G H__瀤h _L '_Ǡ wG'GH' 'GwH__瀤h _Ǡ$ w_L H'à 'GwHIG H_L '_GӠ@_瀤hw_wH _w_GӠ@wH*__瀤h_L? H_Ǡ$ w__瀤h_L? O__瀤h _Ǡ$ w_wHw__t`_w_߰ ww'__\ h H9' 'G$ 'GG〤H-GG@<` @< '__Gۡ,0@\ hG۠ 'H__Gۡ,0\@hG۠$ 'H H 'GG〤O 'G< 0A@cww_c]@ 'G< 0A@cww_a8]@!'G< 0A@cww_`]@ j'G< 0A@bwww '_G,0c@]\@h_G,0c@] \@h H 'G 'G瀤  o 'G< @A@aԮwah]c]t` c]\ ,` b]$` c]$` c]$` aX]$`@A@aw b]$` b]$` aX]$`A@`www_@%w_L Hm_wע_ߐ@ *w__׀h_L '_ wG'G@g__׀ o`@]D Hb]D  b]$`b]D  b]$`H-_ܐH'__@(H_@  'G'b]D GӠ@b]$`b]D GӠ@b]$`_w_L O A@bwah]w_@w '_L H_@ G '_L OG'G< A@awww'wwG뀤 H#_< w_߀h_׀h_@Y'_߀hG_$`_׀hG_$`Hp_ϐw_߀h_׀hd_3H_߀h_$ _׀h_$ HP_;H_@'_߀hG_$`_׀hG_$`H6ah]@?w__@NH_߀h_$ _׀h_$ H_߀h _@  'G_$`_׀h _$`_w_ϰ www_\ w__@Ð@ Ҕw___\ $__@@:w_߰A@blwwww_\ w_ah]@?w_\ __ר$__@@ w_߰ A@awwc]\ L H7c]\ w@wb]D G@b]D HH_c]t`_@fb]D G@b]$`c]\ L Oc]\ L H$c]\ w@QwG뀤 HH_c]t`_@eҐc]\ L Oc]\ _h @c]\ _o0A@cwb]D b]D H8c]@0G'G$ 'G'G HG'G$ 'G'G瀤 Ob]D G$@b]$`b]D b]D Oc]D ah]@c]t` A@bwc]D ah]@w 'Gb]D b]D $@<` @< H'_L H"@GG@'Gb]D b]D $@<` @< H_L O_L H_wߢߠ@pG瀤 HH _w_L O_ah]$@c]$`c]\ w5_0A@`,wc]D ah]@w 'Gb]D b]D $@<` @< H+_ah]h$@CGG@'Gb]D b]D $@<` @< H _ah]o_ah]$@c]$`c]\ w_B A@bwc]\ L H Hp'c]\ w@Ɣwb]D G@b]D HHb]D G@b]D $ H c]\ L  H_c]t`b]D G@b]$`_@dc]\ L H@|wG〤 HH_@d_c]t`c]\ L O 'G<  A@`lwc]\ ah]h HZ'c]\ w_ah]h@\G뀤 HH _ah]ob]D b]D G@H_c]t`b]D G$@b]$`G'G$ 'G'G߀ HG'G$ 'G'G׀ O 'G< 0A@bww'ah]@G! h HP'ah]@ah]w_c]\  h_L`G,@_$ w_c]\ oc]\ w_c]\ G@h_L _,`_ w_ w_c]\ G@ oc]\ ِ 'G< 0A@`Ԯwc]\ ah]h HI'c]\ w_c]\ $@'c]\ w_GL@,`_L HH_ wOc]\ ax]D Hc]\ ah]h c]\ L H H' 'G< @A@c<wc]\ L H H' 'G< @A@bwc]\ ah]h2c]\ L? H*c]\ ah]hc]\ L? HNc]\ ah]h c]\ L? OH(c]\ ah]hc]\ L? H&c]\ ah]h c]\ L? O 'G< @A@`wc]\ L Hc]\ L H Tc]\ L OH$c]\ L Hc]\ L H8c]\ L H c]\ L O 'G< @A@cwah]L H H!' c]$` c]\ ,`c]\ Yax]D H H' 'G< 0A@bww'_`]t`Gax]$``]\ h `]\ `]\ t`0A@b w'`]\ h HS' G H`]\ \ \ `]\ t`H `]\ \ \ `]\ t``]\ \ \ w_hc]wah]_@@Sah]c]t`c]\ L H c]\ L O 'G< 0ww_@ hH/_\ w__h _\ _@@  H  (w__t __t`_\ _t`__\ t`__t`_\ _t`@A@cLw`]\ hH`]\ ah]@ `]\ $` 0A@bw' '`]\ hG '`]\ b]\ hG 'GG@@̒'H1 b]$`'HP b]$`X'HF b]$`c]\ L Hc]\ L Hc]\ L H c]\ L Oc]\ L H c]\ L O H ' b]$`c]\ ah]hc]\ L? Hc]\ ah]h c]\ L? Oc]\ ah]hc]\ L? Hc]\ ah]h c]\ L? O H' b]$` c]$`c]\ a H' b]$`c]\ L H c]\ L O H' b]$` H' b]$`m'Hu b]$`'Hk b]$`'Ha b]$`'HW b]$`A'HM c]$` HE' b]$`GH;'G@YH6' H3' b]$` H+'G`H%` O, < #bP_ĠD`eH%` O, < #b\_DOOG<  40\ w_@w_w_L H_wϢ_א@ __$@N'G〤 HOGH '_L O 'G< A@cTwǠ ' '@#w_@ΐ'c]\ L H.c]\ L H&c]\ L Hc]\ L Hc]\ L H c]\ L OHc]\ ah]h c]\ L? Hc]\ ah]hHwah]w_c]\ h_L HH _ w_c]\  o_c]\  hc]\ Hkwah]w_c]\ h]G߀H 'HJGӀ H _GӦ@c]\ h__GӐ@@ H  '_GӠ$ < @wH(G〤H_L c`]L H 'H_L `]L H 'H _L H_ w_ w_c]\  o_w_0A@cLw`]\ h `]\ @`]t w_hHr_`]t`a]\ ha]\ @bc]\ _$@  a]t a]\ _c]\ $@@}c]\ L / c]\ ,`_L `]L H _@$`]t H_ @"w_瀤h _ @$ڐ`]t H _@$ѐ`]t _@ Oc]\ ,`0A@`w'wHb]_@@Hwb]_@@ޒH wG O Oc]w_0A@`$w'b]D HG H7$`]\ hQ H'G H `]\ `H]t`H b]$`b]`]\ @@ɒG`H]t HG`H]\ @`H]t c]\ `]\ hvc]\ `]\ o`H]\ h b]$`a]\  HHIHD`H]\ t HH<`H]\ @'yH0c]\ ah]hc]\ L?c`]L H&c]@w_h`]w_= HH H ' b]$`ߞ 'G< 0A@`w'`@]D H G`],` 'HaX]D H3 `]$`G`],`G H  aX]$`HG HG H GiaX]$  H'F H'HCG H5`]D 'G `]$`GG`],@`]D aX]D H Hi'`]rH  aX]$` HW'H  aX]$`OaX]D ' aX]$`c]D H c]$``]G@ےH-'@H G HGǐ'HGH'HG H , < #c_ߠD`]G@'G< DA@awwwah]w_L 0H_L 9H_ߥ,p,p_L $ 0< @w_ w_L 0H_L 9O_t _L '_ wG'GӀ .H ې@@V_t _w_@A@cĮwah]w_@A@ctw`]\ hH w`]\ \ \ \ w_ A@bw`]@ߐw_瀤h"_L H_`]@@ H _`]@@ HH;w_ӜH6w` ]@w_h_L HH%w_@`(]@z@ 'G Ӕw_G`0]_`(]@@@B_w_ A@a4www_hH_`8]@@7w_@_瀤hH_@"@/h`@]`@]@#@@ H_@ Ha_@"@hUwL H_L H_L H _,`H _ߠ w_L O`H]@@ H`]wH`P]@@ Hap]wHO "H _h_@_@"@o_@ A@bwww '`X]@Őw_߀h_@'G뀤 H d'_\ w 'G뀠H_\ hH _\ wG 'GG뀤O_\ w_\ h_``]_\ @@s_\ w_\ o㾠A@a$wW 'w_hH|`]D H 'ap]D H 'G뀤HHd_`h]@@w_@֐_hHS '_@+g@0'cGc H w!< @# H 'G瀤H_@@!!_`p]`@]@@_`p]`H]@@`]_@0_`p]`P]@@ap]_@_@ϐP@gIܗ@W A@bw'ww'Gc8]$`{O_j_G@ߒ@A@bwc8]D H c8]D H H' 'G'G< @A@alwcp]D !@H  7c8]$`Hcp]D H  c8]$`H c8]$`cp]D !H`x]cp]D $H`]cp]D "H`]cp]D H`]ڐcp]D !@H`]͐cp]D !@H `]Hcp]D H `]ﲐH`]𢡄b]\  0A@cwc]D @'c]D ?'G H`]Hw`]w_w /c8]$`ۀT_o`8]D H_eGH`]\H`]UH`]NH G O O @A@a|wfwH_`]\ < @@ƒHcp]D !cp]$`_cp]D @@meH _L +H_L H_ w_L +O_L Oc]\ hc]\ @ѐ_L Hc]t H _c]t Hb]L _c]D @@N b],`H_L`L``]\ < @ ,H_L`L``]\ < @ HbH]D HH_@@n{H_L !Hb ]\ hb ]\ @i_@,b ]t bH]D HHpb ]\ h `]`]@@AŒH b ]\ `]@@AHRbH]D HHIa]L _@@Bx`]@WH9c8]D `#H`H` H`OH'O` OH O`OH`/H%`# H, < #`_DO3`7OA@`|w'HD H' H'G 0HG 9H G .HG@G  dHc]`]t  c8]$` Hn'H<b]L Hp@ Hkc]D ?'G뀤 HH  `8]$`  HJ'G _OHOH<G$ @  'Gc]$` H2'G$ @??  'Gc]$` H 'c]D  @c]$` H' `8]$` H'G +H  O !OHO -O`8]D HG HG H$b]L Hlw`]ߐ@@V H' `8]$`b]L 'Hb]L H Ga]D HGa]D H GbH]D H H' H'G H H'#w_L aH _L zH H'Ǡ 'G'ˢϐ@@R w_׀hQ_L b],`GˀHb]L aHb]L zH b]L $ b],`__w_L H%_L 'GˀH G aH G zHG$ 'G H H2'_ w_L O H''H%Ga]D HGa]D H GbH]D HHb]L HHGb],`c]D ? HG@N{HGa]c]D @@Lh H'G@Nw_h  -/G/ /w_ /  H' HH 'H+c8]D 7H"'HFc8]D 7H$'H;c8]D 7H 'H0!'H,!'H(G H H  O OHO OH *H  O !OHO @OG뀤 Hcp]D G@cp]$` HZ'H(c8]D H H OHO OH /H  Ow OHO 7OmG HG HG H%'Gu H H'c8]D #H c8]D $H  H& H' 'G< P] HH@:@b@A@alw@XHa@]\ ?h@)_ H a@]\ a@]D @@)RH4c]D H-`]D '`(]D ' `]$` `(]$`c]D H@`@'@(G`]$`G`(]$`@A@cwa]\ ha]\ `h]hHu@V?a(]t @O H@H H c]\ @"h̜ b]D H@H H c]\ @"vh c@]D HւV c@]$`@^w@hHa]@RT_h_L H@R :H ֑ _@RB@A@aw`]wa]@@S0A@a<wa]\ h@q'HNa]\ `h]ha]\ $ w_a]t`_L H5'a]t  H@WH@q'H"H  gH' H'@q'Hc8]D H  O OOOOG< 0A@cw'a]\ h `h]a]t`a]\ `h] d h a]@SP˘ a]\ w_ a]t`G_,`@w_@$ w__ h_L _$ w__o A@bww' '@Vwcp]D $H%cp]D H@C'H@V'GH_@\Hi 'cp]D ;cp]$`cp]D _G@@eU'cp]D ?cp]$`G H_@4HAG HH%cp]D " HHcp]D H@ 'H@ 'GHH 'OG Ha ]@RG〤H_@ H_@A@cw cp]$`c]D  <` @< `X]$` e' c8]$``]t  b],`c]D H @gc]D Hʈ?Ӵ6c]D HOG뀤 eHK'c]D HOG뀤 eHG' e'HSc8]D HH ,'OOHGR H , < #`_Dc8]D HG- H HO[wHG/ݠ /ޠww_ߐ@@ .'_߀h_G HHa(]  O`]\ h `]\ `]$``]\ h @E: `]t`Oa]D Ha(]\ @$~`]\ <  @ H`]\ h `]\ `]$``]\ h @E: `]t``]\ <  @E H`]\ h `]t`a]D H`]\ ha(]\ @$'`]\ <  @ H`]\ h `]t``]\ <  @ H`]\ h `]t`a]D H`]\ ha(]\ @#`]\ <  @d He`]\ h `]t``]\ <  @ HL`]\ h @D: `]t`qa]D Ha(]\ @#`]\ <  @# H$ HHO@# `(]$`c]D H  @ c]D O `(]$`c]D H c]D H 2'H`]\ h `]\ `X]$` a]D Ha(]\ @#:`X]D  @ H`]\ h `]\ `X]$``X]D  @ H@$H`]\ h `]t``]\ @#H`]\ h `]t c]t `]\ dh  d`]t`c]t `]\ < c]\ @@#ВHW`]\ h@#H`]\ @#SHBu`]\ h`]t `]\ a0]D @@#H( HH S@ZWwa0]ϐ@@OHEH c]\ h Hb]D `]$`@z  HH_߀h_L ǫǩ H cp]$``]\ h `]t``j'O cp]$``]\ h `]t`HR'O! cp]$`;E'O`]\ h `]t`(`]\ < Hcp]D "cp]$``]\ h `]t``]\ < ђHjcp]D 'cp]D H cp]D ? H 'cp]D ? 'Gcp]$``]\ h `]t`o`]\ < Gcp]$`H+cp]D 'cp]D H cp]D ? H 'cp]D ? 'Gcp]$`cp]D "cp]$``]\ h `]t`'`]\ < OGcp]$`H@[H۲ HH `]D b]$` `]$`a8]@ HbH]D H a@]@N-HaH]aP]\  @ ?'ObH]D H a@]@N He HHc]\ @`]@x H aP]@MHtc]\ haX]@M`]c(]\  @ `]\ @W @7sHL@eH a`]@MH?`]\ h `]t``]\ < @H-@HHH@H  Hڐ `]\ hah]Hwap]w_wax]ϐ@@MwH@eiH a]@MjH`]\ h `]t``]\ < @aH`]\ hah]Hwa]w_wa]ϐ@@M9H`]\ h `]t``]\ < @dʐw_h a]@MH_@  H@dw_?h _a0]D @@!H`]\ h `]t``]\ < @dw_h a]@LHg_@  H@dRw_?h _a0]D @@!SHP`]\ h `]t``]\ < @ ސHa]@LH2 HH*c]\ wc]\ @,w_heH_@  H_@H _@H c]$` `8]$`#'OH c]$` `8]$`'O7`] ! u'O*bH]D H a@]@LCH`]c(]\  @ U'O ي HHa]  @'Ga]D HGa]D HGbH]D H G HG HHG@8H}a]  'Ga]D HGa]D HGbH]D H G HG HHPG@8HIbH]D H a@]@KH:a] %w 'Ga]D HGa]D H GbH]D HHG HG H .'G@8HHGa],``]c(]\  %@7 'O@Ga]@) }'O2`]\ h `]\ cP]$`HcP]D HcP]D H 'b]D <` @< 'G`]t``]\ `]D h `]D `]t``]D `]\ < $@`]$` c]$`H`]\ h `]\ cP]$`HcP]D HcP]D H 'b]D <` @< 'G`]t``]D `]\ < @`]$` c]$`HJc8]D Ha] ~ G'OH/zH+G`2H%` -O, < #`_HD`eH%`2 O, < #`_DOOOT4  ,Dp pXd p    x$ `l |LLt d XTp 8 00A@}bw''`@]D HG, 'G 'G< 0'G wߠ 'GH?_G,0$@G 'GGO_w_wwww'_߀h __D @wH_@Xw_w_w__h__$@'__$@'_@ SwG۠ H&_ h"__h_Ϡ$ w__h_L H_L O_L OHSG۠ H)_ h_ h!_Ǡ w__h_L '_Ǡ wG'G@&3HH__ oH(G۠ H_< @H_< @: w_@}_瀤h_G,0D@ HG_G,0$@__ ouG۠ H__h _L? H_Ϡ$ wϠ _,`_߀h__$@_$`_瀤h __$@___$@,0$A@|bww'_w__G@h_w_L HI_L H_L _,`_ w_ߠ wH3_L +w_L  '_Gˠ@w_πh _@Q: GˀHa]w_L H_L _,`_Ϡ w_ߠ w_L O_L O _,`_ߠ w__瀤h  _,`_ߠ w__瀤o_ w_L '_ wG۠ H_L '_ wG'GÀ HH_L '_ wG'G O__G@ oo@A@{cdw`]!@eb] @a]@ a]a]@@ a]b]@@ 0ww'G뀤 H H$'  @w_߀h?H'_G@__t`_G@_t`_\ _t`__t` 'G< 0A@{aww'`]_G@ Hb]@G0A@{aww'b]_G@ Hb]@G0A@{`www'__G@v Hb]@Gwwww_t _w_w__瀤h_L _L H6_L H/_Ϡ w_L 'GÀ H _Ϡ w_L 'GÀ OGÀ gH fHy'Gà H _Ϡ w__t`Gà ?'GHi'HX_L H H_'_L H _L  gH fHR'_L '_Ϡ wG'G HH_L '_Ϡ wG'G O_L H _Ϡ w_L O_L H_Ϡ w_L H H_Ϡ w_L O_$ w_Ϡ w_w_Ǡ w__瀤 od d'Gۡ<  www d'_w_׀h__\`\`_@0'GӀ dHH _\ w_׀oGӀ fH d'G'G< 0A@z`<www`]\ __@'G< 0A@ycĮwwwb]\ __@'G<  A@ycLww``]\ _ߐ@}'G뀤 H_H%w_@w_߀h _L H_Hw``]\ _ߐ@['G뀤 H_Hww_ w_w_\ w_ߠ _t`_L '_w_\ w_Ϡ _t`G_L , @'G'G< @w'_G$ < L@ H _G$ < L@ H?H '_G@ 'G< A@y`ww''_G$ < L@ EH_G$ < L@ nH _G$ < L@ dH?Hd'_ w_L '_ߠ wHD~'_Gא@_Gנ@wHHo'_Gא@_Gנ@wH9`'GH``]Hw``]w__Gא@_Gנ@wH H'?H'Gۀ vH  cO eOOO xOOOG< A@xbww'bH]D H H'_@w_@~ '_@~LGӀ H Ht'G@,w_߀?h_߀ hG@~.?Hb'_ߡ< <  @}w_瀤hG@~?HP'GӐ@} ?h _@~G@~ ?H?'G__ߡ< 4@@~wG@}__߀h_@}?H''_L H_L  MH _L  +H_L  GH __ߡ< @H '__ߥ< G@ڔ'G<  A@x`www'_h_&w_߀h_wHG뀤H_wH_@ Dw_߀hH_G@, H _wb ]א@@DX_@}A@wbw''Ga]D H Ga]D H H'GbH]D H H' 'G뀤 H@'GG,@ G < ,@G 'Πߐ@'G OG HH d'H G O OG HH d'H G O OG HH d'HG$  H , < #b_DG HG dHG뀤 HG$ 'GL@AG뀤 OH _߀h_rG'G< A@w`www ' '@w_@{'_B_t _\ @{_t`_w__\ hYG〤H 'HHGӀ H_GӦ@_\ h__GӐ@@| H  '_GӠ$ < @wH(G߀H_L c`]L H 'H_L `]L H 'H _L H _,`_ w__\  o0ww_h_\ wH_@{yw__\  hHw_L H _ߠ w_L O__\  hHw_w_0ww_h_\ wH __\ hH5w_$ w_L H _ߠ$ w_L O__\ hHw_L? H__\ h_ߠ$ w_L? H__\ o_w_0A@uc̮wc]\ hHE@F_?h c]\ @@@/&^c]\ hc]\ c]\ @qb]\ @@ bc]\ @{rc]t c]t c]t b]t 0A@ubdww_h@H '_c]\ @@@'G< `A@ua̮ww_c]\ h H'H@:wc]\ h@'_G㠌 H_@t H _@ڐa(]\ w_h_@8 H|'_@>ww_פ@@ !w_h_Hw_w_w_@vwǠ '_hG 'H_b(]@@z H c]D 'G 'H_b0]@@z H ?'G 'H~_@ w_h0b8]@@Ah_@z_h ___@@ t_@z_@Z_@z_@z~__h _@Ɛ H'_ǐ@z 'G H_@>wb8]@@A-_@zZOG '`X]D H%_@HG@QH_wb@]@@A'G뀤 yH G뀤 YHG@z%O_h _a(]t`_@__c]t`_c]t`_b]t`c]\ @Dc]\ a@]@@( c]$`GG@*G H7`]\ hb]D H`]\ @_Ǡ@@yȒ'G H _'b]t`_c]t`c]\ hc]\ V_@y`]D `?'G'@>8 `]$`b]D H$@C@&D@NPaP]\ _א@’G瀤Hbp]D H _wb8]@@@P_@y} 'G< A@sbww@wwߢ_@wע_א@w_׀h>_@wϢ_ϐ@wǢ_ǐ@w_ǀh_ H _߀h c]\ @!wߢ_ǐ@w_ǀo_@y#_א@w_׀o_߀h_@R H'_c]\ @@ْc]\ h_@= H '_@I_'G< @A@s`wc]t @ 'G< @A@s`<wc]t @ 'G<  A@rcܮww''G H_@ Hw_@ ېw_wG$ 'G H _d HH_߀h H'c]D H H'_wO 'G< @w'_G@ 'G< @A@rb\w'c]\ G@ 'G< @w'_G@}?'G< @A@raw'c]\ G@`?'G< @'w_@ w_h H '_@ GO_'G< @A@r`wc]\ h c]\ @* c]\ w_@w_h_@?0w__@ w_@ ܐw_n HH_h _' HH_瀤h _L HH @w_@A@qbwc]D @vH bH]@>g b(]'G< @ 'G?H G@;'G?O@;0A@qa|wwC HH_@w_@w 'G@vG  6H 'GH c(]D H O'H _wbP]@@>]'H<_@w!a]$ HW_@wf a]$ a]D @v ?h a]D @v?a]$`H7_@vHJ͐ bX]@>#'OG aH DH AOOO OOO oH  aO dOOO qOOa]D H_wb`]@@=E_@vrH_@vmA@pbww_@u  w_w_L `]L H2_ w_L H(_L c`]L H_L c`]L HH_ w_L _,`_ w_ߠ w_L OH/@=w_@u['_L H#GӀ H__GӐ@@v2 H_GӠ@w_L _,`_ w_ߠ w_L O _,`_w_0A@p`lwbh]?w_hbp]w_w_@A@ocw`]\ hbx]`]t `]\ h b]`]t``]\ w_@/O@u 2h 'G< A@obwww_@t'ˠ 'Ǡ 'à '_w_L H4G۠ '_L `]L H _L c`]L H '_L HGˀ H 'HGGˠ@'_ w_L OGǀH GÀHHSw_@t^ 'Gې yw_wGǀH_Gb]`]L _c`]L @@@uH)_L H!_L bH __ϐ@@t8_Gˠ@w_L _,`_ w_ w_L O _,`_w_A@ncwww_h_L HHDw_@s_@s@ 'GӐ @sw_߀hH.w_Gb]_b]_@@@t_w_א@u  'Gπ H_@ttwHG@tf_@tk_w_0A@nbtwwb]_w_瀤h_Hww_A@naww '_w_L H_HK__h _LL`HG۠ 'H4_L`L`H._L %Hc]\ Hw_L #Ha(]\ Hww_w_w_ǀhG۠ 'H G_@ ܐ@s2@'HG۠ 'H _L #O %OO_ w_L OG۠  3w_w_w_L HpH\__h_LL`H _L _,`_ߠ wH=_L`L`H7_L %Hc]\ Hw_L #Ha(]\ Hww_w_w_ǀh _L _,`_ߠ wH__@ g@@r˒_@rwH_L _,`_ߠ wH _L #O %OO_ w_L O _,`_w_ A@mbwwbH]D HH4w_@rw 'Gې w_Gb]_@@sD_@{w_w__@@r_ H_@s w_@s_@s_w_ A@m`Ԯw' 'GH H]'G@r ?h HR'G@!@sj'G@wߠw_߀h:_ߐ@ wb]D H_׀ h_׀ h_ߐ@ w__߀h_@&OH _ɸHG '__߀ oG  4H 'G< 0'G@rO w_瀤?h?Hw_w_ w d'G w_w_@r'G瀤 HG瀤?HH.__ߤ$@G$ < hG, ' _,`G w__ߐ@@q_@r+_w_@qnwG_,`_נ wO _,`_w_A@la,wwb]nw_߀hI_L HD_w_πh _b]@@rwH0_@q)_@q%@ 'Gː ?w_Gb]@_߬_ϐ@@@q_@q_b]@@rjw_@qH _b]@@r]w_w_A@kc|ww_\wbH]D H_Hw_&ww_@pɐ hb]w_ w_h_@qo_Hwb]Րw_ǀh_L Hb]w_@p_@p@@p*0$@ 'G w_Gb]_`]L c`]L _@@@qTs_@q)mw_L H_@pfb]_L @@p_Ϡ w_L O_@pQb]_ߐ@@p_w_@p_׀h_@p_Hw_w_@q_L H _@p_@pݐ_H w_@pא_@pԐ_w_A@k`wwww '`]D H bH]D HHw?b]w_׀hHw_L |H_נ wנ '_L -H_נ wH_b]@@oԒ HH_w_@oĐ_@o@ 'Gː w_G__@@p_Yw_@p__hH9wGH%_@p'G@ @p h_@pH"wOA__t`G_$`b]Hw_ϐw_@p_L HHw_w_߰A@ja\wwwwbH]D HHB_瀤h_@pc]hw_߀hH/_@o8_@o4@_@o0@ 'Gː Jw_G___@@@o_ǐw_@o͐_׀h_@p~㾰w '_Uw_g@@o'G뀤 H w!< @#H H'c 'cGc'_@oG'G< 㾠A@ic4wWww_!w`X]D H_H_@n  w__@@n_c]@@nH8__@@oI'G〤 H_@2wH(`X]D HwHo!< @# H_@n * w__@@n_c]@@n_@o%_w_'Go@@oy H_HwGw_@A@i`wc]w_@A@i`w`]D H}HE0A@i`,w`(]D H H'*?h H'@8?w_?h_h H' 'G'G< 0H H'@7ݐ w_?h_ h H' 'G'G< @A@hbwb(]D HH  b(]$`@ A@hbDw'w''' 'ߠ 'G瀤H Gc]D $ H` ]D HG` ]D HGc]D $ H H'Ӡ 'G'G׀HM`]D HGc]D $ Ho_h @8 _@7 '_@7@?h@8H"@7_@7} '`]D HHa]D Hc ]@2ҐG$ 'G HG〤 H G$ 'G〤 HwH0_@Fw_?h( 'G뀤H @6 ?hH\ @8 H @8 Hc]D $  @8vHHC_@7G۠ 'G׀HH0a]D H"_?h`]D Hc]\ hc]D H  b(]$`H @1 c@]$`G$ 'G OGۀ HVHG׀H@ a]$`@U? A@gaw'w'' '@GHG瀤HGc]D $ H H'۠ 'G'G$ 'G H'_@=w_?hG뀤HH_@6G 'G߀H@1G$ 'G OG〤 HHG߀H@}H bX]D H@ސ?0A@fcw'''@.HH H = H HF@5ܐ?w_瀤?h5GH c]D $  @7gH&`(]D H@7AHwH@5   = @5?w_瀤?oHnH G_GG@ 0'''@5 w_瀤?hGH@5? hDH G_GG@@A@faTwc`]D H H '`]D H`]D H'`]D H c]D $ H'! #'G< 0A@f`lww'_b]h_ DG@$_\ w_b]o0A@ec̮www_hb]w_\ _t`__t`__\ t`__t`_D  _$` _\  cx]D  cx]$`@A@ebww_\`\`t`_\`\`t`_\ ?cx]D $ cx]$`0ww  @w__t ?_t`0 _,`(_$ $_t __@_w_0A@eaww_hH#_@b_c]\ h c]\ @rc]t _w__\ @k_@j A@e`Ԯww_hb]Hw_w_w_\ b]hHw_\ w_ A@e`$ww_hb]Hw_w_w_\ b]hHw_\ w_0w_ѐw_瀤h_Hw_w_瀤h_Hww_@A@dbwcx]D 'G< 0A@dbwwb]\ w_b]h__\ @@i H_H w_\ w_b]ow_0ww_Ȑw_߀h__@Βw_w_@w_hHw_\ w_@w_D 'G< @ww__ 0\t`\t`@ww_ 0_\t`\t`@w _,`(@w_L ('G< @w'_ $DG@$@w_D $'G< @w_\ w_@ww__t`A@cbww_?h@?Hwa ]D H@DH c8]D H`(]D @??  '_a ]D ,`@< Gː@@C_ZH@{?Hcw_wc]D H@m?HUw2'Gۀ?HHGۀ HH_$ wO@V_@_&_w__h9c]D H@<?H$w'G_ߐ@@'_ߠ wGπ H@ _GϠ$@wGϠ$ 'Gπ H GϠ$ 'Gπ O__o@X@ 'Gۀ?H@?HwGۀ HGۀ H H'ˠ 'G'c]D H@?HwGۀ HGۀ?H(@%'*wGπ Ha]D H`]D H _GϠ < $@wߠ 'H 'HFGۀ H 'G۠" @@'Gπ H0a]D H `]D H'Gۀ HGۀ?Owߠ 'Ӡ b]$`H GϠ"wߠ 'H'OGӐ@ _@=*H_wOc8]D H_" @ @=JH@ *ch]D H1G׀H-'Gۀ HGۀ Hc]D H@0?Hw'Gۀ OGۀ OGۀ?Hnw_w_A@acܮww_?h_ h@?Hbwa ]D H@C9H c8]D H_a ]D ,`@< hH w_a ]D ,`@< $w__@@AΔ?_$ H@?H&wch]D H@/-'xvGӀ HGӀ H/l'GӀ HGӀ Hc]D H@?HwU'GӀ OGӀ OGӀ?H@|?Hwc]D H@n?Hw3'GӀ H wH GӀ?HwHO_w_(H@I?Hw '@F_@_w_'GӀ?H c]D H@*?Hw_ wGӀ H @j'Gˀ Ha]D H`]D HGˠ 'H( 'HHTGӠ" @@ 'Gˀ H8a]D H `]D H  'Ϡ b]$`H&@G'Gˠ$ 'G'GÀ H_$ wG'Gˠ$ 'G'G OO__oGϐ@, _@;uH_wOc8]D H_נ" @ @;H@4 *_w_0A@`aww_?h"_ZHH:'G?HH1G HG HH_ wO_b]t`'_ wG?H G HG HHO_b ]t`0A@``wH c(]@,H1@c@/uw_w_?h c]D $ @H_c]D $ @@ c]D $ @._h@^0A@_clww_@w_?h_ Ha]D H_E_a0]D @@͒H$_ h Ha0]D @c0]@,,H _wc8]@@,!@@0d@/T_G@@ A@_a̮w'ww_߀?h c@]@,kw_߀?h cH]@+H_G_@@)w__߀h_ߠ$ w_a0]D @@ 0A@_`ww'_ H!'G HG?H 'G HG?OG Hjwa]D H__G@@  A@^cww'G@/'_@/+'G H+GG$@'G HG@-ݐ?@  4 H G @-А @ V a]D H@7ѐ H_H cP]@+1H@- w@-?w_瀤?h__瀤h[ 'GH8_߀?h"__߀hc]D G$@G@$ _ߐ@   a]D H@7 H_mw_?hH G 'GGO@ b(]$` c]$`c]D $ _GG$@  H]G'Gc]D $ H0_w_?hH&__瀤hG _@  a]D H@7. H0G 'Gc]D $ O@N`]D HsH c]$`_@-c]D $ _@ z @A@]cLwcX]aH]t aH]\ h aH]\ L H c`]aH]t`ch]ؐcP]t cP]\ h cP]\ L H cp]cP]t`$ `h]t $ c]t $a ]$`0A@]aĮwa ]D , 'G @bwG @b{w_h_瀤h_瀤h_@c _h_@c H9'_`h]\ a ]D @@c_c]\ a ]D @@cc]\ @b`h]\ @bې_`h]t`_c]t`Ga ]$` 'G< @w_  (h 'G< @A@\cw b]$` `P]$` b]$` a]$` b]$` b]$` cx]$` a],` bx]$`c8]D H bx]D  bx]$`A@\btwwwbx]D H_@wc8]D HK `h]\ b]D ,@b]\ ?h_b]\ h_b ]\ h @c]\ b]D ,@H  c]\ b]D ,@b]D  b]$``P]D  `P]$`bx]D H`_Ԑ@@'[@a4'Gπ H '`h]\ b]D @cx]GϠԐ@@aZGϠ 'Ϡ 'GπH c]\ b]D G@< ,G 'GGπOb]D GϠ@b]$``P]D GϠ@`P]$`bx]D GϠ@bx]$``P]D bx]D H2  `h]\ b]D ,@b]D 'G b]$`c]\ G,@`P]D  `P]$``P]D bx]D OA@[bDw'w 'G`P]D bx]D $@H `P]D bx]D $@'Gb]D bx]D $@H b]D bx]D $@'bx]D 'G'GGHGb]D H`h]\ GL@/b]D Hv h hn`h]\ G,@c]\ GL@c]\ G,@Gߠ 'G 'Gb]D HK`h]\ GL@HB`h]\ GL@`h]\ G,@c]\ GL@c]\ G,@G '`h]\ GL@'Gߠ 'G'G@ HHGb]D H `h]\ GL@OH- ' H=`@]D H62'GGۤ@b]D HH`h]\ Gߠ@Ðw_H__ǐ@H _ǐ@  'G'_wH' ' H`@]D H _H?H'ˠ?'G'H jH 'wG׀ H)GG$@ H#c]\ GL@c]\ G,@ `h]\ G,@ wG 'GG۠@'G 'HG〤 H c]\ G$ < L@H'ˠ 'G'GGۤ@b]D H c]\ GG۠@< LH'G'G'c]\ GL@GӐ@HMc]\ GL@Gϐ@ߒH@Gc]\ GL@@'GGۤ@b]D H Gc]\ GL@@'GGϐ@HGG@@'GGۤ@b]D HGG@@'GG$@G׀HHGG۠@'GGנ@'G瀤 H 'GGH Gb]D OHGb]D H(`h]\ GL@`h]\ G,@c]\ GL@c]\ G,@Gߠ 'G 'Gb]D OGb]$``P]D G$@`P]$`b]D G@b]$`@A@Y`w`P]D 0A@Y`w' 'G('G H Ga]D @'G H Gcp]D @'G H G`x]D @'G H Gc]D @'G'G< 0A@Xcw' 'G'G H Ga]D @'G H G`]D @'G H Ga0]D @'G H G`]D @'G'G<  A@Xblww'w_ h`@]D H _H?H'۠?'GH'`@]D H_tH_< ,08<08mH Hp'H_^H __@H H]' '_HGߠ 'b]D H$c]\ b]D $ < L@G@HGc]\ b]D $ < L@<'G# H!b]D Hc]\ b]D $ < L@G@HGGѐ@'G'G<  A@Wcw`h]\ b]D @w`h]\ bx]D @?wb]D bx]D H|`P]D bx]D Hqc]\ b]D $ < L@ 0Hb_`h]\ $@b]$``h]\ bx]D @?w_c]\ b]D L@_@'`P]D G۠$@`P]$`Gۀ H H*'_wb]D bx]D H`P]D bx]D Hc]\ b]D $ < L@ 0O 'G< 0A@W`Ԯw`h]\ b]D @w_`h]\ h(`h]\ @?1w_瀤 h_瀤 h H'_@JH H '_`h]\ o 'G< 0A@Vcww_H H'aH]\ _< ,08<08@@\ 2h 'G< 0A@Vbww_H H'_ÐH H'cP]\ _< ,08<08@@\b 2h 'G< A@Vb$ww'wwG 'G׀ HGb]$`_ߤ`ː@ @1vH G HG @'b]D HJ%HE_kH9_H3`h]\ b]D @wǢ`h]\ @?Sw_`h]\ h _ h_ o_`h]\ $@b]$` H'۠ ' 'H3b]D H_ h_ h ' 'H`h]\ b]D @wǢ`h]\ @?w_G_@I'b]D H`P]D Gע@G@b]D H Hl'_瀤h _/Ҡw 'H_L 5'b]D GӤ@a ]D $ H 6H HE'G'GӠ$ 'G'Gǀ H._L `h]\ b]D ,@_ wGc]\ b]D ,@b]D  b]$`G'GӠ$ 'G'G O`P]D Gנ@`P]$` 'Gۡ<  A@UaDw'w`P]D b]D @bx]D $@'`@]D HG`@]D $ < ,0b]D@H%b]D G`@]D $ < ,0b]D@$b]D <`@.! L$@$'H*`@]D $ 'G〤 HGG,0b]D@HH G$ 'G〤 OG < ,0b]D@G$@'`P]D G@$ G 4 @G@b]D H H'Gc]_ @-H H 'G$ 'G瀤 O 'G<  A@Tbdw/wOw`P]D _@Y: @$ `]D   @`]D @b]D H H'_L H_L _@ ՖH H '_ߠ w_L O 'G< 0A@Taww 'bP]D H!Ga]L@_@H bP]D G$@H'G 'GbP]D O 'G<  A@T`w/wa]L Ha]L a]\ @@QH H?' a],`O H9c]D H2b]D Ha]\ 'G bP]$` b]$`G瀤HbP]D H 'Oa],`_a]t` H'`@]D H O_@@'Hb]D H9 bP]$`Oa],`O H O_@@ߔ'HO HO HOb]$ _a]t` H'_'HkO HNbP]D 'G bP]$`OGa],@bP]D b]D H H'a]Ha]Ja]a]\ @@'Ha]\ Ӑ'GbP]$` b]$`Ha]\ 'G bP]$` b]$`G瀤HObb]D `]D H&`P]D b]D <` @< H `h]\ b]D ,@`]D b]D $@/G瀤H`@]D H H'bP]D 'G'G'G< A@Rblwwww '_ hac]D HH5b]D bx]D H`P]D bx]D Hc]\ b]D $ < L@ 0H_ ĒH H'H%c]D H__@ H H'Hc]D HOa]$  H'a]D Ho`@]D `??'Ga]$``h]\ b]D @3wc]\ b]D L@'__׀h)_ _h Gߠ HGߠ 'Hb]D H Gb]D @'HGߠ 'HGߠ 'H_ _hGߠ '_w`h]\ b]D @wH _׀ _hGߠ 'H,a]D H%_H`h]\ b]D @Ɛ_H b]D 'H a]$`_ h'HH9G_@3H H'Hc]D H , < #c_ǠDH`@]D H_aHA_< ,08<08ZH8b]D Hb]D H_ h_ h___@ H H~'H_< ,08<08_@H Hn'Hj`@]D HTb]D HM_(HG_w`P]D _@V: @$ `]D  W @`]D  @b]D H H0'_L H_L _@ JH H'_Ϡ w_L OH_G__@1H H' 'G< LLD@A@Pbw 'b]D Ha]\ M' b]$`G'G< 0A@Paw''a]L Ha]L HGHa]L a]\ @b]D `]D H `]D b]D $@b]D H5K mH0c]w_L H' _L `h]\ b]D ,@b]D 'G b]$`c]\ G,@_ w_L O`P]D b]D HcH]D HGH bh]D H b]D H! `h]\ b]D ,@ c]\ b]D ,@b]D  b]$`HPbh]D HI`P]D b]D H>GH: `h]\ b]D ,@b]D 'G b]$` c]\ G,@ `h]\ b]D ,@b]D 'G b]$` c]\ G,@ `h]\ b]D ,@ c]\ b]D ,@@A@OaLw/O`h]\ ,` @c]\ ,`0A@O`ܮw'wcx]D H!a]D HG H _$` ~H 'G$ '_$ G @? 'GH'c]\ GL@_$``h]\ GL@ 'G< @A@Ncw cx]$` b]$`A@NcTwwww_?h_H Q'G׀?H?HUwߠ 'G׀ H G׀?H c]D HwH%Ga ]D $ H (H" wHG`h]\ G,@G۠ ''O `h]\ G,@_h`h]\ _t`_瀤hG_$`_w_߰A@Nalwwww_?h _ h _$ 5H?Hwa ]D 'G۠$ 'ۦ `h]\ G,@'G׀ H c]D H wH_G׀?HwHXGۀ HHa ]D 'Ho wHD`h]\ Gˠ@$ w`h]\ a ]D @$ w_`h]\  h_L _,`_$ w_w_$ w_`h]\ oa ]D Gˠ$@'G۠$ 'G`h]\ G,@O_h `h]\ G۠@_t`_瀤h a ]D $ G۠$@_$`_w_߰@A@Mblwb8]w_b8]!"@h)"_`(t`_ (w_b8] ob8]!"t@b8]b]t`b8]!#@`]t`bh]bh]t`bh]bh]t`bh]t bh]t  bh]t` @A@M`ww_bh]h _\ bh]hH _\`\ \`\ $t`A@M`Twwwbh]\ w_bh]h _\ _h_\ _hH_\ w_bh]h_\ _o_w_\ wb]\ hb]\ wb]\ \ b]t`H `]\ w`]t __t`__t`__t`__t` __t`__t`_n_k_h`]\ hDbh]\ \ wbh]\ w_\ bh]h_\ _ǀh _`]t`_\ w_\ w_\ bh]o`]\ \ `]\ \ t``]\ \ `]\ \ t`@A@LaDwc]@R@A@L`wc]D H'c]D  'Gc]$`G dH c]$`@mb]\  h ?c]$`@A@L` wbx]D H c]$` bx]$`c]@w A@Kctwwbx]D HHw_?hHw_ h Hwbh]\ w_bh]h_\ _hH_\ w_bh]h_\ _o_\ _h_\ Hw@b]t _bh]h __\\ %\$@hN_\ w_\ cHHw c]$`_\ w_\ w__h#_אwc]D HOHbw_׀?hH\w _ߠ w__o__א@&__h_ߠ$ wHA_\ HH:w c]$`_\ w_\ w__h#_אwc]D HHw_׀?hHw_ߠ$ w__o__א@ݒ_w_ A@Jcww_ hHwbh]\ w_bh]h_\ _hH_\ w_bh]h_\ _o_\ _h_\ Hw_bh]h __\\ %\ $@h;_\ w_\ H?Hiw_\ w_\ w__h!_ߐwc]D H?HNw_߀?h?HGw_נ w__oH6_\ IH?H3w_\ w_\ w__h!_ߐwc]D H?Hw_߀?h?Hw_נ$ w__o__ߐ@_w_ A@J`dw'G@"w=w_瀤?h%G H!Gc]D HG 'G@w_瀤?hG H Gc]D O_瀤?h_w_w__߀h_נ$ w_w_A@Icwww_L -H_ wHc]@y_@vc]@qw.@ @+ @P '@OK c]@Oݒ HG@Pwc]ϯw_߀h=_L H8_L H_}wH-_ٻw_ǀh%_@Ni_@Ne@ 'GÐ w_Gc]_߬_ǐ@@@O,_@O_׀h_L H c]AwH_;w_@O_@N@Nܐ G@OG@N֐@+ 8 _h_@ߐc]@ڐ@|@ @R c]$`_@*̐  'wG@w_߀?h?H>'@ w_׀?hw@?wG .H ___ϐ@@4H&'__׀h ___ϐ@@&H'_π?h ___ϐ@@H '___ߐ@@H'G< A@Hbtwwww_ H c]@?H'_c]@@Nw_׀h c]@?H'Uc]@6_@3c]@.@z @*R   @N?'_瀤?h_w_ w_w__瀤h%'GӀ?HHG_א@@N֒?HH_瀤?o_w_ w_w__瀤oGӀ H!GӀ?H'GӀ?HHG_א@@N?HH GӀ HGӀ?O_@Ns @N@)   c]$`@)  'G< @A@Gctw '?G,p,pa@] t@G 'G 5O0A@Gbw'G aHG zHG$ a< ,p,pa@]@HwG AHG ZHG$ '< ,p,pa@]@H wc]@w_0A@Gaw'HfcX]w_t _$ c]\ _t`HiH c]@H^wcX]w_t c]D $ _$`c]\ _t`HEcX]w_ @c]\ _t`H5a@]$wH.Gkw_瀤hH$_\ ?h `]@HwHG .H  $O 'OOO ^OO_w_@'Gq "h 'G<  A@Fcdw'Gw_hH@_ \t`\t`c]\ _t`0A@Fbw HH@_?hHa@]$\t`\t`c]\ a@]td A@Faw'Gw_hH;_a@]$h_\ ?hc]\ _t`_t a0]D _$`_ \t`\t`_\ c]\ h _\ ΐHH_G@N0A@F`w'Gw_瀤h?Hw_\ c]\ h `]@?Hw_\ w_0A@Ecww 'G,p,pa@]\@_h ?G,p,pa@] t@G 'G 5O0A@Ec4w'wbH]D H `]@IHiHX_`]t`H` H `]@2HRa]D H ` ]@#HC_w_٬`]t `]\ "H.a]D H `(]@H`]\ w`0]@@HG H , < #b_ߠD`D|0A@Ea w'w c(]$`G_@f A@E`w'wH(_wߢ`8]@@ U'G뀤HG瀤 H `@]@H c]$`_VHG OA@Dcw'wH_L .H"_ w`H]ϐ@@ ya]$`GπH `P]@UH@H"`H]ϐ@@ 'GπH `X]@;H Ga0]$`?a]$`H`a]D Ha0]D '``]@@H:`h]a]D @@IĔ@I'GӀ HGӠ$ < L@ 0HGӠ$ 'GӀ H GӠ$ < L@ 0O G,@w`p]@@HG H , < #b_D$@$@A@D`̮wa]D HHc]D a]D L@!Р"@<`@.! a0]$`A@D`w'wH_L .H"_ w`x]ϐ@@ b]$`GπH `]@mH@H"`x]ϐ@@ 'GπH `]@SH GcP]$`?b]$`H`b]D HcP]D '`]@@2H:`h]b]D @@Hܔ@H'GӀ HGӠ$ < L@ 0HGӠ$ 'GӀ H GӠ$ < L@ 0O G,@w`]@@HG H , < #b_D$@$@A@Ca,wb]D HHb]D b]D L@!Р"@<`@.! cP]$`0A@C`tw'wH_h H _w`]@@HG O A@BcԮw'wH>_c]t`H>bH]D H `]@hH/_%@&Ыw@(H @&w_߀?h_ѐH_к_a0]D @ʒH G O O0A@Bb|w'wH$_c]t`H,_ސw_֪c]t Hc]\ w`]@@HG H , < #`_ߠD$t@0A@Badw'wH c]$`_`]D H`]HG O A@B`w'wH|H9b]w_ HTwb] w_ HKwb] w_ HBw`]w_ H:wb`]w_ H2w`]w_ H*wb]H%w_L mH MH =OOO hOO sH mOOO wOO_\ @G_ϐ_t H$a]D ,0b]\@w`]ߐ@@<HG H , < #b\_נD$$0A@Ab<w'wH `0]D ƐHHG H , < #`_D$D$0A@Aaw'wH@HHG H , < #`_D44$0A@A`ܮw'wH2H= `]$``]@ `]@ `]@ `]@ ݐ`]@ ؐ`]@ Ӑ`]@ ΐڐ HG H , < #a4_D4$$`A@@cw'wH '/ '#_%w_L 0H_L 9HG#,`,`_L $ 0@'#_ w_L 0H_L 9OG#G/$ < ,0b]D@H G#G/,0b]$@G/ '/_w_L '_ wG'G ,HHG/ OG/ HHG/`@]$``@]D $ < ,0b]D@`@]D $ < ,0b]D@$b]$`Ht3`]@@Eo`@]D H= '/ `@]D H)G/ H 3a]@@E3@E@a]G/,0b]D@@ErG/ '/G/`@]D O3@E$a]@@E]3@Ea]b]D @@EN3w'`]'@@ HG H , < #c_D$$ A@?c|w'wHY_L H c`],` `],`HW_L  H_L  H a ]@ EHE_L `],`_L  H `]L c`],`H_L c`],`H(`]L /c`]L / /wa(]ߐ@@ HG H , < #a_נD$$$0A@?aw'wHa0]@ H c ]$`HG H , < #`_DD$$@A@?`w`]D H`]D H 'c]D `]D @'G< A@?`ww_hH`]\ h8H$`]\ \ _ @H$`]\ L @ǐwע_א@@`]\ \ $ H`]\ D   O O`]t H 'w_L HHXH_L -H _ w_wH_L + "H 'GˀH_ wH c]$`_@u +@@w_L +H_Ϡ w_c]t H_̐Ha_$ w z'HG`]D H z'H<_w_ w_L 'G뀤 0H $H  O OH% +H $OHO -OH nH$ 0 H, < #`_ؠDO '_߀hG@wG뀤 aH G뀤 zH H' 'G'G@wHQ_w_L aH _L zH H' 'G'ǢߠÐ@@w_ww_L H_L HH(_L =H"_h_D   H_D   H _wa8]@@ N _ wHw_h_wGÀ H a@]@@ 5H aH]@@ ,t wHiGˀH_D`\`$`H _D `?'G_\ $`HgGˀH_D`\`$`H _D Gǐ@@6_\ $ HR_L H _`]t`HW_L H _ w_L O___\ 0@@wH,_L H _`]t`H1_א@@u_\ $ H_D   H  O OHO O_\ h _\ _ϐ @_L OX\\\\\\\\\\A@<cw'w'G @'G ?'G@w_߀hG@ȐwaP]ǐ@@ hHG뀤 H_D  @HG@waX]ǐ@@ RHsG뀤 H_D !HG@wa`]ǐ@@ <H]HG뀤 H _L H 'H _D   O OG뀤 H _D  H@ G뀤 HHH_\ D `?'G_\ $`H#_D`\`$`H_D `?'G_\ $`HG$  H , < #b_DHH9G aH G zH H'à '_\ D GÐ@@_\ $ H0_D`\`$`H*G aH G zH H' '_D G@@_\ $ HG$  H , < #b_DH[H ah]@HG뀤 O OHHH!Ӑ@@*'GӀHG_\ $`H _D`\`$`Hap]@cHG$  H , < #b_DH_D   H  O7 OeHO O_\ hG뀠@  '_\ G_@G뀤 H _D  H@)G׀H0H_\`D ,0@\ (@H#_\ D '_\ 0ǐ@@HH_D   H  O OHO OG뀤 H _D  H c]$`0($h@''GH G$ @ 'GH 'G$  @?,@'GH'G< 0A@;`dw'c]ax]G,@@@Mc]w_@'G@w_h H '_D  S  2H 'G< 0'G@yw_瀤h_D  HHw_\ (w_@A@:bԮw`]\  2h 'G< 0A@:blww_wa]@@@A@:b w`]\ L _ wwww_L H_Ő7 __t`_w_L HX_L $H_߀hG__L @@@ h>H& _,`_Ϡ wH2__$@  ~Y_t _\ __Ϡ$@@@ _\ __$@,H_L $H  O OOO -OOH _Ϡ w_L O_w_װ A@9cwww_h _$`?H'_h _wa]ߐ@@a~ ?'G<  www_\ ~ wנ '_L -H '_נ w_L 0H_L 9H __@H6' '_L 0H_L 9HGӥ,`,`_L @$ 0'_נ w_L 0H_L 9O__t`_瀤h_$ GπHGӠ 'G'G< wwwwϠ '_\ }w_L 0H_L 9H __@S: Hkw_L 0H!_L 9H_ϥ,p,p_L $ 0< @wGˠ '_נ w_L 0H_L 9OGˀ HG'Gˠ$ 'G'GÀ H_ϡl wG'Gˠ$ 'G'G OHG'Gˠ 'G'GÀ H_ϥ,p,pwG'Gˠ 'G'G O__t`_瀤h_$ _w_߰@A@8c$w`]D Hb]D H 'b]D `? 'G'G< 0A@8bwa]Őw_h _L H `]$`c0]w_L H_\ h_D`\`$`_D "H_\  _ @w_L O0A@8adw'c0]w_L H"_L GH_Hw_D  H _L $ GH_H w_ @w_L Ow_@/O AH O ZH H'O aH O zH H 'O -H H' 'G< A@7cĮwwww_\ www ' ' 'c0]w_L He_\ w_ǀhV '__\ G@|<'GÀ H _GL@HH/GH GGH 'HGGH_w_wG' 'G_\ @<: @ "H '_D  HH G 'G O_\ w_ǀo_Ϡ @w_L OGH _瀤h _$`Hw_G@_t`_h_hHw_\ w__t`_w_߰A@7a w'w'b0]@=ސH b]$`@=ېӐ @=ޔ?HU'@k b]$`G_@@=m'`(]D HG〤 H a]D  a]$`H a]$`a]D H{ʐ  b]$`G〤 Ha]D HOa]D HO?H'G'G< @A@6c wb0]@=x @@=t_w_ A@6b|wwa]D @=cw_@;_@;@ 'Gې zw_Ga]__@@@<]_w_0ww_,p,p,pw_ߡl d_h__l@H'__l dl@H'G<  w'wG,`,`,` ,` ,` < _l d@w_׀ hHw__נL@w__סl@_h_!Р"@l@H w__!Р"@l@LHw_߰0A@6`wc]D H  c]$`H4 a]$` ' 汒'G H"GGa]$`G H HG@YG 'G@摒'G O,0A@5bܮwb8]\ a]$@'G HH%`]D `? 'G'Ga]G@@;0Gh c]$`a]b8]t`0A@5aܮw'ch]D H  ch]$`Ib8]\ a]# hb8]\ w_ b8]t`G_,` c]$`G'G< @w_L H_L '_ wG'G_L Oww_  &h 'wG뀤H_ w_Ǡ$ wǠ _,`_Ǡ$ w_l` L $@ 0_,`_l w_ oG뀤H_Ǡ$ wǠ -_,`__ǐ@@9ww_  &h 'wG뀤H_ w_Ǡ$ wǠ _,`_Ǡ$ w_l` L $@ 0_,`_l w_ oG뀤H_Ǡ$ wǠ -_,`__ǐ@@9 'wG  &H 'wG뀤HG '_Ϡ$ wϠ _,`_Ϡ$ wG<`` .! L $@ 0_,`G<  .! 'G OG뀤H_Ϡ$ wϠ -_,`__ϐ@@9h0'G@ @9C'G<  w_ސ@S@9)'G<  ww '_L Hm_L %H_L '_ wG'GG۠ 'HS_ wH:_\ w_ w_L H_L '_ߠ wG'GdG۠ '_L OH.G_D @'_ wH"G_\ @'_ wH_w_ w_L nH dOHO sO_L OG'G< @@I'G HG H G H G?HG0A@3aĮwww 'bp]D  bp]$``]D Hb]D HbX]D Hʚ*Z Gc]D @'G__@#'`]D H b]D H H$b(]G`]D  @'Gb]D H c]$`I0A@2cԮwwwX __@ђc]H$ ch]$` A@2c,www '`]D H b]D H__@@e'`]D H b]D H$ GH'iGb]D H c]$`G'G< A@2aܮww'wG! @ H*  0vw_w__@@94 H_@8a]?H'_\ h_\ @9$__t` 'G< A@2`̮ww'wcH]D H_wH_@7%s  vAw__@ _G_@'__h_@7G'G< @w_w_\ h_\ @8Ð_t @w_ "h 'G< w'w'ww_G@w_G@w__hF_w_w_L _L H__h__hH_ w_w_ w_L _L O__h_׀h__t`_πh__t` H '_ w__ o 'Gˡ< www'wwG'G'_wG!@H_@6Q@_G__ϐ@@{'H'Gˀ"@?,@'G'__G@ @8`?'G'GH __@_t`__@_t`GǠ !HGH GǠ!H GH H' 'G'G'Gá< 0A@0cw'Hc]D $ 'H&c]D $ 'Hc]D $ <` @< 'HG$? H , < #a _D`H]\ G,0\@w_`@ 0A@0bww ' c]D H`H]\ G,p\`H]\ $`< ,0uG 'Gc]D O_`H]\ c]D $ < ,0t@0A@0awwc]D $ 'G H`H]\ G$`< ,0\`H]\ ,puG$ 'G O_`H]\ t`@A@0`w 'c]D H?`H]\ G,0t@G 'Gc]D O0A@0`wc]D aP]D HH:`H]\ h @ɐ`H]\ @5H?wc]D  t`H]t c]D aP]$`_?h _`H]\ G$ < ,0t@0A@/bĮww_`H]\ \ h?H(' ' c]D H_`H]\ G,0\@hG$ H'G 'Gc]D O?'G< @A@/awc]D $  @'G< 0A@/aLw''G'GGH`H]\ G,0\@?h H 'G 'GGO 'G< 0A@/`ww 'c]D H&`H]\ G,0\@?hG _$``H]\ G,0\@_t`HG 'Gc]D O?_t`@A@.cw'G H Gc]D @'G H 'Gc]D Hc]D $ 'G$ 'G< @A@.bwb]rb]t `]D Hb]Hwb]w_rb]t a]rb]t b]r`]t b]rb`]t b]rv`]t 0A@.alww_@3Z'b]\ G@a] Ȁ h b]\ a] Ǡ@'b]\ _G@@4'b]\ G@b]t` b]\ ,`@/O/ /0w_@0w_@0'G@E|@A@-c4wa]i0A@-bw'Gw_瀤?h'G H#Gc]D $ HG 'Gw_瀤?hG H Gc]D $ O_瀤?hw_w_A@-aĮw/'Hb]\ a]@ 8h H'G? 2h H'`]D  2H H'<'Hc]\ a]@2H  2H H'bx]D H'bx]D H S?h H' 'GH'@H @  4H H 'Q  4H 'GH'@H H'c]D 'GH'G6?h  h H'נ 'GH'GÐ hw_瀤 h _ h H'Ӡ 'GHg'? 2h H_'@?H HW'c]\ y 2h HK'O`lH&`aH`LH `BO`DOmH7Oi`POH0%`a H,, < #`x_ǠD`pH%`l H, < #`_ǠD`sH`pOxHO`xO 'G< $X|dA@,a$w'''H}Gw_瀤?h_2HdH`]D JHG w_π hc]D H_Ϣ$ c]D $ < l@ H;H3w_߀?h0H#_߀ h H_ߠ$ w_π hH_Ϣ$ c]D $ < l@ Huc ]\ wHmc]\ ymHc@IH@ZH c]\ zHNGᕐw_π h_HH=w_߀?h_߀ h _ߵw_π hH_Ϡ$ H @'GۀHGHƼHGww_瀤?h_߀ h __ߐ@|HHG9w_π hzw_߀?h_߀ h _bw_ǀ hkH __ǐ@ʒPHZw_߀?h_ HRHb]\ a]h%b]\ L? Hb]\ $ b]t`b]\ a]h b]\ L? OH@qH a]Ha]Hxc]\ Šw_h _|pHHbG`fH5`PH`LH%`B HT, < #c_DO HE`bH `POO`TOH:%`b H6, < #c_D`pH`lH `fO`iOHO`mOH`xH`sH`pOH OA`tONHOt(l0w 'H%G 'H=G뀤 H_H8wH4G$ 'G뀤 H_H,wH(_ wH#_$ H!w_ w_L :H  O .OH ?H :OHO \OO_0A@*`wwwHCH _H<$ ?_H8$`?_H4$`?_H0$`a0]D _H'$ _$ _$ H!w_ w_L jH  BO bOO mH jOOO tOOH_L dH  PO bOH lH dOHO pO_w_ A@)b<ww'a]b]t`_L Ha]Hw_w_L HHf_L VH|_ߠ w_L MHs_ߠ w_L 'Gۀ H_ߠ$ wH '_ߠא@IwGGא@ӒH_wHN_wHHHF_ߠ w_L 'Gۀ H_ߠ$ wH '_ߠא@wGG_`]\ @ "h ĔH_L :H  %O .OO ?H :OOO \OO_ߠ w_L Oxb]\ a]ha]HwG Hb]\ Ga]@ h b]\ G$@Hwa]w_@A@(bw`]\  w_ A@(b\w`]D Ha]D H 'a]D `?'G'G'd Hb`]\ H wG,0b]\@w_b]D c]D $@`]D $@$ ƒw c]$`_w_@A@(aw`]\ b]D c]D $@`]D $@$ w_0A@(`dwww'_ha]t H_G_@Δ H?H%'_\ h_\ @-_t _h_@,  l_t _\ _@@,G_$` 'G< @w_\ h_\ @-_t _ΐ@w_t _t _$ @A@'bwa]c]@A@'b,w 'c]D H c]D H"c]D HG 'c]D HG 'c]D HG 'H c]D HG 'b]D HG 'G'G< 0w_@,7w__瀤h_@ >w_ߡ< @-UH H '__瀤 o 'G< @w_D !@H _\  2h H '_\ `?'G'G<  A@&c|w'b(]D HJb0]D 'GHb0]D HHK b0]$`b]D H *Gb0]$`H6 'c]D $ H%Gw_?hHG w_GtG 'Gc]D $ OtNGb0]$`A@&awǠ 'b]\ ?hHmb]\ wb ]\ w?b ]t`?b]t`b]D HƸHNb(]D Hƭ 'c]D $ H5G8w_߀?hHG -w__瀤h_׀?h__h _aGt 'G 'Gc]D $ OGӀHs@A@%cwa]ېH a]dHb0]D `?'Gb0]$` 0A@%bww_\ w_h_\ w_@+h_w_o_t ?b]t`?aX]t`@A@%b4wa]ɐ@A@%awah] A@%awwwa]\ w_߀h_\ _h_?h__\ h H '_\ w_߀o 'G< 0A@%`ww H H'ah]\ w_瀤h_\ _h H '_\ w_瀤o 'G<  A@$cܮwww'w_߀h_$ c8]D H b]\ ?h_b ]\ h_?h _b]\ h H0'__@Z'G׀H H#'_߀h _$`a ]D H H'G뀤H b0]D H H'۠ 'Gۡ< 0ww_w_\ h_\ \ _\ hH _\ w_\ o__h_\ _\ h_\ Hw_\ w__t`_\ h_\ _\ \ h_\ Hw_\ \ w__t`_\`\`h_@)H _\ _t`__t`A@$`www'wwwG'_G@w_׀h_πhH\_w__׀h"  h)w____$@,0D_t`____$@,0D_t`a]_@[__h_wH__h_ wHH a]\ a]\ __$׬a]D @@ sWsO@A@#bwbX]D H cH]D c]$`Ha]@`_?hH _?@@? @A@#aw b0]$`a ]D H A@#a$w'HG HHowyfw_瀤?hxy]w_H`wb]D HG H?'H 'G'wHGa0]D ,'GwG H#_*w_瀤?hG 'Gc]D HH Gw_瀤?oH_瀤?hG$ 'G〤 HH Gw_瀤?o_w_㾐A@"bwWww'''w_w_Ӑw_woc]D H?H?'_?h__hG〤 H _πh__t`GH('G〤 HG$ 'G렌 H_ww_@ӣw_ h_ wH_@ w_ww_ h_$ w_?h _πh_o_t`GH'bx]D H__o$@< @)1(H__@%_wo_wHO'GG@'G fLwGw___G@G렌 H;c]H3c]\ c]\ _Gc]D @@ ss'kGkH  f w__w__t`___t`ah]__@Ma]ΐHba]\ a]\ _GG@@ sZs'GHFG렌 H_w_G___G@@zsH1G$ 'G瀤 H*a ]D H_w_G___G@@Ys_@':_@'7_׀h_w_t` H '_@'*_@''OGˡ< 0A@!adw'b]\  nw_h HG'a]_G@! H H8'_bX]$ bX]D HcH]D H  c]$`H cH]D c]$`a ]D H b0]D H} 'G<  A@ cĮw'w'_h_L HRa]ِHG}H a]\?H'G% @a]D  H a]H?H'a ]D Hΐ a ]D Hb0]D H  b0]$` b0]$`HNa]_G@o H?H'_LbX]$ bX]D HcH]D H  c]$`H cH]D c]$`a ]D H v  b0]$`a ]D HGw_߀?hG"HGHD'a]쿒?H;'_GGߐ@??bs'G뀤 Ha ]D HG뀤 H0 GH'G H _a0]D @a ]D H  'G< A@cwww'aX]\ wb]\ wa]ΐH @)HHG뀤 H?wH_wǠ 'G뀠H_ǐݔwG 'GG뀤OaX]\ ?h_?h _aX]\ h _b]\ h_?h _a ]D ,`@< w_wHJ_?hH_b]\ h_a ]D ,`@< wHaX]\ w_aX]\ h_a ]D ,`@< hwH _a ]D ,`@< $w_wHb]\ w_?h _ǀ?h __ǀh_w_?h__h2 'Ga]D ! @'__GGϐ@ As'GÀ HHb]\ ?h _b]\ h_w_aX]t`_b]t`0A@cLww'R_h_L H c]H c]_G@ c]$`@A@bwx H H'c]'G< @A@b w'la] @% c]D  c]$`b]D H@A@adw'b] @$c]D  c]$`b]D Hy@A@`Įw'ax] @$c]D  c]$`b]D HQ@A@`$w'GHa] @$b] @$ax] @$  @$H @$| @$y  @$u @$r0A@cDwc]D 'G HHw c]$`G H+  @$Llkbʐ  @$A @$>@$ @$b] @$3b j c]$`G 'G H4b]D 'c]D 'f b]D GH c]D GHc]D  <` @< `X]$`. c]$`G H b]D Hb& @A@a wc]\ w_c]h_\`\`t`_\`\`t`_@"c]\ w_c]o`]t  a]$` c]$`wwww'ې 0a% w_@!  a_t _\ _@@"__t`G_,`(_߀h_t H_@!  `_t _\ _ߐ@@!_w_ϰ@A@bwc]\ b]@@! H HV'c]\ b]@@! H HF'c]\ b ]@@! H H6'c]\ b(]@@! H H&'c]\ b0]@@! H H'c]\ @" 'G HG@" H' 'G< 0A@a$ww'G H_@'H_G@@ǒ'HH)b8]趒H!b@]讒HbH]覒HG H , < #a,_Dltl@A@cܮw`]\ h?Hw`]\ \  h@wH@wH_ 'wG'G$ 'G'G߀ H@wG'G$ 'G'G׀ O_w_ 'wG'G$ 'G'G߀ H@wG'G$ 'G'G׀ O_w_@A@awc]D 'G< @A@awa]D 'G< A@a<wwc]\ w_bP]@@!;w_@ _߀h H' c]$`_@ .'ۢ_ߐ@"@!'hO !HH_Gې@@  HGL@ H GL@ HHwG۠@_Jw_L HH_w_L H_L H_L H_ w_L H _L H_L O _,`_ w__w_L HH~ '@ : wGHEw_L '_ w_L ^H_ w_w_L GH_L H_L \H_ w_ w_L GH_L O_L? $ "H 'GH_$ w _,`____G@@^wc]_t`c]\ _t`_c]\ t`_c]t`c]D  c]$`_ߐ@"@ Bo_@ Dc]D H H'c]\ `]t` a]$` 'G< @A@`<w`]\ h H '`]\ \ a'G< A@cww_wc]D H?Hcw_w_ϐ@w_߀ h_ߠ w_?h bX]M?HFwbx]D H__@̚`]\ \ @'`]\ \ _Gې@@ H `]\ L (H_GL@ H_GL@ H _ͥ`]\ t HO_w_A@aww'G H _h HV' c]$`G Ha]wb]c]t`H}b`]jw_h_L H H,'Hbh]wH'bP]wH!bp]wHbx]wH H'G$  O, < #a_D_Qw_ǀh_w_@_@@_@@  ]w_b]___ǐ@@@!__h_@_bP]@@:w_@_瀤h_@!@Ĕh}c]D H_a]h_@  H'@'GÀ HGà$ < L@ H  Gà$ < ,@H_@'G HG?OצϠǐ@@NHH7___@ΐ: @e wc]_t`c]\ _t`_c]\ t`_c]t`c]D  c]$`_@!@Io_a]h_@H`]t  a]$` c]$` H'c]\ w_c]h H'_`]t` a]$` 'G< (@0A@cԮw`]\ hH;w`]\ \ w_c]h`]D HH%wc]\ `]t` a]$`H_`]t`a]D  a]$``]\ \ w_0A@bw`]\ hH>w`]\ \ w_c]h`]D HH(wc]\ `]t`c]D a]$`H_`]t`a]D $ a]$``]\ \ w_@A@a4w`]\ h?H w`]\ \ Uw_A@`wwwww_w__t`_L H%_L ,084084aH]  @ H_Ϡ w_L H_L ,084084aH]  @ O_L H?Hm'۠ _,`_Ϡ w_L H%_L ,084084aH]  @ H_Ϡ w_L H_L ,084084aH]  @ O_L H?H7'_L ,084084aH]  @ HR_L H%_L ,084084aH]  @ H_Ϡ w_L H_L ,084084aH]  @ O_L H%_L ,084084aH]  @ H_Ϡ w_L H_L ,084084aH]  @ O_L ,084084aH]  @ H?H'__t`__t`_L H%_L ,084084aH]  @ H_Ϡ w_L H_L ,084084aH]  @ O_L H?H'۠ _,`_Ϡ w_L H%_L ,084084aH]  @ H_Ϡ w_L H_L ,084084aH]  @ O_L H?H\'__t`__t`_L H%_L ,084084aH]  @ H_Ϡ w_L H_L ,084084aH]  @ O_L H?H&'۠ _,`_\ @h_\ @h_\ @h _\ @ H H'۠?'Gۡ< @A@aԮwb]@ a]$ a]D H a]$`P0A@awa]D @ 'G?H?H'G HZ O H?/G OO 'G< PP SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- Search patterns may be modified by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceeded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Forward search skips current screen. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop long lines. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. --no-keypad Don't use termcap keypad init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. CNTL-RightArrow ESC-RightArrow ESC-w Move cursor right one word. CNTL-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. CNTL-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. CNTL-DELETE ESC-DELETE ESC-X Delete word under cursor. CNTL-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. CNTL-L Complete filename, list all. +?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSSECURE/moreMORELESS--VISUALEDITORviLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functional-No filenames allowed with -t optionCannot allocate memoryLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_LINESliCOLUMNScokrklkukdkPkNkh@7kDTERMunknownhcamxndadbutsgpcksketitececdcl cmsoseusuemdmembvbbsbcho|^ll cralsrNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread error%sch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMT%cESC^%cascii8bcccbcc18b95.b8bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.next8bcccbcc18b95.bb125.bbdos8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bANSI_X3.4-1968US-ASCIIISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255?LESSSEPARATOR/LESSHISTFILE-/dev/nullHOME.lesshst%s/%sr.less-history-file:.search.shellLESSHISTSIZE"%s w%s Non-match First-file EOF-ignore Keep-pos Regex-off &//?_-(P)+!!done|doneThere is no --%s option& less %sungetcc overflowPattern not found:%s@/\less/\help/\file/\@Command not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filemark: goto mark: |mark: Brackets: /usr/local/bin/.syslessLESSKEY_SYSTEM/usr/local/etc/syslessLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"-@/\less/\help/\file/\@%s"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"LESSMETAESCAPE\LESSMETACHARS; *? '"()<>[]|&^`#\$%=~%c%s%c%s%s%s/HOME%s*SHELLr%s %s %s-LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x -- %sLESSOPENLESSCLOSE-c...skipping... Cannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSmLESSANSIMIDCHARS0123456789;[?!"'#%()*+ %*s Calculating line numbersLine numbers turned off! /dev/ttySHELL%s %s %ssh (press RETURN)Cannot seek to start positionwCannot create pipeInvalid mark letterCannot seek to end of fileMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"lLine number is required after -ljInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %s#Invalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"tags support is not availableTags file "%s"/%sless Copyright (C) 1984-2009 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops ,%d and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sLESS_IS_MOREsearch-skip-screenbuffersauto-buffersclear-screendumbquit-at-eofforcequit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filequit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEpatternpromptsilentquietraw-control-charssqueeze-blank-lineschop-long-linestagtag-fileunderline-specialversionhilite-unreadtabsno-initmax-forw-scrollwindowquotestildehelpshiftno-keypadold-botfollow-nameSearch includes displayed screenSearch skips displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command Follows file descriptorF command Follows file name%s: %sInvalid pattern?-tagfileNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATH-No tags fileNo such tag in tags fileunknown tag typerTag not foundtagsLESSGLOBALTAGSsP%s -x%s %s/dev/ttyHX`XpXxXXXXXXXXXXYY YHۘY`YxYYYYYYYYYYYYYYYZZZZZ Z(Z0Z8Z@ZHZPZXZ`ZhZpZxZZZZZZZZZZZZZZZZ[[[[[ [([0[8[@[H[P[X[`[h[p[x[[[[[X[[[[[\\0\@\P\X\p\\]@]8]X\\\\]]] ]0]H]P]`]h]x]]]]]c8c@cHcXc`cpcxcccccccccccddd d0d@dPdXd`dhdpdxdddddddddddeeee0eHeXexeeeeeeeff f0f@fHfXf`fpfxfffffffggXgxgggghh8hxhhhhhhhhhiiii i(i8iHi`ihipi˸iiiiijj0jPjxjjjjjjjkkk k(k8k@kPkXkpkkkkkkll@lXlxllllllmm(m0mXm`mxmmmmnn(n0n8n@npnno oXohopoxoooooppXppppqq8q@q`q}p}x}}}}}}}}}~~~~ ~(~0~8~H~h~~~~~~~~V``PxPۈpT@X`8V pxˠP˰hh\d8 ːHˀ(X$pT`(XpHh@Ș X 80|@XX `8d @XPhPۼˈ`(h`x H8` ېhP\ dXh|hX˨XH P˘xtp p px@x(0ۀX  i*0T HWDXʸT,$WVVWh\(XN0o0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0ow`0oo0og0o_0oW0oO0oG 0o?@0o7`0o/0o'0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0ow`0oo0og0o_0oW0oO0oG 0o?@0o7`0o/0o'0o0o0o0o 0o@0o`0o0o0o0o0o 0o 0o%%%%% * *%%xV & oRLo|o}}0 oo ]8]@a`]ap]]X]a]a]a]a]a]a^a]a]a]a]b^Hb^b(^b0^b@]bH]bX]b`]bp]bx]b]b]b]b]b`b`ba b_b_b_pb_c_c`Xc `0c(`Xc0`]]]@P]]]^^^H^P^^^^^^___0_8_p_______```0`@`X`h````a a0oK^pp0J   < < A H M M Q T b c   < < A B G H K M p q   < < ? ? A C M M V V > @ F H J M U V A C M M 114:GN557799q~-0226799XY__24RSrs   "'(229;446:<<BBks 0*0/00 %& #       8 : ? ?gi{тхыѪѭBD psvy0WX``   ;?__KLn : ; N O U W q z      ) ) 1 1 4 4 7 7 : ; = = C F I J N X ] ] _ e u      ) ) 1 1 4 4 : ; D F I J N U X [ ^ ^ b e r     ) ) 4 4 : = E E I I N T W _ b e p      ) ) : = D E I I N V X _ b e p ;>\HHkp""((++35:?ZZ^IINOWWYY^_[^}w  7?T_mmqqtx,/<?ACnou LO}FGNOXXZZ\\^^~  ( ( ) ) * . ` c d i j o r s !O!R!!##$'$?$K$_&&&'''' ' '('('L'L'N'N'S'U'W'W'_'`''''''''''+++$+,/,/,_,_,m,s,x,,,-&-/-f-n-p-------------------........////0@0@00111-10111111222D2O22MM",?xפ./ko77==??BBEE@O$/SSgglouu  '';;>>NO^46$/K  669;=>@             4 7 ; > H O Y#o#$c$o$t')szFW_rUUԝԝԠԡԣԤԧԨԭԭԺԺԼԼ  ::??EEGIQQ֦֧ _#)#*./0000>0AMNף0k`D"D#D%D'""pppȘȘȘ e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789.=:f/?/*?*n+n,N-N.&7m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)astb(@xt(tHB8hthtcHtttdXAuu8ehuPupufxuuF؈uvgؘv8vXvhبvviظ\y`ww(w@jk0whwxJ!wwkHrpKwwlHj@Lxx(m0x@xPx`n("xpxxo8gxOHixpXHuPhv0xqوxyyHr٘"y`yys٨!yzSٸ!z(z8tszHTthzPu"z`zzVzw"zz{(x({X{`{pX(A{{y8 {{zH|| "Xh|@~h!|P|x?xX#ڈn|wx.ژA||.ڨ,|}.ڸ}(}Pqqqqqqqqrrr(r8rHrXrhrxrrrrrrrrxrsss(s0s@sXs`spsxsssssssss H (press RETURN)... (interrupt to abort)WWXNXX~436pȘ XxV|}0}} ` * * * X`~Hxې H9PL8Zf *u|ېXxf * X` Xp Xx X X X X X X X X X X0 Y Y ( YH|ۘxf * ۘ$ Y` Yx! Y' 1 ; D 8M YS YY Y_ Ye Yk Yq Y Yw Y} Y Y Y Y Y Z Z Z Z Z  Z( Z0 Z8 Z@ ZH ZP ZX Z` Zh Zp Zx Z Z Z  Z Z Z Z% Z+ Z1 Z7 Z= ZC ZI ZO ZU Z[ [a [g [m [s [ y [( [0 [8 [@ [H [P [X [` [h [p [x [ [ [ [ [   p X\  [ @ |ېxf * [  [% [* [ / \9|xf *> \0D \@J \PP |Z \X` \pf \ l рu \{  X|xf * ]@ ]8 ]X \ \ L \    \ ] ] ]  ]0 ]H ]P  @  ]` ]h ]x ]% ] ]+ ]1 ]7 $C|Xxf *L  (\ k xy 0 x XT   P P | p  0 ", #H c8 $ (8 6\ .& /3 3H> c@E 5P cHW cX^ c`e cpl cxs cz c c ? c c c c c c DPT c c|Pxf * H$ HPt d d d  d0  d@ dP dX d`$ IxP/ dh5 dp; dxA dG dM Kp\ db d_ dh Mhq dT d~ d Rh  ]D ]x` d ^8 d d d e e e e0 eH eX  ex0 e e  e e^ e es e  f' f . f05 f@< fHC fXJ f`Q fpX|ېxf *^|ېxf *g fxl  f f f f f ` f  f( g@ Pl    X , gX|ˠxf * P gx g g$ g0*  5 0<@ <K g0Q h8W h8@^ hxe|ې˰xf *p hv h h h |  D h h h d h h T `< i i i ͸ i  i(  i8  iH  i`  ih  ipW i ˸ '* . i 5|ېxf * @ HT I i O|ېxf * V|ېxf * ^ x k  i | v   X |ېxf * |ېxf *  i  i(p i  j  j0  jP" |Hxf *  jx  j  j  j     j   <  H  `  x  H  "  $ " j ) ) 3 ,H @ - N 4x X j _|@xf * i I q j w M8  M  k  N| |ېxf * k  k   k(  k8  k@ kP kXD kp  k  k |xf *  k  _  k   k  `  k |ېxf *  l(  l@  lX  lx  l  l l(! l  l  l  m(  m( $ m0( * mX 0 m` 6 mx < m B m( H m N m T n Z n( ` n0 f n8 l n@0 r np@ n8 x n8 ~ o 8  oX  oh  op  ox  o  o(  o o | xf *  o0  p@  pX0  t  8  x  p  p  p  p0 q(O q8  q@  xH  q`  ( |ېxf *  q % p 0| xf * 5 }p :| Hxf * C L N 0L ]  i|ېxf * s }x x   | |Hxf * |Pxf V  x  Ɛ,  0   0  h0p }  ǰ4   }   d$ }  }    ՘0    }  }5| (xf *  ހ  ߸H ' ( 4 D @  I x V } \ P m x x P  X        }  } |ېxf *     |pXxf *  ~    ~  ~ ~  ~( ~0 ~8! ~H  ~h  ) 82 !p= 8H 0Q  X<Z ~` ~f ~1 ~l ~ ~r ~ x "8|ېxf *  ~ |ېtxf * PL ' f P 4@     Hx`+2; (G VM`X{ (\ب P  ΀4 xh` T< D`a PnPx ( 4 XH 2<PRYۈb z   \ * nX t  &2Rnpw 8 * | C @@h `H ) + p5 hC Kg oٸ8 X`T(@ 8 ܠD`5 SX> HC ڸQ iPXXq v0Tx th~ z, ( @p )x h(`8?8\ l Vz H  H!px ; ? 8F 0Sg (qˠP˰ @ A ؈(h2 X: HxH dO nhv  \\ 4dx 0 8  %-  8ːY aHz@ˀ Ex l X f0  `" 00(IXf pT$ PD p װ . T  ``(6O `[٘vH(   # x0 X9 ppB( DPYcqv( Pt (| :8|@` x  8Z0 X> [<H 4X XXe`kXx @8 y`p k0 rp j@ * g u \ s< (( {XH7 L=^ @ehژ  ( ,@ H Ș( &X?E (RV \p` } 8 pt`0 (|' #6@OX[ =$ciHrX  x, ՈP8 ؘ ` 1 N S _ 00 k8   @ )  d  8P     `  h @@!X!`!!P!, @!2h!T H`!_ !m 0!uP! p! d0!!! h! d!!ۼ! x!ˈ" X" ې"2`"Q "Z(h"t "@"" Xh""`"" Op" " #x#`k#%   #1 h #D cP#L ,#^H#x8# X# PX#  #  @#`#ڸ`# _pl# #ې$$!$+$F 0$Rh$nX$ q$ C0H$$ X$ $$$ ~$P% $%@ l\%0 8%;  `$%F %bd%m%u$% <`% 8%@% %%%x%% l%%&X&( H&4  !-h&B&G"T  (D&b|&m  &v  & XL& H4& h& c(<& & dh&$ x4&& '  ' @, M':  'D  'L'U '^'h ܈@'r X'~˨'' g@  (' $'X'H' ''و( ?pl( ($8(?(E(P (\(w(ظ( ( 0P( ( `((P)))4 4)=)H˘)l)r )|xd)))))t) ) Ҙ@*p(** *- *4 *> נ*H J*Q*jp* 80* * j #@?** (H*p*+xD  H+! +*  +H +S +Z ne +d +k+r ,+~@+++  + X+  + P@+x+ +E+ X+ HH,(,0,$ 2@,-,;,V) a@L,a ,m ,z0,,   AT, 4,,(,ۀ, =|,x- L- - W0 } 4-! (-1ڈ-PX%-o- 0L-- \- X- p  |-- @p#  .-#F a. (` 9 h...# .. 8 وT.6  p= |.? P<.I .P .miq *+.  4 0.ڨ. ؀. hH. d> .0.T./ H/ $0/% </2 dHl/: /H WDf/aX</y`// c/ d(/ 8 T/ P/ (`/ x//h0٨0"0=0W0aʸ0|H0" 0000T110 17@1>1H X1M1S1r B 1x X1,1@!11(1`1 (1 `1 p !(  111$2 WT20 D2:2R2Z V;2v E4222  2 @h2 V4#  2 2ې2 V42 WP2@3h333 X3E (3L3S بd3]\3~3O(3 XNchg_caselesscrti.scrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptr__crt_scratchvalues-Xa.cDrodata.rodatamain.cBbss.bssDdata.dataDpicdata.picdata.L22.L51.L65.L75.L77.L106.L146.L156.L165.L172.L181.L191.L277.L289.L300.L395screen.c.L30.L29.L130.L138.L162.L170ltget_envltgetflagltgetnumltgetstr.L304.L314.L340.L350.L383.L387.L391.L399.L403.L407.L411.L415.L455.L459.L474.L483.L485.L487.L489.L491.L495.L517.L527.L534.L538.L545.L549.L556.L560.L567.L571.L582.L587.L599.L604.L615.L620.L630.L640.L641.L642.L643.L645.L646.L648.L649.L651.L653.L660.L666.L670.L676.L691.L698.L707.L719.L721.L728.L737.L749.L751.L761.L768.L772.L779.L792tmodescheaperinc_costcountcost.L911beepclear_eol_botbrac.c.L36.L41.L68.L73.L139search.c.L159.L217.L257ch_addbuf.L339.L370.L450buffered.L918init_hashtblch_delbufscharset.c.L13.L54.L158ichardef.L269icharsetilocalesetbinfmt.L427.L437.L463.L465.L467.L477.L479set_charset.L507.L510.L512.L514.L516.L577.L588is_in_tablecmdbuf.ccmd_step_commoncmd_step_rightcmd_step_leftcmd_repaintcmd_leftcmd_homecmd_lshiftcmd_rshiftcmd_rightcmd_icharcmd_erasecmd_deletecmd_werasecmd_wdeletecmd_kill.L986cmd_updowncmd_editcmd_completecmd_istrdelimit_wordinit_compl.L1527next_compl.L1641.L1648.L1892.L1904.L1906.L1917.L1931.L1934histfile_name.L1956.L1971.L2017.L2027.L2074.L2122save_mlist.L2171.L2204command.ccmd_execstart_mca.L89.L98.L107.L116.L125.L134.L144.L149mca_search.L169.L171.L190.L201.L205mca_opt_toggle.L330.L331exec_mcamulti_search.L635mca_charclear_buffersmake_display.L912at_prompt.L945.L1024.L1162.L1344.L1635.L1768.L1778.L1784.L1814.L1826.L1843.L1875.L1877.L1879.L1915.L1939.L1980.L2019.L2099.L2118.L2149.L2187.L2245cvt.cdecode.c.L56expand_special_keys.L129.L131.L132.L135add_cmd_table.L184.L202.L220add_var_tablecmd_searchecmd_decodegintold_lesskeynew_lesskey.L708edit.cclose_file.L364.L377.L394.L451edit_istepedit_inextedit_iprev.L904.L969.L1007.L1022filename.c.L103.L110metacharsmetachar.L244.L310.L311dirfile.L343.L535seek_filesizereadfd.L714.L730.L739$XAoAMiKEtWrM06y.shellcmd.L783.L799.L808.L814.L824.L830.L886.L1065.L1103.L1147forwback.ceof_bell.L180help.cifile.cincr_indexunlink_ifilenew_ifilefind_ifileinput.cjump.c.L25.L95.L137.L261line.c.L19.L28.L32expand_linebuf.L194pshiftattr_swidthattr_ewidthpwidthbackcin_ansi_esc_seqstore_char.L1025store_tabstore_prcharflush_mbc_bufdo_append.L1748linenum.ccalcgap.L163longloopmessagelongish.L214abort_longlsystem.c.L33.L48.L58.L83.L225.L230mark.cgetumark.L90getmark.L271optfunc.c.L47.L59.L76.L122.L177.L196.L219.L226.L246.L299.L306.L325.L348.L374.L426.L462.L515.L546.L603.L684.L687.L689.L693.L695.L780.L801.L805.L812.L817.L862.L887option.c.L197.L235proptoptstringflip_triple.L358.L372.L386.L503.L709nostring.L818num_erroropttbl.c.L140is_optcharos.c.L44output.ciprint_intiprint_linenumless_printfpattern.c.L34compile_pattern2matchposition.cprompt.cap_strap_charap_posap_linenumap_intap_questcurr_byteskipcond.L456protocharwherechar.L602.L690set_patternclear_patterninit_patternget_cvt_opsis_ucaseprev_pattern.L401is_hilited_rangeadd_hilitehilite_linehilite_screensearch_possearch_rangehist_pattern.L1234.L1330signal.cu_interrupttabstoptags.c.L11maketagent.L78.L87.L96.L105.L114.L166.L174findctagfindgtaggtagsearchctagsearchnextgtagprevgtag.L286.L501.L569.L595.L619getentryttyin.cversion.ccrtn.s_END__START_cmd_acceptunmarkjump_forwclr_filterhow_searchstrstrcan_goto_lineinttoa$XAoAMiKEtWrM05y.prompt_colireadfcloseclr_linenumstrlencurr_inoget_swindow$XAoAMiKJtWrMkZz.m_proto$XAoAMiKItWrMUUz.p_optname$XAoAMiKItWrMUUz.x_optnameget_ifile$XAoAMiKItWrMUUz.h_optnameadd_back_posno_initutf_len__xargvend_logfileget_meta_escape$XAoAMiKDtWrMUzy.sc_bl_inat_exit$XAoAMiKEtWrMU1y.ch_ungotcharnexttag$XAoAMiKHtWrMUNz.mbc_buf_lenisoptpending$XAoAMiKJtWrMkZz.mpstart_attnpos$XAoAMiKFtWrM0_y.curr_altpipereedit_ifilesigprocmaskopt_queryinit_search$XAoAMiKHtWrMkOz.startimequit_if_one_screenscreen_trashed$XAoAMiKDtWrMUzy.sc_homeabove_mem$XAoAMiKHtWrMUNz.attrdohelpml_shell$XAoAMiKItWrMUUz.optionis_utf8_well_formedback_lineset_status_coladd_linech_initforw_promptcalc_jump_slineauto_wrap$XAoAMiKItWrMUUz.quote_optnameedit_tagfilecmd_addhist$XAoAMiKItWrMUUz.L__optname$XAoAMiKHtWrMUNz.mid_ansi_chars$XAoAMiKItWrMUUz.K__optnameprogname__xargcno_back_scrolldel_ifilesnprintf_lib_versionch_ungetcharforw_raw_linejump_loc$XAoAMiKItWrMUUz.P__optnameget_scrpos$XAoAMiKItWrMUUz.O__optnameneed_clrclose_getchrget_wcharerrno_messageecalloc$XAoAMiKItWrMUUz.T__optnamefindopt$XAoAMiKItWrMUUz.S__optname$XAoAMiKItWrMUUz.B__optnamestrncpycvt_text$XAoAMiKEtWrM06y.search_type$XAoAMiKItWrMUUz.X__optnamememcpy$XAoAMiKGtWrMEIz.ifilesget_term$XAoAMiKItWrMUUz.V__optnamefind_posquiteof_displayedopt__O$XAoAMiKKtWrMEdz.taglistopt__Popt__T$XAoAMiKItWrMUUz.m_optname$XAoAMiKItWrMUUz.u_optname_GLOBAL_OFFSET_TABLE_opt__Vatexit$XAoAMiKItWrMUUz.J__optnameshell_quoteopen_getchr$XAoAMiKItWrMUUz.e_optnameevery_first_cmdsetjmp$XAoAMiKJtWrMEbz.filter_infoget_quit_at_eofsize_helpdatain_mca$XAoAMiKDtWrMUzy.sc_clearpercentagebs_mode_environ$XAoAMiKEtWrMk3y.chardef$XAoAMiKEtWrM06y.fraction$XAoAMiKKtWrMEdz.totalfopen$XAoAMiKDtWrMUzy.sc_pad$XAoAMiKEtWrM05y.cmd_offsetget_cmdbufunsave_ifile$XAoAMiKEtWrM05y.cpget_indexcurr_altfilename$XAoAMiKJtWrMEbz.is_caselessquitting$XBoAMiKFtWrMEBz.metachars.mcharsforw_linefchmod$XAoAMiKEtWrMk3y.wide_tablestrncmpinit_cmdhist$XAoAMiKItWrMUUz.F__optnameopenquoteprevtagbelow_memcmd_putstr$XBoAMiKEtWrMk3y.prutfchar.bufautobufclear_cmdch_setbufspace$XAoAMiKEtWrM06y.optgetnameclr_hilitentabstops$XAoAMiKItWrMUUz.q2_optnameget_pos__environ_lock$XAoAMiKEtWrM05y.tk_trial$XAoAMiKHtWrMUNz.columnwscrollgettagtype$XAoAMiKFtWrM09y.list_var_tableslgetenv$XAoAMiKHtWrMUNz.linebuf$XAoAMiKDtWrMUzy.sc_deinitsignal$XBoAMiKDtWrMUzy.get_term.sbuf$XAoAMiKFtWrM09y.list_fcmd_tablesback_raw_lineinit_linemarkposprev_ifile_startquietless_is_morejump_line_loc$XAoAMiKDtWrMUzy.sc_move$XAoAMiKEtWrM05y.curr_mlistvbell$XAoAMiKEtWrM06y.save_hshiftseekableis_hilited$XAoAMiKKtWrMEdz.curtagbad_filepappendeqprotocvt_alloc_chposbinattrtgetent$XAoAMiKEtWrM06y.numbertop_scroll$XBoAMiKDtWrMUzy.special_key_str.tbuf$XAoAMiKEtWrM05y.tk_textinit_option$XAoAMiKItWrMUUz.r_optname$XAoAMiKItWrMUUz.z_optname$XAoAMiKItWrMUUz.b_optname$XAoAMiKItWrMUUz.j_optname_PROCEDURE_LINKAGE_TABLE_uncompile_pattern$XAoAMiKHtWrMkOz.sparewait_messagenamelogfileinit_charsetcat_filehomefilemlist_examinetowlowereditprotogetpidis_ansi_end$XAoAMiKJtWrMEbz.hilite_anchorsave_curr_ifileskipspcmd_char__fsr_init_value___Argvwritecfgetospeedchopline$XAoAMiKDtWrMUzy.costcountopt_bclear_attn$XAoAMiKDtWrMUzy.sc_returnshell_unquotepipe_markis_null_patternis_ubin_charcreatsize_linebufat_enteropt_ihold_ifileopt_jopt_kopt_lcs_aliases_finiopt_oopt_ppos_clearsigemptysetopt_tget_timeinitial_scrposopt_x$XAoAMiKHtWrMUNz.end_ansi_chars$XAoAMiKJtWrMkYz.table_sizeputbs$XAoAMiKEtWrM05y.cmd_mbc_buf_lennifile$XAoAMiKDtWrMUzy.sc_bl_out$XAoAMiKItWrMUUz.keypad_optnamejump_percentedit_listback_textlist$XAoAMiKJtWrMEbz.filter_anchoredit_lastopen_altfilemlist_shell$XAoAMiKEtWrM05y.curr_cmdflags$XAoAMiKJtWrMkZz.message__iobprutfcharis_ttypipe_data$XAoAMiKJtWrMEbz.search_infoput_wchar$XBoAMiKGtWrMECz.forw.first_time$XAoAMiKHtWrMUNz.mbc_posgetoff_ifilejump_sline_fractiondupputc$XAoAMiKDtWrMUzy.sc_s_inheld_ifile$XAoAMiKKtWrMEdz.curseqis_ansi_middle$XAoAMiKDtWrMUzy.sc_u_inerase2_charcmd_interrno_DYNAMIC$XAoAMiKDtWrMUzy.sc_b_outfexpandgetfractionclose_altfile$XAoAMiKItWrMUUz.o_optname$XAoAMiKItWrMUUz.w_optname$XAoAMiKHtWrMUNz.pendc$XAoAMiKItWrMUUz.g_optname$XAoAMiKEtWrMk3y.utfbinfmt$XAoAMiKHtWrMUNz.overstrikefgetcwerase_charinit_prompt$XAoAMiKDtWrMUzy.sc_s_outforw_textlist$XAoAMiKGtWrMEIz.anchortabdefaultsquishedch_beg_seekierror$XAoAMiKItWrMkVz.read_labeluse_logfile$XAoAMiKHtWrMkOz.poolcharsetsregfreesecurecleantags$XAoAMiKJtWrMEbz.is_ucase_patternchg_hiliteinit_textlistforward$XAoAMiKDtWrMUzy.sc_b_insprefixgomarkignawerrmsgsopt_quoteopt_promptlinenums$XAoAMiKDtWrMUzy.hardcopyedit_index$XAoAMiKFtWrM09y.list_ecmd_tablesbinary_charentire_file_displayed$XAoAMiKEtWrM05y.in_completionch_flush$XAoAMiKEtWrM05y.tk_tlistnl_langinforegcompsc_widthis_filteringquit_on_intr$XAoAMiKJtWrMEbz.prep_endposmissing_capfind_linenum__1cG__CrunMdo_exit_code6F_v_apply_at_specialsml_searchsetlocalech_forw_getsingle_char_optionungetccreopen_curr_ifile$XAoAMiKDtWrMUzy.sc_u_outprprotois_wide_charedit_prevcheck_winchprewindreading$XAoAMiKItWrMUUz.follow_optnameinit_mark$XBoAMiKItWrMUTz.propt.buf$XBoAMiKDtWrMUyy.quit.save_statuspclosetagoption$XAoAMiKItWrMUUz.t_optnameis_filtered$XAoAMiKEtWrMk3y.comp_table$XAoAMiKItWrMUUz.d_optnamecalc_shift_count$XAoAMiKHtWrMUNz.is_null_lineeditorjump_backclr_hlistforce_logfileclear_bg_etext$XAoAMiKEtWrM06y.mcaget_filestate$XAoAMiKEtWrMk3y.comb_tablepshift_alllen_cmdbuf$XBoAMiKHtWrMURz.getmark.smclosequotesqueezebo_s_widthpflushmbcis_combining_charfprintfstrcatnew_filesprintf$XAoAMiKItWrMUUz.query_optnamecurr_devch_getflagsfstat$XAoAMiKEtWrM05y.literal$XAoAMiKEtWrM06y.optflagundo_searchset_filestatesigs$XAoAMiKHtWrMkOz.loopcountso_s_widthonscreenpsignalsclear_eolprep_hiliterepaint_hilitebadmark$XBoAMiKEtWrMk3y.prchar.bufget_returnplusoption$XAoAMiKItWrMkWz.intr_to_abortsync_logfileset_filter_pattern$XAoAMiKDtWrMUzy.sc_s_keypadcmd_resetfindtagiswuppereditcharsc_heightpr_stringch_back_getfd0bo_e_widthcommandsscrsizeany_display$XAoAMiKEtWrM05y.cmd_mbc_buf_indexmain$XAoAMiKEtWrM05y.tk_ipoint$XAoAMiKItWrMUUz.q_optnamecmd_lastpatternforw_scroll$XAoAMiKItWrMUUz.y_optnamefgetsignore_eoiscan_option$XAoAMiKItWrMUUz.a_optname$XAoAMiKEtWrMU1y.thisfile$XAoAMiKItWrMUUz.i_optnameadd_hometableempty_screenbackwardadjsline$XBoAMiKDtWrMUzy.raw_mode.curr_onutf_mode$XAoAMiKJtWrMkYz.table$XAoAMiKDtWrMUzy.sc_initpos_initforce_open$XAoAMiKFtWrM09y.list_sysvar_tablessleepinit_cmds$XAoAMiKEtWrM06y.ungot$XAoAMiKDtWrMUzy.sc_addlinebl_s_width$XBoAMiKEtWrMU1y.end_logfile.triedregexecdispversionempty_linesch_seekmlist_searchso_e_widthget_back_scrollwprotoat_switchch_lengthadd_lnum$XAoAMiKEtWrMU1y.maxbufs$XAoAMiKDtWrMUzy.sc_visual_bellstore_pos$XAoAMiKItWrMUTz.pendoptfcomplete$XAoAMiKFtWrM09y.cmdtableeq_message$XAoAMiKKtWrMEdz.circularuse_lessopen$XAoAMiKDtWrMUzy.sc_backspaceset_open$XAoAMiKDtWrMUzy.sc_eol_clearnext_ifilepostoaopt_shiftis_dirstrchrch_end_seek$XAoAMiKEtWrM05y.cmd_mbc_buflongjmpioctlput_lineedit_stdinmatch_braccurr_tagul_s_widthbin_filetgotocontrol_charedit_first$XAoAMiKHtWrMUNz.mbc_bufpr_typestrerrorhilite_search$XAoAMiKEtWrM06y.bottomposbl_e_widthpercent_posinit_signals$XAoAMiKEtWrMk3y.ubin_table$XAoAMiKHtWrMURz.marksch_getset_attnpos__ctype$XAoAMiKItWrMUUz.n_optnameml_examinepdone$XAoAMiKItWrMUUz.f_optnameline_leftlsystemspecial_key_str$XAoAMiKItWrMUUz.pound_optname$XAoAMiKJtWrMEbz.prep_startpos$XAoAMiKDtWrMUzy.sc_e_keypad$XAoAMiKDtWrMUzy.sc_lower_left$XAoAMiKEtWrM05y.cmdbufis_at_equivraw_modeadd_ecmd_tablefollow_modeadd_fcmd_tableabsul_e_widthno_keypadtwiddlelinenumtoaintreadplinenumstep_charstrcmp$XAoAMiKEtWrM05y.tk_original$XAoAMiKEtWrM06y.pipecis_ascii_char$XAoAMiKItWrMUUz.oldbot_optnamech_telllglobch_close$XAoAMiKHtWrMUNz.pendposfinal_attr$XAoAMiKEtWrM06y.ungotp$XAoAMiKItWrMkWz.obufset_mlistget_filenameungetsctoggle_option$XAoAMiKJtWrMkZz.M_proto$XAoAMiKEtWrMk3y.binfmtfilenoshow_attnsetmarklastmarkshell_coptionadd_forw_possquish_checkclear_bot$XAoAMiKItWrMUUz.k_optname$XAoAMiKItWrMUUz.tilde_optname$XAoAMiKItWrMUUz.s_optname$XAoAMiKDtWrMUzy.init_done$XAoAMiKHtWrMkOz.freelistknow_dumb$XAoAMiKFtWrM09y.edittable$XAoAMiKItWrMUUz.c_optname_get_exit_frame_monitor$XAoAMiKDtWrMUzy.attrmodeend_attnpos$XBoAMiKItWrMkWz.error.return_to_continue$XAoAMiKJtWrMEbz.hide_hilite$XAoAMiKItWrMkWz.obputchrstrcpykill_charsavepopen$XAoAMiKHtWrMUNz.mbc_buf_indexglineedit_nextoldbothprototcsetattr$XAoAMiKHtWrMkOz.anchoratoipositionfcmd_decodematch_pattern$XAoAMiKDtWrMUzy.sc_eos_clearfsync$XAoAMiKHtWrMUNz.lmargin$XAoAMiKJtWrMkZz.e_protonopendopt$XAoAMiKHtWrMUNz.cshiftctldisp$XAoAMiKJtWrMkZz.more_protosave_cmdhistshift_count_fractionPCfindopt_namecvt_length$XAoAMiKJtWrMkZz.s_prototputs_edatacurrline$XAoAMiKJtWrMkZz.h_protolseek$XAoAMiKEtWrM06y.optchar$XAoAMiKEtWrM05y.cmd_colis_composing_charopenedisattypr_expand$XAoAMiKHtWrMUNz.last_overstriketcgetattr$XAoAMiKHtWrMUNz.curr$XAoAMiKJtWrMkZz.w_protoanotate anotate  x* HP"`*#d*$l*anotate anotate  XX|\l<D hXTxXh8@danotateX P  X  Xanotate anotate anotate anotate anotate anotate anotate anotate anotate anotate anotate anotate anotate anotate anotate anotate anotate anotate anotate  hxϨy`k0hrpj@g(ihuҨv0s(thԨz({X(h֨Xnanotate anotate anotate anotate anotate anotate anotate p@   hp<  danotate anotate @(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)termios.h 1.6 92/07/14 SMI@(#)termios.h 1.42 07/01/14 SMI@(#)ttydev.h 1.7 92/07/14 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 03/09/02 SMI@(#)param.h 1.82 06/01/30 SMI@(#)mutex.h 1.22 08/05/05 SMI@(#)rwlock.h 1.10 08/05/05 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.37 06/03/10 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)langinfo.h 1.11 03/12/04 SMI@(#)nl_types.h 1.14 00/09/16 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)setjmp.h 1.38 04/09/28 SMI@(#)setjmp_iso.h 1.2 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)values.h 1.16 04/03/29 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)regex.h 1.25 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)regex.h 1.25 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03acomp: Sun C 5.10 SunOS_sparc 2009/06/03ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.497main.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g main.c -W0,-xp\$XAoAMiKDtWrMUyy.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKDtWrMUyy.;backend;raw;cd;DBG_GEN 5.2.7charsevery_first_cmd{ `voidcurr_ifile hold_ifile pintany_display Xlong)POSITIONstart_attnpos1 xend_attnpos1 logfile& force_logfile' namelogfile{( mainGnargcD|argvDpifileH`s{IX ` 4 4filename{@ D { save,`n{ {s*x p{-h D ecalloc<n count9| size9x p=h D unsigned skipspN(n{ {sLx D sprefix^n {psZx {sZp uppercaseZl c_d sc`` lena\ Dquit}H4n status{| save_status~ ې Deditproto{- editor{, less_is_more# dohelp" secure! Pquitting progname{ pwscroll scrpos!pos1#ln#initial_scrpos is_tty (new_file close_getchropen_getchredit_tagfiletagsearch1findtaginit_signalsinit_searchinit_prompterrorflushinit_optionget_quit_at_eofnopendoptisoptpendingscan_optioninit_markinit_lineget_ifilenifileprev_ifileshell_quote{cat_fileedit_stdinedit_nextedit_firsteditlgetenv{init_cmdscommandssave_cmdhistinit_cmdhistinit_charsetclear_botdeinitinitget_termraw_modes unsigned long size_tstrlen  W s Wstrcpy{ { `s s strcmp   mkstemp {mkstemp 9{exit Ucalloc    tm$ `tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst#   `__wcsftime_xpg5      iwchar_t    __wcstok_xpg5  *   wint_t__putwchar_xpg5 * j *) )__FILE __pad j# __putwc_xpg5 *  * __getwchar_xpg5 *__getwc_xpg5 *3 __ungetwc_xpg5 *j * j __fputws_xpg5s|__fputwc_xpg5 * *  __fgetws_xpg5 9  __fgetwc_xpg5 *f lockf)struncate))off64_ttell)ssize_tpwrite({ (pread({ (lseekftruncate-)s-truncatep6))off_ttellppwrite( (pread(7{ (lseekpnplockf)isattyftruncate)ssattropen\s\openatescreatsopen's's9attropen0BsopenatscreatsopenQ ftelloQfseeko|))fsetpos|)fgetpos3| FILE3tmpfileBs`srfreopenBi{BssfopenB ftellop>fseekov|))vfsetpos|fgetpos|ssfreopenBEBsEsWfopenBN`tmpfileB(Nscreen.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g screen.c -W0,-xp\$XAoAMiKDtWrMUzy.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKDtWrMUzy.;backend;raw;cd;DBG_GEN 5.2.7+intinit_donew missing_capw attrmodew raw_modeXDnwon|curr_onw 0s Xsave_term ۘsaved_termw  C Dunsigned tcflag_tunsigned char cc_tlong   termios$c_iflag#c_oflag#c_cflag#c_lflag# c_cc#ltget_envppncapnamenxnameq`srX000envnext#name#value#envsx pyP Dchar  *ltgetflagTnwGcapnamexshtgetflagw Dltgetnumnwcapnamexshtgetnumw Dltgetstr8n+capnamex+ppps` D scrsizensxsys_heightwtsys_widthwpnwldwd Dunsigned short winsizeWws_row#ws_col#ws_xpixel#ws_ypixel#special_key_stru(nwkeys|tbufv swhsp` D ( 'get_term!8nsp`xt1apt2ahtermb`termbufcosbufe ltgetentw D inc_costcountKXnw hwcI| DcostSDnw tQxtputsw DcheaperbpXn )t1_xt2_pdef_h D$tmodeszn incaprxoutcaprp+instrrh+outstrr`def_instrrXdef_outstrrP+spprH D8init n dpiw| Ddeinit#00n Dhome>Pn Dadd_lineM n Dlower_left0tn  Dline_left,n L Dcheck_winchLn ~ Dgoto_linek(n wslinenumi| Dvbelln Dbeep@Ln  Dbell pn G Dclear4n s Dclear_eol(Xn Dclear_eol_botcTn Dclear_bottx n[   saved_attrmodew| Dat_enter@pnwattr| Dat_exitn Dat_switchxnJwattr|new_attrmodewxignore_modeswt Dis_at_equivnwwattr1|wattr2x D apply_at_specialsnwwattr| Dputbs %n. DcostcountwE hardcopywk ۼtgototgetstrclear_bgw can_goto_linew below_memw above_memw bl_e_widthw bl_s_widthw so_e_widthw so_s_widthw |ul_e_widthw ul_s_widthw xbo_e_widthw bo_s_widthw sc_heightw sc_widthw werase_charw kill_charw erase2_charw Xerase_charw ignaww auto_wrapw sc_deinit sc_init sc_e_keypad sc_s_keypad sc_backspace xsc_visual_bell psc_bl_out hsc_bl_in `sc_b_out Xsc_b_in Psc_u_out Hsc_u_in @sc_s_out 8sc_s_in 0sc_eos_clear sc_eol_clear sc_clear  sc_move (sc_return sc_lower_left sc_addline sc_home sc_pad unsigned long long rlim64_t rlimit64rlim_cur-#rlim_max-#@getrlimitww@setrlimitwwunsigned long rlim_t rlimit]rlim_cur#rlim_max# getrlimitww] setrlimitwwtcsetattrw)wwtcgetattrwdw)d speed_tcfgetospeedvmpos_initputchrwlgetenvvoidecallocsave size_tstrlen/f&fstrcpyostrcmpwstrcat;mkstempwbmkstempwatoiwww tm$tm_secw#tm_minw#tm_hourw#tm_mdayw# tm_monw#tm_yearw#tm_wdayw#tm_ydayw#tm_isdstw# __wcsftime_xpg5//wchar_t __wcstok_xpg5e wwint_t__putwchar_xpg5ee   __FILE__pad#__putwc_xpg5e%e__getwchar_xpg5e__getwc_xpg5en__ungetwc_xpg5eew__fputws_xpg5w__fputwc_xpg5e,e__fgetws_xpg5t,__fgetwc_xpg5elockfwwwtruncatew off64_ttellQwQ ssize_tpwritecwZcpreadcwclseek 6wwftruncatew hw htruncatew  q off_ttell  w pwritec!2w cpreadc!rwclseek !w wlockfw!wwioctlw"wwftruncatew"Awfsyncw"fw"f"xattropenw""o"w"openatw#w"w#creatw#P##Popenw##Yw##attropenw###w#openatw$:w#w$:creatw$z$C$zopenw$$wftello$$fseekow%!w%!fsetposw%c%*fgetposw%%c FILE%tmpfile%%%freopen%&&%%%&&&8fopen%&x&/&Aftello &&xfseekow&w&fsetposw'!&fgetposw'Q%c'Qsprintfw''Z''freopen%'''%'(fopen%(C'( tmpfile%brac.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g brac.c -W0,-xp\$XAoAMiKEtWrMU0y.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKEtWrMU0y.;backend;raw;cd;DBG_GEN 5.2.7match_brac! nnnobrac|ncbracxnforwdirtnnpcn"lnestn#hpos}$`chget%Xch_back_getnch_forw_getnD(intlonguPOSITION n position} error jump_line_locch_back_getnch_forw_getnch_tell}ch_seeknchar , mkstempnd 4 mkstempn 4 nunsigned longsize_tn tm$tm_secn#tm_minn#tm_hourn#tm_mdayn# tm_monn#tm_yearn#tm_wdayn#tm_ydayn#tm_isdstn#   __wcsftime_xpg5    wchar_t    __wcstok_xpg5S    nwint_t __putwchar_xpg5S Suu__FILE__pad#  __putwc_xpg5S S __getwchar_xpg5S __getwc_xpg5S\  __ungetwc_xpg5S S n   __fputws_xpg5n   __fputwc_xpg5S S   __fgetws_xpg5b    __fgetwc_xpg5S  lockfn n n u,  truncaten  uuoff64_t tell ? nvoid? Gussize_t pwriteY n P  Y ? preadY n   Y lseek  , n  n ftruncaten ^ n u, ^ truncaten g uuoff_t tell  n? pwriteY ( n  Y preadY h n   Y lseek  n n lockfn n n u ftruncaten  n u, ,  attropenn g  # n, g openatn n p n, unsigned creatn , openn >  n, >, P attropenn G Y n, openatn n n, creatn ( , ( openn h 1 n  ftello  h fseekon  u nu fsetposn  u fgetposnJ  FILE JtmpfileY, w,  freopenY   Y, ,  fopenY&    ftello U & fseekon  u nu  fsetposn   fgetposn  , ,  freopenY\   Y, \, n fopenY e wtmpfileY!!ch.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g ch.c -W0,-xp\$XAoAMiKEtWrMU1y.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKEtWrMU1y.;backend;raw;cd;DBG_GEN 5.2.7 intch_ungotcharo} maxbufso~ ch_get͸nobppbnhnodslepto`ho\posPlenHʔʤʤʼparg7@ <<stXJ~roK~Dbufnode  next# prev# hnext# hprev# long BLOCKNUMunsignedunsigned char  8 buf 0 node# block# datasize#( data#, 8POSITIONchar LINENUMparg p_string# p_into# p_linenum#PARGunsigned long-dev_t-ino_tmode_tnlink_touid_togid_toff_ttime_ttimespec tv_sec# tv_nsec#timestruc_toblksize_tblkcnt_tXstat st_dev># st_inoN# st_mode^# st_nlinko# st_uid# st_gid# st_rdev># st_size#( st_atim#0 st_mtim#@ st_ctim#P st_blksize#` st_blocks(#h st_fstype;#pch_ungetchar}\noc{|Dend_logfile΀Ϭntriedo Dsync_logfile`n bpxbnpwarnedolblock`nblocksX$`8@8@wroteoTDbufferedрlno blockxbphbn`ho\Dch_seekҘno posxnew_blockhlen`Dch_end_seekno JlenpDch_beg_seek"8tno bn#pfirstbn$hDch_lengthBנXn Dch_tellQ؀n Dch_forw_get\ ,no ico]xDch_back_getsXno Dch_setbufspaceܤn obufspace|Dch_flushn 2bnxDch_addbufXno bppbnhDinit_hashtbl4n ho|Dch_delbufsX0n bnxDseekablePno ^of|Dch_init/n of,|oflags,xD ch_closeVln keepstateoW|Dch_getflagsno5D S?filestateP buflist# hashtbl5# fileo# flagso# fpos# nbufso# block# offset# fsize# Sthisfile| ignore_eoio  _ Xlstatohq fstatatooqo stato;qfstatoioq istat64 st_dev># st_inoN# st_mode^# st_nlinko# st_uid# st_gid# st_rdev># st_size#( st_atim#0 st_mtim#@ st_ctim#P st_blksize#` st_blocks(#h st_fstype{#p fstatatooro lstatoR Rstato[fstatoowait_messageierrorerrorireadoset_filestatevoid get_filestateget_filenamefilesizeclear_eolmkstempomkstempofreecalloc-- o-size_to +tm$ tm_seco# tm_mino# tm_houro# tm_mdayo# tm_mono# tm_yearo# tm_wdayo# tm_ydayo# tm_isdsto# = __wcsftime_xpg5Z4wchar_t ZZ n e__wcstok_xpg5eewowint_t__putwchar_xpg5%__FILEJ __pad# %__putwc_xpg5J __getwchar_xpg5__getwc_xpg5J__ungetwc_xpg5Jo  %__fputws_xpg5oY__fputwc_xpg5J %__fgetws_xpg5eeZ__fgetwc_xpg5Jlockfo;oo ;truncateo~Doff64_ttell~o ssize_tpwriteo- preadbo-lseek~o~oftruncateoo writeo- truncateoWtell{osleep pwriteo-pread3o-lseekjoolockfoooftruncateoocloseoo   attropenoWo! Wopenatoo`o! creato openo"o! " 4attropeno+=o! openatooo! creato   openoLo! %ftello~{Lfseekooo fsetposo fgetposo.%FILE . tmpfile= [ mfreopen=dv=  fopen=  %ftello 9 fseekoo qo qfsetposo  zfgetposo   freopen=!@  = !@ !Rfopen=!!I![ tmpfile=charset.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g charset.c -W0,-xp\$XAoAMiKEtWrMk3y.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKEtWrMk3y.;backend;raw;cd;DBG_GEN 5.2.7]intutf_modey Pcharycharsetname#p_flag#desc#long(charsets $ Xcs_aliasname#oname#H(cs_aliasesB  binfmtr X utfbinfmts `binattryt T ichardef\n sx cpp nyl vk D icharset\ny namex yno_errort p h a` D H ilocaledn\ cy| Dsetbinfmtn sx fmtvarptrp default_fmthLLLt` D$set_charset0 Xnas1x Dinit_charsetwx8nsxx Dbinary_charXnycx Dunsigned longLWCHARcontrol_char<ny_cx Dprcharhncxbuf  D prutfchar(nchxbuf DTTlenyl D utf_lenny9ch Dis_utf8_well_formedDny sxiyplenyl<ttmask%k Dunsigned charget_wchar7p`n `p5x Dput_wcharl,n ppixchip D step_charP|n _ppx _dirtlimithchXlenyTpH D$signed intwchar_range first#last# m comp_table  h m comp_table  h m @comb_table %  m@ comb_table b  m ubin_table /  m0 ubin_table /  m :wide_table ;  m zwide_table \; is_in_tableLny chHx tableHpytsizeHlhiyMdloyN`midyW\ D mis_composing_chari,ny chgx Dis_ubin_charsXny)chqx Dis_wide_char} nyvch{x Dis_combining_char8nych1xch2piyh D   chardefq nl_langinfoVyVsetlocaley_errorlgetenvquitstrstrstrchrUyUstrcpy^strcmpymkstempymkstempy7ysize_tyQtm$$tm_secy#tm_miny#tm_houry#tm_mdayy# tm_mony#tm_yeary#tm_wdayy#tm_ydayy#tm_isdsty# c$__wcsftime_xpg5@7@Z-wchar_t__wcstok_xpg5ywint_t__putwchar_xpg5.K__FILEp__pad.#K__putwc_xpg5p __getwchar_xpg5__getwc_xpg5p__ungetwc_xpg5.py.K__fputws_xpg5y7@__fputwc_xpg5pK__fgetws_xpg5__fgetwc_xpg5*plockfyayyatruncateyjoff64_ttellyvoidssize_tpwriteGypreadyGlseekyyftruncateyytruncatey<off_ttell<pyppwriteyypreadyGlseek<:y<ylockfyqyyftruncateyyattropenyy!openatyMy y!MunsignedcreatyV_openyy!attropeny8y!8openatyyAy!creaty_openyy!Kftello2fseekoyj@yjfsetposy@sfgetposy@KFILE tmpfile$freopeno-ofopenxKftello<fseekoy(@y(snprintfyu1!ufsetposy@~fgetposy@freopenDDVfopenM_ tmpfile2cmdbuf.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g cmdbuf.c -W0,-xp\$XAoAMiKEtWrM05y.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKEtWrM05y.;backend;raw;cd;DBG_GEN 5.2.7intin_completionw' `charopenquote3 hclosequote4 dmlist(\next\#prev\#curr_mp\#stringe#modifiedw# mlist_searchM pvoidml_searchO xmlist_examineQ ml_examineS ۀmlist_shellV Șml_shell@X ۈcurr_mlist\i X cmd_resetv  n D clear_cmd  $n D cmd_putstr H <n esxprev_ch0pch0hendlinee`  | <   (   (nseX    t  t     widthwT Dunsigned long LWCHARlen_cmdbuf ` nwsependlineehlenwd Dcmd_step_common (ne epx 0chp wlenl pwidth` bswidthXpreH  T  d  d  x     lenwD          h h  lenwD  prev_ch0@ D,wcmd_step_rightLneppxpwidthpbswidthhpeXch0P Decmd_step_leftxne 2ppxpwidthpbswidthhpeXch0P D$cmd_repaint"08n ]eold_cp x TH t( t(npe)pwidthw*lpre+` H h hnpe4pwidthw5lpre6` Dcmd_homeJXn pt H HwidthwM|bswidthwMx Dcmd_lshift]n se^xsave_cpe_pcolsw`l   d dwidthwjh L 8 8widthwphnseq` Dcmd_rshift0n sexsave_cpepcolswl  \ \widthwh Dcmd_rightPLnw 8prepncpehwidthwd Dcmd_leftx$nw ncpepwidthwlbswidthwh Dcmd_icharPnwecsxwclentseh D cmd_erasexnw}sepclenwl Dcmd_delete6 nw Dcmd_weraseI 0!nw Dcmd_wdeletec"#nw& Dcmd_kill}#H$nw\ Dset_mlist$0$nmlistxwcmdflagst D cmd_updown$&hnwwaction|sep Dcmd_addhist&'xn\mlistxecmdpml\h D cmd_accept'(n Dcmd_edit(8.<nw+wc|actionwtflagswp Dcmd_istr./dnwestrxsehactionwdendlineeX ./\ ./H ./HoseP Ddelimit_word/3pnewordeppehdelim_quotedwdmeta_quotedw`esceXesclenwT Dinit_compl35nfwordexcw 55 5L5 5L5qwordeh Dnext_compl256newaction/|eprev/p D cmd_completeG6:nw*wactionE|seHp Dcmd_char:8=nwwc|actionwtlenwp Dcmd_int=>n'9fracxpehn'`errw\ Dlong LINENUMget_cmdbuf? ?Hne{ Dcmd_lastpattern"?p?ne Dhistfile_name/?Ane2homee0pnamee1hlenw2d Dinit_cmdhistTAD,nml\VxlineW{filenameeX{f>Y{peZ{ D __FILE/__pad#  FILE/save_mlistDPEn\mlx>fphistsizewlnwhse` D save_cmdhistEGnfilenameexf>pmodifiedwl FG$do_chmodwhstatbuf~rw~ D dev_t ino_tunsigned mode_t nlink_t wuid_t wgid_t off_t time_ttimespecqtv_sec$#tv_nsec# 5timestruc_t wblksize_t blkcnt_tstatst_dev#st_ino#st_mode#st_nlink#st_uid#st_gid#st_rdev# st_size#(st_atimq#0st_mtimq#@st_ctimq#Pst_blksize#`st_blocks#hst_fstype#pcmd_mbc_buf_indexwn Hcmd_mbc_buf_lenwm ccmd_mbc_bufFl @curr_cmdflagswj  textliststringe#endstringe#tk_tlist, (tk_triale+ 8tk_ipointe* tk_originale)  tk_texte( literalw cmd_offsetw cpe prompt_colw cmd_colw ;cmdbuf Xlstatwajfstatatwwjwstatw4jfstatwbwjbstat64st_dev#st_ino#st_mode#st_nlink#st_uid#st_gid#st_rdev# st_size#(st_atimq#0st_mtimq#@st_ctimq#Pst_blksize#`st_blocks#hst_fstypet#pfstatatw wkw lstatw K  Kstatw  Tfstatw wfchmodw wputstrputchrwgetfractionis_dirwfcompleteeshell_quoteeget_meta_escapeeback_textlisteforw_textlisteinit_textlisteditcharwlgetenvein_mcawis_combining_charwis_wide_charwis_ubin_charwis_composing_charwstep_char0is_utf8_well_formedwutf_lenwprutfchareprchareputbsclear_eolbellecallocsavee##strncpye#ne#,#n#strncmpw##w## size_tstrlen#$#$strcpye$Ue$$U$gstrcmpw$$^$pmkstempw$emkstempw$efree%%atoiw%H%ww%Qtm$&$tm_secw#tm_minw#tm_hourw#tm_mdayw# tm_monw#tm_yearw#tm_wdayw#tm_ydayw#tm_isdstw# %c&$__wcsftime_xpg5#&%H#%Z&-wchar_t&&&&__wcstok_xpg5&&&&& wwint_t __putwchar_xpg5&'.& __putwc_xpg5&'l&'. __getwchar_xpg5&__getwc_xpg5&''.__ungetwc_xpg5&'&'.w' __fputws_xpg5w(=''__fputwc_xpg5&(s&'. __fgetws_xpg5&(&&(s__fgetwc_xpg5&('.lockfw)ww)truncatew)b)( off64_ttell)b)w) ssize_tpwrite))w))pread)*Fw))lseek)b*}w)bwftruncatew*w*truncatew**tell+w+pwrite)+iw+)pread)+w))lseek+wwlockfw,wwftruncatew,Iw,I,[attropenw,,R,dw!,openatw,w,w!,creatw-3,-3openw-s-<w!-s-attropenw--|-w!-openatw.w-w!.creatw.].&.]openw..fw! ftello)b..fseekow/'w/fsetposw/F'/ fgetposw/v'9 tmpfile>//freopen>///>//fopen>0:/0 ftello0i0:fseekow0'wfilenow0'0snprintfw1e0!1fsetposw1V'1fgetposw1'9fgetse1ew'1fprintfw2'1!22freopen>2]2 2>2]2ofopen>22f2xfclosew2' tmpfile>! command.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g command.c -W0,-xp\$XAoAMiKEtWrM06y.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKEtWrM06y.;backend;raw;cd;DBG_GEN 5.2.7&charyungotp; shellcmd= cmd_execUHH,nDstart_mcafHPHnvvactiona|promptapmlistahvcmdflagsadD(intvoid}in_mcapHILnvDmca_searchyIxKnDmca_opt_toggleKMHneno_promptv|flagvxdashpDexec_mcaMhR<ncbufxD mca_char Rh\nv vc| p!p flagv"l buf#i pargi$` R\, R[ R[ UX U4XX U4XX oX onameP lcvLDlong y LINENUMpargip_string#p_intv#p_linenum #PARGoptnameoname#onextx#v loption@olettery#onamesx#otypev#odefaultv#ovar#ofunc# odesc#(clear_buffersD]]TnDmake_displayS]x^n ]^ ^^ ^^ ^$^ ^$^ save_top_scrollve| save_ignore_eoivfxDprompt{^a n p|xDdispversiona@an pargixDgetccac nvBDungetcc cPd(n vc |DungetscdHdn sx ppDmulti_search-dgn { pattern*x vn*t nomorev.p save_ifile/h changed_filev0dD commandsg@Dn cv| actionvx cbufp newactionvl save_search_typevh extra` tbuf ^ pargiP old_ifileH new_ifile@ tagfile gD g< g< j0< j8 j8 |} |} |} pos  }} }} }} pos D y POSITIONpipecyI isave_hshiftvG bottompos F optgetnamevE \optflagvD XoptcharyC hfractionB pnumber A `search_typev@ Tmcav? P yd 2cungot : xgetchrvntagsvprevtagnexttagtagsearch cleantagspsignalsis_filteringvset_filter_patternsearchvclr_hiliteundo_searchclear_attnpr_stringeq_messagepr_expandempty_screenvposition errorputstrputchrvflushfindopt_nameget_quit_at_eofvopt_promptsingle_char_optionvtoggle_optionget_swindowvgomarksetmarkbadmarkvpipe_markvlsystemclr_linenumjump_locjump_line_locjump_percentrepaintjump_backjump_forwset_attnposget_filenamegetoff_ifilenext_ifiledel_ifilebackwardforwardentire_file_displayedveof_displayedvfexpandreopen_curr_ifilereedit_ifileunsave_ifilesave_curr_ifileedit_indexvedit_prevvedit_nextvedit_lastvedit_firstvedit_listvedit_ifileveditveditcharvfcmd_decodevget_cmdbufcmd_int cmd_charvcmd_acceptset_mlistlen_cmdbufvcmd_putstrclear_cmdcmd_resetch_getflagsvch_flushmatch_bracat_exitat_enterclear_botclear_eolbellcheck_winchquitsaveydunsigned longvsize_tstrlenmyystrcmpvmkstempv8mkstempv_free{vvtm$Wtm_secv#tm_minv#tm_hourv#tm_mdayv# tm_monv#tm_yearv#tm_wdayv#tm_ydayv#tm_isdstv# W__wcsftime_xpg5{`wchar_t__wcstok_xpg5!vwint_t__putwchar_xpg5!a! ~__FILE__pada#~__putwc_xpg5!!__getwchar_xpg5!__getwc_xpg5!*__ungetwc_xpg5!a!va~__fputws_xpg5vjs__fputwc_xpg5!!~__fgetws_xpg50__fgetwc_xpg5!]lockfvvvytruncatevoff64_ttell v} ssize_tpwritervv}preadvrvlseekvvftruncatev$vy$truncatevg-off_ttellgv}pwritevvpread.vrvlseekgevgvlockfvvvftruncatevvyyattropenv-vy-openatvxv6vyxunsignedcreatvyopenvvyyattropenvc vycopenatvvlvycreatvyopenv.v~ftello].fseekovsvfsetposvsfgetposvs~FILEtmpfiley=yOfreopenFXyyfopen~ftellog fseekov Ssv Sfsetposv s \fgetposv sy y freopen!"  y!"y!4fopen!t!+!=tmpfile cvt.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g cvt.c -W0,-xp\$XAoAMiKFtWrM07y.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKFtWrM07y.;backend;raw;cd;DBG_GEN 5.2.7"cvt_length@nlen|opsxD intcvt_alloc_chpos,0nIIlen*|i-lchposI.`Dcvt_textAXnodst;xosrc;pIchpos;hIlenp;`ops;\dstBPsrcCHsrc_endD@chE   src_posNdst_posODcharunsigned long LWCHAR is_ansi_middle step_char put_wcharvoid ecalloc , size_tstrlen>u5mkstempmkstemp tm$tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst# __wcsftime_xpg5>>wchar_t __wcstok_xpg5i! wint_t__putwchar_xpg5iilong__FILE__pad#__putwc_xpg5i1i__getwchar_xpg5i__getwc_xpg5iz__ungetwc_xpg5ii __fputws_xpg5__fputwc_xpg5i8i__fgetws_xpg58__fgetwc_xpg5itowloweriiiswupperlockf 4  4truncate w = off64_ttell w   ssize_tpwrite    pread  [  lseek w  wftruncate   truncate   off_ttell  ;  ;pwrite   D pread    lseek   lockf <ftruncate n  n  attropen  w   openat    unsignedcreat d ! *  dopen  m   attropen   openatN  NcreatW * openftello wfseeko5 5fsetposw>fgetposw FILEtmpfile  freopen: : LfopenCUftello fseeko fsetpos5fgetposew e wfreopenn  fopentmpfile decode.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g decode.c -W0,-xp\$XAoAMiKFtWrM09y.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKFtWrM09y.;backend;raw;cd;DBG_GEN 5.2.7#unsigned charlongwcmdtable/ wcmdtable/ edittable ʸwFedittable( ʸ char o tablelist t_nextf# t_startw# t_endw#list_fcmd_tablesf ˀlist_ecmd_tablesf ˈlist_var_tablesf ːlist_sysvar_tablesf ˘ expand_special_keys`n& wtablex &lentfmwhtow`a&\replwPklen&LD intinit_cmds$<n]Dadd_cmd_tableE`n&tlistAxwbufAp&lenAltfF`D fadd_fcmd_tableb@nIwbuf_x&len_tD add_ecmd_tablen0nwbufkx&lenktD add_var_table{Pntlistwxwbufwp&lenwlD$cmd_searchn&wcmdxwtablepwendtablehsp`pwPqwHa&DD wcmd_decodexn&vftlistxwcmdpsphtfXaction&TDfcmd_decoden&wcmdxsppD ecmd_decode  ln&4wcmdxsppD lgetenvnwwvarxa&lsw`Dgint-,n&sp+xn&.pDold_lesskey<Xn& Vwbuf9x&len9tD new_lesskeyRn& wbufNx&lenNt&sysvarNppwS`c&T\n&UXD$lesskey@n& wfilenamex&sysvartbufwhlen `nXf&TD POSITIONadd_hometablen owenvnamexwdef_filenamep&sysvarlfilenamew`parg XD$LINENUMparg p_stringw# p_int&# p_linenum o# PARGeditcharn& &c|&flagsxaction&pnch&lsw`usercmd OD o errorfilesize homefilewshell_unquotewungetscungetccgetcc&special_key_strwsavewo Runsigned long dsize_tstrlen u  [mkstemp& wmkstemp& wo getenvw2void 2free_:calloc: d d && tm$j tm_sec&# tm_min&# tm_hour&# tm_mday&# tm_mon&# tm_year&# tm_wday&# tm_yday&# tm_isdst&#  j__wcsftime_xpg5 u uswchar_t   __wcstok_xpg54&wint_t__putwchar_xpg54t4__FILE __padt# __putwc_xpg544__getwchar_xpg54__getwc_xpg54=__ungetwc_xpg54t4& t __fputws_xpg5&}__fputwc_xpg544 __fgetws_xpg5C__fgetwc_xpg54plockf&&&o truncate&off64_ttell &2  ssize_tpwrite2&) d2 2pread2& d2lseek&&ftruncate&7&o 7truncate&z@off_ttellz&read2& d2 pwrite27& d2pread2w& d2lseekz&z&lockf&&&ftruncate&&close&<&o <o Nattropen&EW& o openat&&& o unsignedcreat&2o 2open&r;& o ro attropen&{& o openat&&& o creat&\%o \open&e& ftellofseeko&& fsetpos&E fgetpos&~EFILE ~tmpfileo o freopeno o fopenZ# ftellozZfseeko&& fsetpos&fgetpos&3Eo 3o Efreopen<No o fopentmpfile$iedit.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g edit.c -W0,-xp\$XAoAMiKFtWrM0_y.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKFtWrM0_y.;backend;raw;cd;DBG_GEN 5.2.7'intfd0s ˨charcurr_altfilename/ ˠinit_textlist>ntlist;xstr;ps?hmeta_quotedsAddelim_quotedsB`escCXesclensDTD textlist string# endstring# forw_textlistjnRtlistgxprevgpsk`D back_textlistntlistxprevps`D close_file`n scrpos%pDlong  POSITION scrposW pos# lns# editnsfilenamexD edit_ifilenst|ifilexfspanswerslno_displayshchflagssdfilenameXopen_filenamePqopen_filenameHalt_filename@alt_pipe|was_curr_ifile|parg$$tstatbuf+~rs~Dvoidt  LINENUMparg p_string# p_ints# p_linenum# PARGunsigned long dev_t ino_tunsigned %mode_t %nlink_t suid_t sgid_t  off_t  time_t timespec tv_sec# tv_nsec # timestruc_t sblksize_t  blkcnt_t+  stat X st_dev# st_ino# st_mode1# st_nlinkB# st_uidT# st_gidd# st_rdev# st_sizet#( st_atim#0 st_mtim#@ st_ctim#P st_blksize#` st_blocks#h st_fstype#pedit_list(ns cfilelistxsave_ifile|hgood_filename`filenameXgfilelistPgfilenameHtl_filestl_gfilesDedit_firstH|ns Dedit_last ns Dedit_istepns V|hxsntsdirpnext|`D$edit_inextD0Xns |hAxsnAtD edit_nextKns snI|Dedit_iprevS ns S|hPxsnPtD edit_prevZPns snX|Dedit_indexd$ns snb|h|epDsave_curr_ifilexPn| 6Dunsave_ifilen |save_ifilexDreedit_ifile(n |save_ifilexnext|pprev|hDreopen_curr_ifile4nMsave_ifile|xDedit_stdinXnsDcat_fileHncs|Duse_logfileh4nTfilenamexexistsstanswerspparghDcurr_altpipe|0 curr_ino, curr_dev+ +lstatsfstatatsTs sTstats]fstatss  stat64 st_dev# st_ino# st_mode1# st_nlinkB# st_uidT# st_gidd# st_rdev# st_sizet#( st_atim#0 st_mtim#@ st_ctim#P st_blksize#` st_blocks#h st_fstype#pfstatatsjssjlstatssstatsfstatssclr_hiliteget_scrpospos_clearqueryserrorputchrsflusherrno_messagelastmarkclr_linenumheld_ifileshold_ifileopenedsset_openget_posstore_posget_indexsget_filenameget_ifile|prev_ifile|next_ifile|del_ifilebad_fileclose_altfileopen_altfilelglobbin_filesget_meta_escapeshell_unquoteungetsccmd_addhistch_getflagssch_closech_initch_forw_getsend_logfilequitskipspsavestrncmps00 size_tstrlenBy9ystrcmpsmkstempsmkstempsfree6|ss? tm$ tm_secs# tm_mins# tm_hours# tm_mdays# tm_mons# tm_years# tm_wdays# tm_ydays# tm_isdsts# Q__wcsftime_xpg5Bn6BHwchar_tnny__wcstok_xpg5yy swint_t__putwchar_xpg5 9  __FILE^ __pad#9__putwc_xpg5^__getwchar_xpg5__getwc_xpg5^__ungetwc_xpg5^s9__fputws_xpg5sm%.__fputwc_xpg5^9__fgetws_xpg5yyn__fgetwc_xpg5^lockfsOss OtruncatesX  off64_ttellst  ssize_tpwrite-stpreadvs-lseekssftruncatess truncates" telltFstFpwritesOpreads-lseektstslockfsGss isattysmsftruncatess closessattropens#s#openatsns,sncreatsw%openss attropens M s Mopenats s Vs creats  % opens! s9ftello!G!fseekos!. s !fsetposs!.! fgetposs!.! 9FILE !tmpfile" "'"9freopen" ""0"B" ""fopen" """9ftellot#"fseekos#=. s #=fsetposs#.#Ffgetposs#.!##freopen" $ ##" $ $fopen" $^$$'tmpfile" 'filename.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g filename.c -W0,-xp\$XAoAMiKFtWrMEBz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKFtWrMEBz.;backend;raw;cd;DBG_GEN 5.2.7,4shell_unquoteEXLnTLTstrCxnameTFhpTG`888escTYXesclen]ZTDcharLintget_meta_escapekxnTsTlpD metacharsynTmcharsTz ˰D metacharn]JLcDshell_quote(nT+TsxpThnewstrT`len]\escTPesclen]Luse_quotes]Hhave_quotes]DD dirfileDnTTdirnamexTfilenameppathnameT`qpathnameTXlen]Tf]PD homefile pnTI Tfilename x pathnameT hD fexpand=ȸnT Ts;x frT>h toT>` n]?\ eT@P ifileAHDvoid fcompletenT Tsx fpatTh qsT` x len]\D bin_filen] ]f| n]t bin_count]p data} pT} pendT}ʴˬ˘˘ c}Dlong Lunsigned longLWCHARseek_filesize4n>> ]f| sposQhDPOSITIONoff_treadfd `͌nT Efd x len]l ch]h bufT` pTXD __FILE 6__pad# FILE 6shellcmd>͸@n E l Tcmd<x fd E?h shellTB`8 scmdTGX esccmdTHP XX len]TLD lglobqhҠnT z Tfilenameox gfilenameTrh ofilenameTs`Ҁ fd EX sTP lessechoTH cmdT@ escT len]D open_altfile1`nT Tfilename-x pf-p pfd-h lessopenT5X cmdT6P len]7L fd E8@ returnfd]:Ԅ Ԕ Ԕ f]i cLjD$]close_altfileՈn Taltfilenamex Tfilenamep pipefdh lesscloseT` fd EX cmdTP len]LD$ is_dirׄn]@ Tfilenamex isdir]pp r]l statbufV~Ddev_tino_tunsigned`mode_t`nlink_t]uid_t]gid_ttime_ttimespectv_sec#tv_nsec#timestruc_t]blksize_tblkcnt_tLVstatst_dev@#st_inoP#st_model#st_nlink}#st_uid#st_gid#st_rdev@# st_sizeQ#(st_atim#0st_mtim#@st_ctim#Pst_blksize#`st_blocks&#hst_fstype9#p bad_fileװ\nT& Tfilenamex mThHhh is_a_dir& ˸pHpH r]d statbufV~؈HذHذHHHHH not_regC DLCL*`) filesize وn> ]f | statbufV ~D shell_coption! nTDLVlstat]FLFfstatat]]O]Lstat]fstat]]LL6stat64est_dev@#st_inoP#st_model#st_nlink}#st_uid#st_gid#st_rdev@# st_sizeQ#(st_atim#0st_mtim#@st_ctim#Pst_blksize#`st_blocks&#hst_fstype#p6fstatat]]e]Llstat]eLstat]/efstat]]]eerrno_messageTis_ansi_middle]get_filenameTlgetenvTstep_charbinary_char]seekable]ch_ungetcharecallocsaveTL8strchrTyA]LyLstrncmp]Lsize_tstrlenLstrcpyT`T(L`Lrstrcmp]i{LstrcatTTmkstemp]Tmkstemp]BTfree^calloc]]tm$itm_sec]#tm_min]#tm_hour]#tm_mday]# tm_mon]#tm_year]#tm_wday]#tm_yday]#tm_isdst]# i__wcsftime_xpg5rwchar_t__wcstok_xpg53]wint_t __putwchar_xpg53s3 __putwc_xpg533s__getwchar_xpg53__getwc_xpg53s__ungetwc_xpg5313s]1 __fputws_xpg5]:C__fputwc_xpg533s __fgetws_xpg5__fgetwc_xpg53-slockf]d]]Ldtruncate]moff64_ttell]ssize_tpwriteB]pread]Blseek]]ftruncate]]Ltruncate]7tellQ[]read]Bpwrite]pread $]BlseekQ []Q]lockf] ]]ftruncate] ]close] ]L L attropen]!H !]L!Hopenat]!]!Q]L!creat]!!`L!open]"!]L"L"%attropen]"r"".]L"ropenat]"]"{]L"creat]""`L"open]#=#] ftello#l#=fseeko]#C]#fsetpos]#C#fgetpos]$C#tmpfile EL$4L$Ffreopen E$$=$O EL$L$fopen E$$$ ftelloQ%$fseeko]%JC]pclose]%pCL%pL%popen E%%y%fileno]%CL%snprintf]&5T%&5fsetpos]&wC&>fgetpos]&C#getc]&CL&sprintf]'T&L'L' freopen E'k'') EL'kL'}fopen E''t'tmpfile E5Mforwback.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g forwback.c -W0,-xp\$XAoAMiKGtWrMECz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKGtWrMECz.;backend;raw;cd;DBG_GEN 5.2.71 intno_back_scroll{ eof_bell-HڔnDeof_displayed9ڸdn{#pos+:pDlong#POSITIONentire_file_displayedTېn{pos+UpD squish_checkh(܀nD forwܠ4n {ny| +posyp {forceyl {only_lastyh {nblankydeof{`nlines{\do_repaint{Xfirst_time{ D, back$Xnf {n| +posp {forcel {only_lasth nlines{%d do_repaint{&`D( forwardX0n {nT| {forceTx {only_lastTt pos+YhD$ backwardlni {n| {forcex {only_lastt pos+hDget_back_scrollHn{Dforw_prompt{ squished{ dscreen_trashed{ empty_lines{empty_screen{pos_clearadd_back_posadd_forw_posposition+putstrput_lineget_quit_at_eof{#LINENUMcurrlinerepaintback_line+forw_line+edit_next{ch_getflags{ch_length+clearbellvbelllower_leftadd_linehomequitcharmkstemp{mkstemp{{unsigned longsize_t{2tm$ tm_sec{#tm_min{#tm_hour{#tm_mday{# tm_mon{#tm_year{#tm_wday{#tm_yday{#tm_isdst{# D __wcsftime_xpg5! a!; wchar_t a a u l__wcstok_xpg5 l  l ~ {wint_t__putwchar_xpg5   # ,#__FILE Q__pad # ,__putwc_xpg5    Q__getwchar_xpg5 __getwc_xpg5   Q__ungetwc_xpg5    Q{  ,__fputws_xpg5{ `  !__fputwc_xpg5    Q ,__fgetws_xpg5 l  l a __fgetwc_xpg5   Qlockf{ B{{# Btruncate{  K##off64_ttell  {void  #ssize_tpwrite  ({   pread  q{ ( lseek  { {ftruncate{ {# truncate{ ##off_ttellQ{ Qpwrite {Z pread { ( lseek{{lockf{R{{#ftruncate{{#attropen{{openat{.{{.unsignedcreat{z7@zopen{{attropen{{openat{d{"{dcreat{m@open{{ ,ftello fseeko{K !#{#Kfsetpos{ !T#fgetpos{ ! ,FILEtmpfilefreopenPPbfopenYk ,ftellofseeko{  !#{# fsetpos{K !fgetpos{{ !{freopenfopen*tmpfilehelp.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g help.c -W0,-xp\$XAoAMiKGtWrMUDz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKGtWrMUDz.;backend;raw;cd;DBG_GEN 5.2.73charslong{++helpdata *intsize_helpdata Vsmkstemp0 mkstempW unsigned long `size_t tm$U tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# U__wcsftime_xpg5q W q  ^wchar_t__wcstok_xpg5    wint_t__putwchar_xpg5_  | __FILE __pad_#|__putwc_xpg5  __getwchar_xpg5__getwc_xpg5( __ungetwc_xpg5_  _|__fputws_xpg5 h q__fputwc_xpg5  |__fgetws_xpg5.   __fgetwc_xpg5[ lockf   struncate   off64_ttell void  ssize_tpwrite%x   ` % pread%  x ` %lseek   ftruncate*  s*truncatem 3  off_ttellm  pwrite%   ` %pread% 4  x ` %lseekm k  m lockf   ftruncate  s s attropen 3 s 3openat ~  < s ~unsignedcreat s open s s attropen i  % s iopenat  r s creat s open 4 |ftello c 4fseeko q   fsetpos q fgetpos  q |FILE tmpfile %s Cs Ufreopen % L ^ %s s fopen % |ftellom! fseekoY q  Yfsetpos q bfgetpos q ssfreopen %(   %s(s:fopen %z 1 Ctmpfile %ifile.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g ifile.c -W0,-xp\$XAoAMiKGtWrMEIz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKGtWrMEIz.;backend;raw;cd;DBG_GEN 5.2.74+ifile@,h_next,#h_prev,#h_filename=#h_filestateN#h_indexW# h_holdW#$h_opened5#(h_scrposy#0uchar5voidFintlong^POSITIONscrposposf#lnW#anchoru0 ifilesW2 @ incr_index8xn7 ,p5x Wincr5t D link_ifileDn ,pAx ,prevAp D unlink_ifile]tn ,p[x D new_ifilenn,; =filenamekx ,prevkpp,o` D del_ifile8n Nhxp,p Dnext_ifilenN Nhxp,h Dprev_ifileDnN= Nhxp,h Dgetoff_ifilepnN NifilexnewifileNh Dnifile,nW D find_ifileXn,6 =filenamexp,h Dget_ifile(tnN =filenamex Nprevpp,` D get_filenamen= Nifilex Dget_index nWA Nifilex Dstore_pos 8`nNifilexscrposp C D yget_posnNifilexscrposp C D set_open nLNifilex Dopened*nWNifile(x Dhold_ifile2@dnNifile/xWincr/t D held_ifile9nW >Nifile7x Dget_filestate@nN Nifile>x Dset_filestateH n NifileExNfilestateEp D unmarkecallocNsave=5 !5 3strcmpW t * <mkstempW =mkstempW =free NWunsigned long size_tW tm$ tm_secW#tm_minW#tm_hourW#tm_mdayW# tm_monW#tm_yearW#tm_wdayW#tm_ydayW#tm_isdstW#   __wcsftime_xpg5  8    wchar_t 8 8 L C__wcstok_xpg5 C  C U ^Wwint_t__putwchar_xpg5   ^ ^__FILE (__pad # __putwc_xpg5  f  (__getwchar_xpg5 __getwc_xpg5   (__ungetwc_xpg5    (W  __fputws_xpg5W7  __fputwc_xpg5 m  ( __fgetws_xpg5 C C 8m__fgetwc_xpg5  (lockfWWW^5truncateW\"^^off64_ttell\WF^ssize_tpwriteW Fpread@W lseek\wW\WftruncateWW^5truncateW^^off_ttell WF pwritesW) preadW lseekWWlockfW!WW^ftruncateWSW^5S5eattropenW\nW5openatWWW5unsignedcreatWI5IopenWRW55attropenWW5openatW3WW53creatWs<5sopenW|W ftello\fseekoW ^W^fsetposW\ #^fgetposW \ FILEtmpfile55freopen551fopenq(: ftelloqfseekoW ^W^fsetposW fgetposWJ \5J5\freopenSe55fopentmpfileZSinput.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g input.c -W0,-xp\$XAoAMiKGtWrMEJz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKGtWrMEJz.;backend;raw;cd;DBG_GEN 5.2.77forw_line0@nTLTcurr_pos.xbase_posT1hnew_posT2`cg3\blanklineg4Xendlineg5Tbackcharsg6PDlongLPOSITIONintback_linenTITcurr_posxnew_posThbegin_new_posT`base_posTXcgTendlinegPbackcharsgLDset_attnpos,n Tposx cgtD is_filteringg prep_hilite is_hilitedg is_filteredg null_line set_status_col pdone pflushmbcg pappendg pshift_all plinenum prewind ch_back_getg ch_forw_getg ch_tellT ch_seekgchar mkstempgmkstempg, gunsigned long5size_tg Wtm$*tm_secg#tm_ming#tm_hourg#tm_mdayg# tm_mong#tm_yearg#tm_wdayg#tm_ydayg#tm_isdstg# i *__wcsftime_xpg5F,F`3wchar_t   __wcstok_xpg5gwint_t__putwchar_xpg54LQL__FILEv__pad4# Q__putwc_xpg5v__getwchar_xpg5__getwc_xpg5v__ungetwc_xpg54vg 4 Q__fputws_xpg5g=F__fputwc_xpg5v Q__fgetws_xpg5 __fgetwc_xpg5 0vlockfg gggL gtruncateg  pLLoff64_ttell  gvoid Lssize_tpwrite  Mg 5 pread  g M5 lseek  g gftruncateg gL truncateg B LLoff_ttell B vg vpwrite  g 5 pread  g M5 lseek B @g Bglockfg wggLftruncateg gL  attropeng   g openatg Sg g Sunsignedcreatg  \ e openg  g  attropeng>  g >openatggGg creatg e openg g Qftello 8 fseekogpFLgL pfsetposgFy LfgetposgFQFILE tmpfile  *freopenu!3 u fopen~ Qftello Bfseekog.FLgL .fsetposgpF7fgetposgF  freopen  fopenOtmpfilejump.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g jump.c -W0,-xp\$XAoAMiKHtWrMkLz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKHtWrMkLz.;backend;raw;cd;DBG_GEN 5.2.79qjump_forwPXnpos xend_pos!pDlongPOSITIONjump_backFxnSSlinenumDxposGppargHhDLINENUMchareint parg p_stringm# p_intv# p_linenumS#}PARGrepaintfnscrposgpD scrposO pos# lnv#jump_percentxnvpercentu|fractionupposyhleny`D jump_line_loc0 n>posxvslinetcvpD jump_loc@xnposxvslinetnlinevptposhbpos`D repaint_hilite adjslinev get_scrpos onscreenv pos_clear add_back_pos position ierror error percent_pos lastmark find_pos set_attnpos back_line forw_line back forw ch_back_getv ch_forw_getv ch_tell ch_length ch_beg_seekv ch_end_seekv ch_seekv clear homemkstempvmmkstempvmvunsigned longsize_tv tm$ tm_secv# tm_minv# tm_hourv# tm_mdayv# tm_monv# tm_yearv# tm_wdayv# tm_ydayv# tm_isdstv# (__wcsftime_xpg5Ewchar_tEEYP__wcstok_xpg5PPbkvwint_t__putwchar_xpg5̀  __FILE 5 __pad# __putwc_xpg5 s 5__getwchar_xpg5__getwc_xpg5  5__ungetwc_xpg5  5v  __fputws_xpg5v D  __fputwc_xpg5 z 5 __fgetws_xpg5P PE z__fgetwc_xpg5  5lockfv &vve &truncatev i /off64_ttell i vvoid  ssize_tpwrite  v   pread  Uv  lseek i v ivftruncatev ve truncatev  off_ttell  5v  5pwrite  v > pread  v  lseek  v vlockfv6vvftruncatevhvehezattropenvqveopenatvvveunsignedcreatv^$e^openvgveeattropenvveopenatvHvveHcreatvQ$eopenvv ftello ifseekov/ v/fsetposvq 8fgetposv q FILEtmpfileeefreopen4e4eFfopen=O ftello fseekov vfsetposv/ fgetposv_ qe_eqfreopenhzeefopentmpfile%'line.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g line.c -W0,-xp\$XAoAMiKHtWrMUNz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKHtWrMUNz.;backend;raw;cd;DBG_GEN 5.2.7;Qcharslinebuf{ Hattr{ Pintsize_linebuf Xlong tabstops hntabstops dtabdefault last_overstrike# \mbc_buf_lenA `mbc_buf_indexB init_lineJn D expand_linebuf]  nnew_size_xnew_buf{fpnew_attr{gh D is_ascii_char  n chx Dunsigned long LWCHARprewind @ Ln( Dplinenum p|n posxlinenumpil bufUnP D POSITION LINENUMs,pshiftn shift|prev_chpcoshiftedhtodfrom`len\widthXprev_attrTnext_attrPp  chH Dunsigned charpshift_allg(n Dattr_swidthrH4nGap|wst Dattr_ewidth`Lna|wt Dpwidthxn#chxatprev_chhw` D$backcH!nprev_chpp{hch`width\ Din_ansi_esc_seq"#n Ap{p"(#"p""p"chh Dis_ansi_end#@#n chx Dis_ansi_middle##$n ch!x Dstore_char9$)tn ch4xa4t{rep4hpos4`w:Xreplen;Tcss<S%%`matchesDL%`'`%&%&%&%&%&p{UHbchV@&'`&'`&'`&'`p{gHprev_chh@ D(store_tab),Pn Nattr|pospto_tabhid D store_prchar,-n scposps{` D flush_mbc_buf-.n posxip Dpappend.4Hn scposprh D do_appendM4x<$nchIx{repIpposIhaN`prev_chOX8<9L<9L<:|<:|<:;:;s{P D$pflushmbc<`<nrx Dpdone=Atnendline|forwx=>>(>>(>p{p D set_status_col1AAnsc/ Dgline?BCn9i<|9ap<p D null_line]C0Cpnr Dforw_raw_linelCEPn0curr_poshx0linephp9line_lenphhnm\cnXnew_posoP D${back_raw_lineExHPncurr_posx0linepp9line_lenphn\cXnew_posPF GF GF GFGFGFGold_size_linebufLfm{@to{ D$mbc_posC 8smbc_buf@ (mid_ansi_chars{) end_ansi_chars{( pendpos' 0pendcs&  lmargin% $is_null_line$ overstrike" column  curr hshift $cshift linenumtoais_hilitedfind_linenumlgetenv{is_combining_charis_wide_charis_ubin_charis_composing_charstep_charget_wcharis_utf8_well_formedutf_lenprutfchar{prchar{control_charch_back_getch_forw_getch_tellch_seekapply_at_specialsis_at_equivvoidNecallocVssstrchr{|s size_tstrlenNmemcpyVGVmkstempn{mkstemp{freeVcallocVtm$tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst# __wcsftime_xpg5wchar_t,#__wcstok_xpg5##5> wint_t__putwchar_xpg5__FILE__pad#__putwc_xpg5F__getwchar_xpg5__getwc_xpg5__ungetwc_xpg5__fputws_xpg5__fputwc_xpg5M__fgetws_xpg5##M__fgetwc_xpg5lockfstruncate< off64_ttell<rNr ssize_tpwrite{Npread lseek<W<ftruncatestruncate off_ttellNpwriteS preadlseeklockfftruncate3s3sEattropen<Nsopenatsunsignedcreat )s )open i 2s is {attropen  r s openat! s!creat!S!s!Sopen!!\ftello<!!fseeko!!fsetpos"<"fgetpos"u"< FILE"utmpfile"s"s"freopen"""""s"s#fopen"#Q##ftello##Qfseeko##fsetpos##fgetpos$*"<s$*sprintf$m{$3s$ms$freopen"$$v$"s$s$fopen"%$$tmpfile"linenum.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g linenum.c -W0,-xp\$XAoAMiKHtWrMkOz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKHtWrMkOz.;backend;raw;cd;DBG_GEN 5.2.7Aclr_linenumNHxInpOxDlongPOSITIONLINENUMlinenum_info(\ next# prev# pos# gap# line# calcgapkIJln pixDadd_lnumJM|nR linenum}x pos}pphnew`nextpXprevpPmingapHD longloopmessageMMnD longishMNnD abort_longNOLnD find_linenum OpS,nn pos xp hlinenum`cposXD find_posSXVXn linenum}xphcpos`clinenumXD currlineVWn where|poshlen`linenumXDintstartime loopcount spareB @ poolA @freelist@ anchor? positionierrorerrorget_timeback_raw_lineforw_raw_linech_lengthch_seekcharmkstemp5mkstemp\unsigned longesize_ttm$Z tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# Z__wcsftime_xpg5v\vcwchar_t__wcstok_xpg5 $wint_t__putwchar_xpg5 $ d $Ā __FILE __pad d# __putwc_xpg5 $  $ __getwchar_xpg5 $__getwc_xpg5 $ - __ungetwc_xpg5 $ d $  d __fputws_xpg5  m v__fputwc_xpg5 $  $  __fgetws_xpg5 3 __fgetwc_xpg5 $ ` lockf  truncate  off64_ttell  void  ssize_tpwrite * } !e * pread *  }e *lseek   ftruncate / /truncate r 8off_ttell r   pwrite *  e *pread *9 }e *lseek rp rlockfftruncateattropen88openatAunsignedcreatopen!attropenn*nopenatwcreatopen9 ftello h9fseeko vfsetpos vfgetpos v FILEtmpfile*HZfreopen*Qc*fopen* ftello r&fseeko^ v^fsetpos vgfgetpos vfreopen*-*-?fopen*6Htmpfile*lsystem.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g lsystem.c -W0,-xp\$XAoAMiKHtWrMUQz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKHtWrMUQz.;backend;raw;cd;DBG_GEN 5.2.7D}lsystem-WZncmd*xdonemsg*pinp.lshell0`p1Xsave_ifile 3PXYY YY YY YY8YY8YesccmdHYHYYXYYXYlenDD charintvoid pipe_mark[\@nc|cmdp mpos` tposX bposPD long POSITION pipe_data$\p_Dn cmd x spos p epos h f%X c&T popenD$__FILE__pad# FILE6!signal6ninit_signalswinchpositionerrorget_returnputstrputchrflushmarkposshell_coptionshell_quotereedit_ifilesave_curr_ifile edit_ifilelgetenvch_forw_getch_seekclear_botdeinitinitraw_modeecalloc saveunsigned long size_tstrlen Wmkstemp~mkstempsystemfree tm$tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst# __wcsftime_xpg5  1  wchar_t 1 1 E <__wcstok_xpg5 <  < N W wint_t__putwchar_xpg5   __putwc_xpg5    __getwchar_xpg5 __getwc_xpg5  f __ungetwc_xpg5     __fputws_xpg5   __fputwc_xpg5  $  __fgetws_xpg5 < l < 1 $__fgetwc_xpg5   lockf  truncate   off64_ttell  I I ssize_tpwrite [  R [pread [   [lseek  . ftruncate ` `truncate  i off_ttell   pwrite [*  [pread [j  [lseek  lockfftruncate dup-closeRRdattropen[mopenatunsignedcreatHHopenQattropenopenat22creatr;ropen{ftello fseeko fsetpos[ "fgetpos [tmpfilefreopenfopenX!ftello Xfseeko pclose popensnprintf``fsetpos ifgetpos [putc freopen\\nfopenewtmpfileV_mark.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g mark.c -W0,-xp\$XAoAMiKHtWrMURz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKHtWrMURz.;backend;raw;cd;DBG_GEN 5.2.7FJinit_mark(_p_ni)|Dintgetumark5_`nc3|Dvoidlong POSITION scrpos] pos# ln# mark m_ifile# m_scrpos+#]getmarkH`cn cF|mIhsm]J  D badmarkc(cPnRc|Dsetmarkcdnc|mpscrpos+`CDlastmarkd(dnscrpos+pCDgomarkdfnoc|mpscrpos+`CD markposf0fnc|mhDunmarkfgnifilexitD]44marks! get_scrposerrorjump_locedit_ifilech_getflagsch_tellch_end_seekcharmkstemp mkstemp0unsigned long 9size_t[ tm$. tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# m.__wcsftime_xpg5J0Jd7wchar_t__wcstok_xpg5 wint_t__putwchar_xpg58U __FILEz __pad8#U__putwc_xpg5z__getwchar_xpg5__getwc_xpg5 z__ungetwc_xpg5 8z 8U__fputws_xpg5  A J__fputwc_xpg5 zU__fgetws_xpg5  __fgetwc_xpg5 4zlockf k ktruncate  t off64_ttell   ssize_tpwrite  I 9 pread   I9 lseek   ftruncate  truncate >  off_ttell > r rpwrite   {9 pread   I9 lseek > < >lockf sftruncate   attropen  openatO OunsignedcreatXaopenattropen::openatCcreataopenUftello 4fseekol Jlfsetpos Jufgetpos J UFILEtmpfile&freopenq/qfopenzUftello >fseeko* J*fsetposl J3fgetpos Jfreopen fopenKtmpfileoptfunc.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g optfunc.c -W0,-xp\$XAoAMiKItWrMUSz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKItWrMUSz.;backend;raw;cd;DBG_GEN 5.2.7HLcharytagoption< opt_oPgin  typeM|sMpparg|QhD intlong LINENUM parg| p_string# p_int # p_linenum# .PARGopt__Oij n type}|s}pD opt_lj@kn] type|sperr ln ht`D opt_jk0mny type|spparg|hbufyXlen Terr P kPm kXm kXm kXll kll kllsline LD ycalc_jump_slinennnDopt_shiftnqn type|spparg|hbufXlen Terr P nq nqP nqP np op op hs LD ycalc_shift_countqrPn<Dopt_k(rprn type%|s%pparg|)hD opt_t@stDn" type=|s=psave_ifile*Ahpos3B`D void" POSITIONopt__TithuTn typef|sfpparg|jhD opt_puvn type|spD opt__Pv0x|n{ type|spproto{hparg|`D opt_bxy4n type|spD opt_iy`yn & type|spD opt__Vz{,n x type|spD opt_xd{X8n  typea|sapmsg h~i i~p|j~ {x8 {~ {~ {| {| {|n s~D y opt_quoteh(n  type|spbuf mparg|`D y <opt_queryXn  type|spD get_swindow(n  Dedit_tagfile tagsearch3findtagchg_caselesserrorputstrgetfractiongetnum jump_loclglobuse_logfilereedit_ifileunsave_ifilesave_curr_ifile*lesskey ungetscdispversionch_getflags ch_setbufspacesync_logfilequitskipspsavey ]unsigned long osize_tstrlen   fy strcpy  y strcat9mkstemp `mkstemp free*  tm$ tm_sec # tm_min # tm_hour # tm_mday # tm_mon # tm_year # tm_wday # tm_yday # tm_isdst # __wcsftime_xpg5  wchar_t__wcstok_xpg5I  wint_t__putwchar_xpg5II __FILE __pad#__putwc_xpg5I I__getwchar_xpg5I__getwc_xpg5IR__ungetwc_xpg5II __fputws_xpg5 __fputwc_xpg5II__fgetws_xpg5X__fgetwc_xpg5Ilockf   ytruncate  off64_ttell5 "5 ssize_tpwriteG > oG"preadG  oGlseek  ftruncate L yLtruncate U off_ttell "pwriteG  oGpreadGV  oGlseek  lockf   ftruncate  yyattropen U yUopenat  ^ yunsignedcreat yopen , y,y>attropen 5G yopenat   ycreat yopen V ftelloVfseeko  fsetpos fgetpos 8 FILE8tmpfileGyeywfreopenGnGyyfopenGftelloCfseeko { {fsetpos fgetpos ysprintf 0y0yBfreopenG9KGyyfopenGtmpfileG] ?option.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g option.c -W0,-xp\$XAoAMiKItWrMUTz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKItWrMUTz.;backend;raw;cd;DBG_GEN 5.2.7Lintplusoptionw scan_option+ns)xo,poptcw-loptname.`printopt/Xstr0Pset_defaultw1Llcw2Herrw3Dparg(4Dchar optname oname# onext#w long (  loption@ oletter# onames# otypew# odefaultw# ovar# ofunc# odesc #((LINENUMparg( p_string# p_intw# p_linenum#PARGtoggle_option nwc|spwhow_togglelo `numw\no_promptwXerrwTparg(HD$flip_tripleTnwnwval|wlcxD proptnwc|buf  D  single_char_optiondnwNwc|opDopt_promptnwc|ohDisoptpending LnwDnostringxn@printoptxparg(pDnopendoptnpDoptstring.8ns)xp_str)pprintopt)hvalidchars)`p/PDnum_errorV(nwprintoptSxerrpSpparg(W`D getnumrHnw =spnxprintoptnperrpnhssXnwtTnegwuPDgetfractionxn spxprintoptperrphsXfracPfraclenwLDget_quit_at_eof4nw 2Dpendopt  chg_hiliterepaint_hiliteerrorfindopt_namefindoptungetscprcharquitskipspvoid ecalloc save strchr [ #w [unsigned longstrncpy  d mmkstempw mkstempw w msize_tw  tm$ tm_secw# tm_minw# tm_hourw# tm_mdayw# tm_monw# tm_yearw# tm_wdayw# tm_ydayw# tm_isdstw#  1 __wcsftime_xpg5  N   ( wchar_t N N b Y__wcstok_xpg5 Y  Y k twwint_t__putwchar_xpg5     __FILE> __pad #__putwc_xpg5 | >__getwchar_xpg5 __getwc_xpg5 >__ungetwc_xpg5  >w__fputws_xpg5wM__fputwc_xpg5  >__fgetws_xpg5 Y Y N__fgetwc_xpg5 >lockfw/ww/truncatewr8off64_ttellrw ssize_tpwrite w m preadVw  mlseekrwrwftruncatewwtruncatewoff_ttell6w 6pwritew? mpreadw  mlseekwwlockfw7wwftruncatewiwi{attropenwrwopenatwwwunsignedcreatw_%_openwhwattropenwwopenatwIwwIcreatwR%openwwftellorfseekow0w0fsetposwr9fgetposwrFILEtmpfilefreopen55Gfopen>Pftellofseekowwfsetposw0fgetposw`r`sprintfwifreopenfopenR tmpfile8!opttbl.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g opttbl.c -W0,-xp\$XAoAMiKItWrMUUz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKItWrMUUz.;backend;raw;cd;DBG_GEN 5.2.7Plongjump_sline_fractionw+ shift_count_fractionw, intless_is_more< charoptnameJoname #onextJ#a_optnameA b_optnameB (B__optnameC 8c_optnameD Hd_optnameE Xe_optnameI hf_optnameJ xF__optnameK ؈g_optnameM ؘh_optnameO بi_optnameP ظj_optnameQ J__optnameR k_optnameT K__optnameV L__optnameW m_optnameX n_optnameY (o_optname[ 8O__optname\ Hp_optname^ XP__optname_ hq2_optname` xq_optnamea وr_optnameb ٘s_optnamec ٨S__optnamed ٸt_optnamef T__optnameg u_optnamei V__optnamej w_optnamek x_optnamel X__optnamem (y_optnamen 8z_optnameo Hquote_optnamep Xtilde_optnameq hquery_optnamer xpound_optnames ڈkeypad_optnamet ژoldbot_optnameu ڨfollow_optnamev ڸ   wloption@oletter#onamesJ#otype#odefault#ovar#ofunc# odesc#(  woption    w+option init_option`\n oo oxp pDfindoptDn o c|o ohDis_optcharpn cDfindopt_name n o ~ ~p_optname x ~p_oname pp_err hoptname Xo oPonameJHlenDuppercase@maxo omaxonameJmaxlenambigexactD$ hilite_search9 oldbot7 ,follow_mode6 quit_on_intr5 use_lessopen4 status_col3 shift_count2 show_attn1 twiddle0 no_keypad/ no_init. chopline- jump_sline* swindow) force_open( ctldisp' bufspace& autobuf% hlinenums$ caseless# \forw_scroll"  back_scroll! tabstop squeeze quit_if_one_screen quit_at_eof know_dumb bs_mode pr_type 0top_scroll how_search quiet opt_queryopt_quoteopt_xopt__Vopt_iopt_bopt__Popt_popt__Topt_topt_kopt_shiftopt_jopt_lopt__Oopt_olgetenv sprefixunsigned longsize_tstrlenmkstemp mkstemp, 5tm$tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst# G__wcsftime_xpg5d,>wchar_tddxo__wcstok_xpg5oowint_t__putwchar_xpg5 w/ w__FILET__pad#/__putwc_xpg5T__getwchar_xpg5__getwc_xpg5T__ungetwc_xpg5T/__fputws_xpg5c$__fputwc_xpg5T/__fgetws_xpg5ood__fgetwc_xpg5TlockfEwEtruncateNwwoff64_ttellvoidwssize_tpwrite+preadt+lseekftruncatewtruncate wwoff_ttell TTpwrite]pread+lseek  lockfUwftruncatewattropenopenat11unsignedcreat}:C}openattropenopenatg%gcreatpCopen/ftellofseekoN$wwNfsetpos$Wwfgetpos$/FILEtmpfilefreopenSSefopen\n/ftello fseeko $ww fsetposN$fgetpos~$~freopenfopen-tmpfileW#fos.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g os.c -W0,-xp\$XAoAMiKItWrMkVz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKItWrMkVz.;backend;raw;cd;DBG_GEN 5.2.7R[ireadJnfdF|bufFplenFlnKd\\\0PmaskfT((((consecutive_nulls D$intcharunsignedlong    __sigbits# sigset_tintreadn_Dget_time(@ntpD time_terrno_messagehn>filenamexphm`len\DpercentageHnnumxdenpnum100`D POSITIONpercent_posnoposxpercenttfractionhperdenXtempPD `  ojmp_bufread_label<  reading: `longjmpsetjmp55sigprocmask>GsigemptysetGflushquitvoidecallocunsigned long size_tstrlenJstrerrorrmkstempmkstemptm$ tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# __wcsftime_xpg5wchar_t  __wcstok_xpg5  f    wint_t__putwchar_xpg5 f  f ؀ __FILE __pad # __putwc_xpg5 f & f __getwchar_xpg5 f__getwc_xpg5 f o __ungetwc_xpg5 f  f   __fputws_xpg5   __fputwc_xpg5 f - f  __fgetws_xpg5  u  -__fgetwc_xpg5 f  lockf  truncate   off64_ttell  R R ssize_tpwrite d  [ dpread d   dlseek  7 ftruncate i itruncate  r off_ttell  read d pwrite di dpread d  dlseek  lockfftruncateII[attropenRdopenatcreat33opens<sattropen|openatcreat]&]openf ftello fseeko fsetposF  fgetposv  FILE vtmpfilefreopenfopenR  ftello Rfseeko snprintffsetposH fgetposx xfreopenfopen'tmpfiletime<%output.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g output.c -W0,-xp\$XAoAMiKItWrMkWz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKItWrMkWz.;backend;raw;cd;DBG_GEN 5.2.7Tput_line0nc1|i2xa3tDintcharobN flushbnWnc|fddxDputchr>nc<|D putstrtlnsrxD postoapniqnumxbufp negl tbufU sHD long iPOSITION  i linenumtoapn33numxbufp negl tbufEU sHD iLINENUM b i inttoannum|bufp negl tbuf_ sPD   i iprint_intnlnum| buflmD   i iprint_linenum0hn3numx buf_D  iless_printftnfmtxpargp s` col\D pargp_string#p_int#p_linenum3# PARG get_returnn8 c|D error nfmtxpargp coll return_to_continue D  ii intr_to_abort#  C i intr_to_abort&#  ierror/nfmt,xparg,pD queryBn =fmt?xparg?p cCh colDdD  \iobuf =M  Hat_prompt final_attr Tneed_clr errmsgs getchrglinesquish_checkungetccputbsat_switchat_exitat_enterclear_botlower_left unsigned long size_tstrlen    strcpy $ mkstemp Kmkstemp r {tm$ Ntm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst#   N__wcsftime_xpg5   r   Wwchar_t    __wcstok_xpg5     wint_t__putwchar_xpg5  X  i u i__FILE __pad X# u__putwc_xpg5    __getwchar_xpg5 __getwc_xpg5 ! __ungetwc_xpg5 X  X u__fputws_xpg5aj__fputwc_xpg5    u__fgetws_xpg5 '  __fgetwc_xpg5 T lockfitruncatei ioff64_ttellvoid issize_tpwriteq preadq lseekftruncate#i#writel, ltruncateui ioff_ttellpwrite6 preadvq lseeklockfiftruncatei(attropenu1uopenat~unsignedcreat  openLL^attropenUgopenatcreat66openv? uftellovfseekojiifsetposjifgetposXj uFILEXtmpfilegfreopenggfopeng4 uftelloc4fseekojiifsetposjfgetpos j freopengj(gj|fopengstmpfileg &pattern.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g pattern.c -W0,-xp\$XAoAMiKJtWrMkXz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKJtWrMkXz.;backend;raw;cd;DBG_GEN 5.2.7Vcompile_pattern2n``opatternx`search_typetcomp_patternh,DDcompc Xpcompl!PD$intchargvoidxunsigned long size_t _regex_ext_t 0Q re_nsub# re_comp# re_cflags`# re_erroff# re_len# re_sc#( regex_tQc compile_patternmn`.opatternix`search_typeitcomp_patternihcvt_patternonXresult`oTD$uncompile_pattern(dnpatternxpcomplpD is_null_patternn`patternxDmatch@n`opatternx`pattern_lentobufh`buf_lendpfoundXpendPppo@lpopattern_endobuf_endoDo match_patternpn`}patternxotpatternpolineh`line_lendspXepP`notbolL`search_typeHmatched`@spatterncrm"flags`D,g}long regoff_t (" rm_sp# rm_ep# rm_so# rm_eo# rm_ss`# rm_es`#$ regmatch_tregfree_7_gqregexec`hz`gregcomp` "7`errorcvt_textcvt_length`ecallocg dstrlen  mmkstemp` omkstemp` ofree `` tm$ tm_sec`# tm_min`# tm_hour`# tm_mday`# tm_mon`# tm_year`# tm_wday`# tm_yday`# tm_isdst`#  ! __wcsftime_xpg5 >   wchar_t > > R I__wcstok_xpg5 I  I [ d `wint_t__putwchar_xpg5    __FILE . __pad # __putwc_xpg5  l  .__getwchar_xpg5 __getwc_xpg5   .__ungetwc_xpg5    .`  __fputws_xpg5` =  __fputwc_xpg5  s  . __fgetws_xpg5 I  I > s__fgetwc_xpg5   .lockf```gtruncate`b( off64_ttellb`x ssize_tpwrite`xpreadF`lseekb}`b`ftruncate``gtruncate` off_ttell&`x&pwritey`/pread`lseek``lockf`'``ftruncate`Y`gYgkattropen`bt`gopenat```gunsignedcreat`O gOopen`X`ggattropen``gopenat`9``g9creat`yBgyopen`` ftellobfseeko`  ` fsetpos`b )fgetpos` b FILEtmpfileggfreopen%g%g7fopenw.@ ftellowfseeko` `fsetpos`  fgetpos`P bgPgbfreopenYkggfopentmpfile(position.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g position.c -W0,-xp\$XAoAMiKJtWrMkYz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKJtWrMkYz.;backend;raw;cd;DBG_GEN 5.2.7Xulong{POSITIONtable position*(nwhere(|Dint add_forw_pos?P0napos=xi@tD add_back_posPPnposNxiQtD pos_clear`(nia|D pos_initln:scrpos:mpD scrposl pos# ln#onscreen nposxipDempty_screen0lnDempty_lines0nis|exipD get_scrpos`<nscrposxitD:adjsline`nsline|Dtable_size Hvoid3 ecalloc;charX mkstemp` mkstemp`free;unsigned longsize_t tm$ tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst#  __wcsftime_xpg5-wchar_t--A8 __wcstok_xpg588JSwint_t __putwchar_xpg5{{ __FILE __pad# __putwc_xpg5[__getwchar_xpg5 __getwc_xpg5 __ungetwc_xpg5 __fputws_xpg5 , __fputwc_xpg5 b __fgetws_xpg58 8- b __fgetwc_xpg5  lockf {X  truncate Q {{off64_t tell Q 3 {ssize_t pwrite    3 pread  5  lseek Q l Q ftruncate {X truncate  {{off_t tell  3  pwrite  h  pread    lseek    lockf { ftruncate H{X HX Z attropen  Q cX openat  X unsigned creat> X> open~GX~X attropenX openat(X( creath1Xh openq ftello Q fseeko{{ fsetposQ{ fgetposQFILEtmpfileXX freopenXX& fopenf/ ftello f fseeko{{ fsetpos fgetpos?QX?XQ freopenHZXX fopentmpfilee)8prompt.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g prompt.c -W0,-xp\$XAoAMiKJtWrMkZz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKJtWrMkZz.;backend;raw;cd;DBG_GEN 5.2.7Z}charwlongs_proto+ V43s_proto+ Vw(m_proto - VMcLm_protoF- VwM_proto/ WDfeM_proto/ WDw"e_proto1 WT]Se_proto@1 Ww{h_proto3 W{POh_proto3 Www_proto5 XNWw_proto:5 XNwumore_proto~7 Vu;:more_proto7 Vw  eqproto; w ) hproto2< w Y wprotob=  init_promptG0Xn D ap_strVxlnsTxlenWt D wint ap_chargƐƴngwcebufgh} Dw ap_posunpossxbufva DPOSITIONw ap_linenum Hn\\linenumxbufna DLINENUMw ap_inthǐnnum|bufo Dw  ap_questǰn% Dcurr_bytenwhere|posh Dcond pnwcwherexlenh D protocharXn c|wherexiseditprototposhlen`n\linenum\Plast_linenum\Hh @ D$void skipcond՘ָn Cpxiflevell Dwherechar|n px wpp D pr_expandبn Eprotoxmaxwidthtp`c\whereX D eq_message((`n ~ Dpr_string4܈ݸn prompt5ptype6l Dwait_messageETn  Dmp@ Pw Tmessage 6? X  prproto r: 8inttoalinenumtoapostoacurr_tagntagsadjslinepositionpercentagecurrline\find_linenum\get_indexget_filenamenifilenext_ifile eof_displayedch_getflagsch_lengthsavew unsigned longstrncpyw$-w w-size_tstrlenw w strcmpmkstemp:mkstempa  jtm$=tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst# | =__wcsftime_xpg5asFwchar_t   __wcstok_xpg5wint_t__putwchar_xpg5Gd__FILE__padG# d__putwc_xpg5__getwchar_xpg5__getwc_xpg5__ungetwc_xpg5G G d__fputws_xpg5PY__fputwc_xpg5 d__fgetws_xpg5__fgetwc_xpg5Clockfzw ztruncateoff64_ttell ssize_tpwriteX- preadX-lseekftruncate w  truncateMoff_ttellM pwrite-preadX-lseekMKMlockfftruncatew w attropenw openat^w ^unsignedcreatgpw openw w attropenIw IopenatRw creatpw open dftelloCfseeko{Y {fsetposY fgetposYdFILE tmpfilew #w 5freopen,>w w fopen dftelloMfseeko9Y 9fsetpos{YBfgetposYw w freopenw w fopenZ#tmpfile$*search.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g search.c -W0,-xp\$XAoAMiKJtWrMEbz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKJtWrMEbz.;backend;raw;cd;DBG_GEN 5.2.7^hilitehl_next#hl_startpos#hl_endpos#wlongPOSITIONhilite_anchorw7 (filter_anchorw8 @set_patternQހߌn  infoMx patternMp search_typeMl D$intunsigned longsize_tvoid _regex_ext_t 0re_nsub#re_comp#re_cflags#re_erroff#re_len# re_sc#(regex_tcharpattern_info compiled#text#search_type# clear_patterni߸nY  infogx D init_patternv8n  infotx Dinit_searchXn Dget_cvt_opsnopsx Dis_ucasen strxstr_endhch` DLWCHARprev_pattern<n  infox Drepaint_hilitehn on|slinenumxpospeposhsave_hide_hilited Dclear_attn8(nNslinenum|old_start_attnpospold_end_attnposhpos`eposXmovedT Dundo_search Hn Dclr_hlist3nanchor1xhl4pnexthl5h Dclr_hiliteBn! Dclr_filterH,nR Dis_hilited_rangeSPnposPxeposPphlT` D is_filteredh0n *posfxhlih Dis_hilitedn posxepospnohidel p_matches`matchX D(add_hilite0n Danchorxhlpihlh D hilite_lineP(n Nlineposxlinepline_lenl chpos`spXepPcvt_opsLsearchp@line_endhl D8chg_caselessHn Dhilite_screen'(n scrpos (p Dscrpos pos#ln#chg_hilite6Hn . Dsearch_posKn search_typeI|posLhlinenumMd Dsearch_rangeTnyposxendpospsearch_typelmatcheshmaxlinesdyplineposXypendposPline@clineline_lenlinenumspepline_matchcvt_opscvt_lenchpos linepos~oldpos~8T8L8Lline_filter~<LLhl~ D8LINENUMhist_patternLnsearch_typeJ|patternNp Dsearchw nsearch_types|patternspnslposx` D$prep_hiliteHtnsposxepospmaxlineslnprep_startpos `nprep_endpos Xnew_epos Pmax_epos Hresult Di@hLLLsearch_types D$set_filter_pattern8nTpatternxsearch_typet D is_filteringXn Dfilter_infoG 8search_infoF  is_ucase_pattern/ his_caseless. Pprep_endpos- `prep_startpos, Xhide_hilite+ Tadjslineget_scrposempty_screenpositionmatch_patternis_null_patternuncompile_patterncompile_patternerrorput_linefind_linenumadd_lnumback_raw_lineforw_raw_linejump_locrepaintforw_linecvt_textcvt_alloc_chpos cvt_lengthcmd_lastpatternset_mliststep_charch_getflagsch_lengthch_end_seekgoto_linelower_leftecallocstrlen  strcpyNmkstempumkstempfreeabstm$tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst# __wcsftime_xpg5wchar_t'__wcstok_xpg509wint_t__putwchar_xpg5Ԁ__FILE__pad#__putwc_xpg5A__getwchar_xpg5__getwc_xpg5__ungetwc_xpg5__fputws_xpg5__fputwc_xpg5H__fgetws_xpg5H__fgetwc_xpg5iswupperlockftruncate_%off64_ttell_ssize_tpwritepreadClseek_z_ftruncatetruncateoff_ttell##pwritev,preadlseeklockf$ftruncateVVhattropen_q openat unsignedcreatL LopenU attropen openat 6  6creat v ? vopen   ftello_  fseeko!!fsetpos!_!&fgetpos!!_FILE!tmpfile!!!freopen!""!!!"""4fopen!"t"+"=ftello""tfseeko""fsetpos#"fgetpos#M!_#M#_freopen!##V#h!##fopen!###tmpfile!',signal.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g signal.c -W0,-xp\$XAoAMiKJtWrMEcz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKJtWrMEcz.;backend;raw;cd;DBG_GEN 5.2.7dUu_interrupt.\ntype,|DintstopJntypeH|DwinchZ n;typeX|Dinit_signalsn~on|Dpsignals n-tsignals|   old_widthxold_heighttD sigs  killv     v    signal  flushintreadcalc_shift_countcalc_jump_slineclear_botbelldeinitinitget_termraw_modequitchar n mkstemp v mkstemp v unsigned longsize_t tm$tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst#   __wcsftime_xpg5'    wchar_t '' ; 2 __wcstok_xpg52 2 D Mwint_t __putwchar_xpg5 longՀ__FILE__pad#  __putwc_xpg5]  __getwchar_xpg5 __getwc_xpg5  __ungetwc_xpg5     __fputws_xpg5.   __fputwc_xpg5d    __fgetws_xpg52 2 ' d __fgetwc_xpg5  lockf    n  truncate S  off64_t tell S void ssize_t pwrite    pread  ?   lseek S v  S  ftruncate  n truncate off_t tell     pwrite  r  (  pread    lseek    lockf   pid_tgetpid  ftruncate v  n vn attropen  n openat  n unsigned creat l ) 2n l open u n n attropen n  openatV   n V creat _ 2n  open    ftello S  fseeko=    = fsetpos  F  fgetpos  FILE tmpfilen n  freopenB   n Bn T fopen K ]  ftello   fseeko     fsetpos=   fgetposm  n mn  freopen v  n n  fopen  tmpfile.tags.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g tags.c -W0,-xp\$XAoAMiKKtWrMEdz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKKtWrMEdz.;backend;raw;cd;DBG_GEN 5.2.7echarstags{ hlongLINENUMtag0Qnext#prev#tag_file{#tag_linenum#tag_pattern{# tag_endlines#(taglisttl_first#tl_last#taglistQC X cleantags\  ntp]x D maketagentw  n {nameqx {fileqp linenumqh {patternq` endlineq\tpxH Dint gettagtype  nfx D findtag nV {tagxtypetresultVp Dtag_resultTAG_FOUNDTAG_NOFILETAG_NOTAGTAG_NOTYPETAG_INTR tagsearchn DPOSITION nexttag0n{O n|tagfile{h D prevtagXn{ n|tagfile{h D ntags$n D curr_tagP|n Dfindctag|nV_{tag xp{hf`taglen\taglinenumPtagfile{Htagpattern{@tagendlinesearch_charerrtline{tp{ D|__FILE__pad_#|FILEsedit_tagfile}n Dctagsearch8nposplineposhlinenum`len\line{P Dfindgtag8nV {tagxtypetbuf }fp}tp}command{}flag{}qtag{}cmd{}hhhname{ }file{ }line{ }len!}dc0} D s circularX pnextgtaga 0n{ vtpbp Dprevgtag X!n{ tpp Dgtagsearch!"n Dgetentry"8(n {bufx tagp fileh line`p{P D({curtagK pcurseq |total xerrorgetnumfind_posfind_linenumadd_lnumforw_raw_lineshell_quote{shell_unquote{editlgetenv{skipsp{void ecalloc s s unsigned longstrncmp[ s[size_tstrlenmdsstrcpy{{ssstrcmp8mkstemp_{mkstemp{free satoitm$tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst# __wcsftime_xpg5mmwchar_t$__wcstok_xpg5~-6wint_t__putwchar_xpg5~~|__putwc_xpg5~~ __getwchar_xpg5~__getwc_xpg5~E__ungetwc_xpg5~|~||__fputws_xpg5__fputwc_xpg5~~|__fgetws_xpg5K__fgetwc_xpg5~xlockfstruncateoff64_ttell( (ssize_tpwrite:1: pread::lseek ftruncate?s?truncateHoff_ttell pwrite: :pread:I:lseeklockfftruncateclosess attropenm)!smopenatv!sunsignedcreatsopenD !sDsVattropenM_!sopenat!screat.s.openn7!|ftellonfseekofsetposfgetposP tmpfileseswfreopennssfopen|ftelloCfseeko{pclosesspopenfsetpos5fgetposefgets{{fgetcssprintf{!ssfreopena sassfopenj|fclose tmpfile/ttyin.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g ttyin.c -W0,-xp\$XAoAMiKKtWrMEez.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKKtWrMEez.;backend;raw;cd;DBG_GEN 5.2.7iopen_getchr$))nDclose_getchrZ))nDgetchrf)*tn33c:g{result3htDintchartty3 iread3 quit : mkstemp3 x mkstemp3 x 3unsigned long size_t3 tm$tm_sec3#tm_min3#tm_hour3#tm_mday3# tm_mon3#tm_year3#tm_wday3#tm_yday3#tm_isdst3#   __wcsftime_xpg5)    wchar_t )) = 4 __wcstok_xpg54 4 F O 3wint_t __putwchar_xpg5 long׀__FILE!__pad#  __putwc_xpg5_  !__getwchar_xpg5 __getwc_xpg5 ! __ungetwc_xpg5  !3   __fputws_xpg530   __fputwc_xpg5f  !  __fgetws_xpg54 4 ) f __fgetwc_xpg5 ! lockf3 3 3 :  truncate3U   off64_t tellU 3void  ssize_t pwrite 3     preadA 3    lseekUx 3 U 3 ftruncate3 3 :  truncate3   off_t tell ! 3 ! pwrite t 3 *   pread 3    lseek 3  3 lockf3 " 3 3  ftruncate3 T 3 : T: f attropen3 ] o 3: openat3 3 3: unsigned creat3 J  : J open3 S 3: : attropen3 3: openat3 4 3 3: 4 creat3 t = : t open3 } 3  ftelloU fseeko3    3  fsetpos3 ]  $  fgetpos3  ] FILE tmpfile : : freopen  :  : 2 fopen r ) ;  ftello r fseeko3   3  fsetpos3   fgetpos3K  ]: K: ] freopen  T f : :  fopen   tmpfile 1version.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g version.c -W0,-xp\$XAoAMiKKtWrMEfz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKKtWrMEfz.;backend;raw;cd;DBG_GEN 5.2.7jcharlongyversion t /var/tmp/less-436/usr/include/sys/usr/include/isomain.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h 0 $0$]0} 4!\y$4z <0I0H)0H(,   d "! !D$!$$ $( !   0  $$ (45 !<,< q  H) D Q /var/tmp/less-436/usr/include/sys/usr/include/isoscreen.ctermios.hresource.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h X,)0J;! %   $ 00~ 44$ (  ,T( , ( 8,($ :1(414!(414  (,,,,,,,,,  ~ 4 , ,0000 H -HH8( 8((8()8()8()8I 8e 8I 8()!x8(), 8H,,@% ,,T% 8(,,()@ X 0   <  p  5   4  ((!0!   (H(H 4    0 ((H(   P    . 0     ( ,5 @ p(   X 1 (A9 x((! @888   (8(8(8(   = ( (   /var/tmp/less-436/usr/include/sys/usr/include/isobrac.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h   -05-$9-$ H-  8t$ /var/tmp/less-436/usr/include/sys/usr/include/isoch.cless.hstat.htypes.htime_impl.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h (=$\ (a5 v    !$,('4  0A$),(-@$T <$5 ( ,,' 0 8$  ΀(I $ (~$  @!E%8y  $o рa$| Ҙ(@$m01 ({ $D (,= (~ 8 $,E(} (  נ((,$$ ؀(@  (4 8! X(, ,\8) @(! ( $I~    -$  % $8tx D} X=$,|   P4 4,P $$$489,$ ( 0(-$) ($_ /var/tmp/less-436/usr/include/sys/usr/include/isocharset.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h !0$m -$$(]&,"- 011{ 11 y $ 0,0-y    !5y!$$$$z  $($1( 0   x$9$8 X( ( ( hPH 8@ (85(UT$!$8),}         $( 0@((~ p  W+  DHLHHLHHHLHHHHHHHHHE P eT )89 1 $!,0 ,!x  4 X4 4 8 `|R /var/tmp/less-436/usr/include/usr/include/iso/usr/include/syscmdbuf.cless.hstdio_impl.hstdio_iso.hstat.htypes.htime_impl.htime_iso.hwctype_iso.h  ($   4   H !( 6!)09E045o  ` % }  (  --%%0-4 5D x 1D 0-!(@  w -!( x,- X 089 y  < 0$|$y 0  0$|0  P (@d 4-(z x  )(|@ 489 P T H& $   ! |p   0TT ", L #H $( $0 (1 $A ((H- &$  '(4% (8 % ! ! LM,- TUTU $ ,-  ! ! ! ! !   ) .!)$(x  /LU4< ~ ,$=m,00 m  3)$($H$$1   ($ 51 { 6 )  4  8  001d$$  :8 )  (5(!!P8     1z , = D2A= ?   ?p (, ? $1]$ <$H A ,u1%5{4$ j  DP $% |,2- E ((,(9988V /var/tmp/less-436/usr/include/sys/usr/include/isocommand.cless.hoption.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h H HP    H` Ix,()!( ( ( ( ,,() ( K$$I (   y  Mh00,45($ %(@ @@( !($((94(,$7 Rh 0  =$ z 8@0 j )( l$P($T0)<$z l)!E<-$ (((j&4~& ]$ ]x!!@)  ! ^px(  0 a@( a! 4m cP((9$D dH8- d(!  0(!% g@ @ )((((m 8 ,(((($0(((0( D$0( 0( D$0( 0((($0$ )}H(,($,(,,( $)) <($(8$( ,  (  ( $ l0l xl  x0l $, )$< )$$E$% 0 !$(  LT)!$( 5T)( ,$%( ,$%( 4$$ (%  ,)$< $,,)$,l,$ <0( x8,D ( xD ),z)1 /var/tmp/less-436/usr/include/sys/usr/include/isocvt.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h @ -!(- X)!1( l  D~8$ 8^%D 0 /var/tmp/less-436/usr/include/sys/usr/include/isodecode.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h  )!4  < 2k$!(< W- ( 5 `1   @<$ <$ P 4$ 1 !(&$!  <= ! ,-  %8| 8  8 808 -<!   D4 !44$0   Ո ( 4D$8 $ װ 0  $$)0  و,  j /var/tmp/less-436/usr/include/sys/usr/include/isoforwback.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h H-( ڸ;(L ې H ((  ܠ   ))(0h   X ph( 0  Y ,4 A0 (($(( /var/tmp/less-436/usr/include/sys/usr/include/isohelp.ctypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h /var/tmp/less-436/usr/include/sys/usr/include/isoifile.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h x8("5  0  0    8,4 @, @, p,,   X<0~  (,$   8( (   @$   N /var/tmp/less-436/usr/include/sys/usr/include/isoinput.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h @8 m%)!)$(r)U$(, T 8)|  -Y)8)|  ) %9U(E 9} !T $,<  /var/tmp/less-436/usr/include/sys/usr/include/isojump.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h P"!$ 08 x5(41,)   )$)$, , 0e(  @=5(%$ % M(g  9-(h ( 9 /var/tmp/less-436/usr/include/sys/usr/include/isoline.cless.htypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h 0H)0H),,   $%-@@$%   $  @ (0  p )5h=40  X(:-44 A0P |  @4@5A((TQ I4I?  : ;  I: .?  6 : ; @ ID I: ;  4I : ;   D D .?  : ;@ ID  I: ; 4I : ; .?  : ;@ D  :  I8 .? < D .? < ID &I.? < ' ID I.? < ' D I !I/ .? < ' ID  DD%$> 4I : ;  4I?  : ;  .?  : ;@ D I: ; 4I : ;   D D I: I  !I/  :  I8 . : ;@ ID  I.? < ID .?  : ;@ ID I !I/. : ;@ D .? < ' ID I&I.? < D .? < ' ID  DD%.?  : ; @ D I: ;  4I : ;  .? < ID D D $> I: ID I .? < D .? < ' ID  I&I :  I8 I !I/ .? < ' ID  DD%$> 4I : ;  .?  : ; @ ID  4I : ; D D   I8 I I I  !I/ I:  :  : I !I/ .?  : ;@ D I: ; . : ;@ ID .?  : ;@ ID . : ;@ D 4I?  : ;  &I.? < ' ID I.? < ID .? < D .? < ' D  .? < ' ID ! DD%$> 4I?  : ;  I  I8 I !I/ 4I : ;  . : ; @ D  I: ;  D D . : ; @ ID . : ;@ D  4I : ; .?  : ;@ D .?  : ;@ ID I: ; I: I I!I!I/. : ;@ ID .? < ' ID I&I.? < D .? < ID  :  .? < ' ID ! DD%$> 4I : ;  4I?  : ;    I8 I&I .?  : ; @ D  D D I: ;   I: .?  : ; @ ID . : ; @ ID . : ;@ ID I: ; 4I : ; . : ;@ D .?  : ;@ D .?  : ;@ ID I !I/I !I/  : .? < ' ID I.? < D .? < ID .? < ' D  .? < ' ID ! DD%$> I4I : ;  . : ; @ D D D I: ;  .?  : ; @ ID  . : ;@ ID  I: ; 4I : ;  I !I/ I:  :  I8  : D . : ;@ D .?  : ;@ D .?  : ;@ ID .? < ID .? < D &I.? < ' ID I.? < ' D .? < ' ID  DD%.?  : ; @ ID I: ;  D D $> 4I : ;  I.?  : ; @ D   I: .? < ID .? < D &I.? < ' ID I :  I8 I !I/ .? < ' ID  DD%$> I!I4I : ;  I !I/I  I   I8 . : ; @ D  I: ;  D D .?  : ;@ D . : ;@ ID I: ; 4I : ; . : ;@ D .?  : ;@ ID I:  : !I/ .? < D .? < ID &I.? < ' ID I.? < ' D  : .? < ' ID  DD%$> 4I?  : ;  I.?  : ; @ D I: ;  4I : ;  D D  :  I8 .?  : ; @ ID  . : ; @ D  I:  4I : ;  : I !I/ .?  : ;@ ID I: ; . : ;@ ID .?  : ;@ D &I.? < ' ID I.? < D .? < ID .? < ' D .? < ' ID  DD%.?  : ; @ ID I: ;  4I : ;   D D $> I . : ; @ ID  .?  : ;@ ID  I: ; 4I : ; I !I/I: . : ;@ ID I !I/  :  I8 .?  : ;@ D &I.? < ' ID I.? < ID .? < D .? < ' D .? < ' ID  DD%$> 4I?  : ;  . : ; @ D D D .?  : ; @ ID 4I : ;  I: .?  : ; @ D  I: ;  .?  : ;@ D  I: ; 4I : ; .?  : ;@ ID .? < ID .? < D I.? < ' ID I&I :  I8 I !I/ .? < ' ID  DD%$> &II !I/4I?  : ;  I.? < ' ID  I I:  :  I8 I !I/ .? < ' ID  DD%  I8 I$> I:  : 4I : ;  . : ; @ D  I: ;  D D . : ; @ ID  .?  : ; @ D .?  : ; @ ID .?  : ;@ D I: ; .?  : ;@ ID .? < D .? < ID &I.? < ' ID I.? < ' D I !I/ .? < ' ID  DD%.?  : ; @ ID I: ;  4I : ;  D D $> I: .?  : ;@ D  I: ; 4I : ; .? < ID .? < D I.? < ' ID I&I :  I8 I !I/ .? < ' ID  DD%.?  : ; @ D 4I : ;  D D $> I: I: ;  I  :  I8  :  .? < D .? < ID .? < ' ID I&II !I/ .? < ' ID  DD%$> I4I : ;  4I?  : ;  I !I/ .?  : ; @ D  D D . : ; @ ID  .?  : ; @ ID  I: ;  I:  . : ; @ D 4I : ; .?  : ;@ D . : ;@ ID I: ; .?  : ;@ ID .? < D .? < ID &I.? < ' ID I.? < ' D  :  I8 .? < ' ID  DD%.?  : ; @ D 4I : ;  D D I$> I:   I8 . : ; @ D  I: ;  .?  : ;@ ID  I: ; 4I : ; I !I/.? < ID .? < D .? < ' ID I&I : I !I/ .? < ' ID  DD%.?  : ; @ D I: ;  4I : ;   D D $> I .?  : ;@ ID  4I : ; I: I: ; .? < ID II !I/  :  I8 &I' D .? < ' ID .? < D .? < ID .? < ' D .? < ' ID  DD%.?  : ; @ D 4I : ;  D D $> . : ; @ ID I: ;  I I:  :  I8   .?  : ; @ ID I !I/ .? < D .? < ID .? < ' ID I&II .? < ' ID  DD%$> I4I?  : ;  .?  : ; @ D I: ;  4I : ;  D D I:  :  I8  I !I/ .?  : ;@ D I: ; 4I : ; !I/.?  : ;@ ID .? < ID .? < D &I.? < ' ID I.? < ' D  : .? < ' ID  DD%$> 4I?  : ;  .?  : ; @ D I: ;  4I : ;  D D I  :  I8 D I  !I/ I:  : .?  : ;@ D I: ; 4I : ; . : ;@ ID .?  : ;@ ID . : ;@ D .? < D .? < ID &I.? < ' ID I.? < ' ID  DD%$> 4I?  : ;  I :  I8 4I : ;  D I  !I/ I !I I .?  : ;@ D 4I : ; D D .?  : ;@ ID I: ; . : ;@ ID .? < D .? < ID &II: .? < ' ID I.? < ' ID  DD%.?  : ; @ ID I: ;  4I : ;   D D $> I I  !I/  :  I8 I: .?  : ; @ D .?  : ;@ ID I: ; 4I : ; 4I?  : ;  .? < ' D I.? < ' ID &I.? < D .? < ID  : .? < ' ID .? < ' ID  DD%.?  : ; @ D 4I : ;  D D $> I.?  : ;@ ID I: ; .?  : ;@ D  4I : ; I: I  !I/ . : ;@ ID  :  I8 I!II !I/4I?  : ;  .? < ID .? < D &I.? < ' ID I : .? < ' ID  DD%. : ; @ ID I: ;   4I : ;  D D $> I I: <  :  I8 .?  : ; @ ID .?  : ; @ D 4I : ; &I.? < ' D I.? < ' ID .? < D .? < ID  : I !I/ .? < ' ID  DD%$> I: I4I : ;  .?  : ; @ ID I: ;  D D .?  : ; @ D   :  I8 .? < ID .? < ' ID I.? < ' D &II !I/ .? < ' ID  DD%$> &II!I4I : ;  I !I/ I 4I?  : ;  .?  : ; @ D  D D . : ; @ D I: ;  I: . : ; @ ID 4I : ; . : ;@ ID I: ; .?  : ;@ ID !I/.? < D .? < ID .? < ' ID I :  I8 .? < ' ID  DD%  I8 I$> I: 4I : ;  . : ; @ ID  I: ;  D D <  :  . : ; @ D .?  : ; @ D .?  : ;@ D I: ; 4I : ; . : ;@ ID .?  : ;@ ID . : ;@ D  :  .? < ID .? < D &I.? < ' ID I.? < ' D I !I/ .? < ' ID  DD%. : ; @ D I: ;  D D $> .?  : ; @ D 4I : ;    4I?  : ;  .? < ' ID  I ' D  I.? < D I: &I :  I8 I !I/ .? < ' ID  DD%$> I4I?  : ;  I:   I8 4I : ;  .?  : ; @ D  D D . : ; @ ID  I: ;  .?  : ; @ ID  ( . : ;@ ID I: ; 4I : ; I !I/  : I !I/.?  : ;@ ID  .? < D .? < ID &I.? < ' ID I.? < ' D  .? < ' ID ! DD%.?  : ; @ D D D .?  : ; @ ID 4I : ;  $> 4I?  : ;  .? < ID .? < D I .? < ' ID  I I: &I :  I8 I !I/ .? < ' ID  DD%$> I !I/ 4I?  : ; every_first_cmdcurr_ifileold_ifileany_displayDstart_attnposiend_attnposlogfileforce_logfilenamelogfilemainsaveecallocskipspsprefixquiteditprotoeditor0less_is_moreTdohelprsecurequittingprognamewscroll!initial_scrposGis_ttyenew_file,(Zmissing_capraw_mode4scrsizeWspecial_key_strget_term init ddeinit home add_line lower_left line_left Lcheck_winch ~goto_line vbell bell Gclear sclear_eol clear_bot[at_enterat_exitat_switchJis_at_equivapply_at_specialsputbsclear_bgcan_goto_linebelow_memabove_membl_e_width>bl_s_width`so_e_widthso_s_widthul_e_widthul_s_widthbo_e_width bo_s_width,sc_heightMsc_widthmwerase_charkill_charerase2_charerase_charignawauto_wrap-Asmatch_bracjQ!ch_getch_ungetcharend_logfilesync_logfile ch_seek ch_end_seek Jch_beg_seek ch_length ch_tell ch_forw_get ich_back_get ch_setbufspace ch_flush seekable ^ch_init ch_close ch_getflags=ignore_eoi~svutf_mode(charsetscs_aliasesbinattrainit_charsetbinary_charcontrol_char_prcharprutfcharutf_len9is_utf8_well_formed get_wchar `put_wchar step_char is_composing_char is_ubin_char)is_wide_charvis_combining_char#2openquoteclosequotenmlist_searchml_searchmlist_examineml_examinemlist_shellIml_shellcmd_resetclear_cmdcmd_putstrAlen_cmdbuf\set_mlistcmd_addhistcmd_accept*cmd_charcmd_intBget_cmdbuf{cmd_lastpattern2init_cmdhistsave_cmdhist|!in_mcadispversiongetccBungetccungetsc {commandsV+qcvt_lengthcvt_alloc_chposRcvt_text-init_cmdsadd_fcmd_tableIadd_ecmd_tablevfcmd_decodeecmd_decode4lgetenv lesskey add_hometable editchar$uzfd0curr_altfilenameinit_textlistforw_textlistRback_textlistWeditedit_ifile Xedit_list cedit_first edit_last edit_next Sedit_prev edit_index save_curr_ifile 6unsave_ifile reedit_ifile reopen_curr_ifileMedit_stdincat_fileuse_logfilewcurr_inocurr_dev 93'{shell_unquotedget_meta_escapeJshell_quotehomefileIfexpandfcompletebin_file llglob zopen_altfile close_altfile is_dirbad_file`filesizeshell_coption aAno_back_scrolleof_displayed>entire_file_displayedsquish_checkforwbackfforwardbackwardiget_back_scrollforw_promptsquishedscreen_trashedAvHhelpdatasize_helpdataC;del_ifilenext_ifileprev_ifile=getoff_ifilenifile6get_ifileget_filenameget_indexAstore_posget_posset_openLopenedhold_ifileheld_ifile >get_filestate set_filestateRfuforw_linenback_lineIset_attnposO%sjump_forwjump_backrepaintOjump_percentjump_line_loc>jump_loct%3size_linebuf tabstops-ntabstopsNtabdefaultinit_lineis_ascii_charprewind(plinenumpshift_all Ais_ansi_end is_ansi_middle pappendpflushmbcpdoneset_status_colglineBnull_linerforw_raw_line9back_raw_line"hshiftvyclr_linenumadd_lnumfind_linenumnfind_poscurrlineN=ylsystempipe_markpipe_databsinit_mark badmarkRsetmarklastmarkgomarkomarkposunmarka'dtagoptionopt_oopt__Oopt_l]opt_jcalc_jump_slineopt_shiftcalc_shift_countback_scrollatabstopsqueezequit_if_one_screenquit_at_eofknow_dumb bs_mode,pr_typeKtop_scrollmhow_searchquiet{coiread2intread_get_timeerrno_message>percentagepercent_posreading jwput_line flushWputchrputstrpostoalinenumtoabinttoaget_return8errorhierrorquery wat_prompt final_attr need_clr errmsgsz=ucompile_pattern.uncompile_patternis_null_patternmatch_patternSposition add_forw_posaadd_back_pospos_clearpos_initlonscreenempty_screenempty_linesiget_scrposadjslineXq eqproto;hprotokwprotoinit_prompt pr_expand Eeq_message ~pr_string wait_message prprotoF$init_searchrepaint_hiliteclear_attnNundo_searchclr_hlistclr_hilite!clr_filteris_filtered *is_hilited Nchg_caseless chg_hilitesearchprep_hiliteset_filter_patternTis_filtering[3winch;init_signals~psignals-sigs&tagscleantagsgettagtypefindtagtagsearchnexttagOprevtagntagscurr_tagedit_tagfile^Cuopen_getchrclose_getchrgetchrBtty*Tversion1POSITIONscrpos size_t tm *wint_t __FILEoff64_t(ssize_tpoff_t3FILE(Ztcflag_tcc_ttermioswinsize-rlim64_t@rlimit64rlim_t rlimitvspeed_t/size_ttmewint_t__FILEoff64_tcssize_t off_t%FILEA}POSITIONsize_ttmSwint_t__FILE off64_tYssize_t off_tJFILEQ!bufnodeBLOCKNUM8bufPOSITIONLINENUMpargPARG>dev_tNino_t^mode_tonlink_tuid_tgid_toff_ttime_ttimespectimestruc_tblksize_t(blkcnt_tXstatSfilestatestat64size_t=tmwint_t%__FILE~off64_tssize_t.FILEsvcharsetHcs_aliasLWCHAR mwchar_range@size_tctmwint_tK__FILEoff64_tssize_tsize_ttmiwint_t__FILE woff64_t ssize_t off_tFILEtablelist POSITION oLINENUM parg PARG usize_ttm4wint_t__FILEoff64_t2ssize_tzoff_t~FILE$utextlistPOSITION%scrposLINENUMpargPARGdev_tino_t1mode_tBnlink_tTuid_tdgid_ttoff_ttime_ttimespectimestruc_tblksize_tblkcnt_t+statstat64Bsize_tQtmwint_t9__FILEoff64_tssize_t!FILEw93'LWCHAR>POSITIONQoff_t __FILE 6FILE@dev_tPino_tlmode_t}nlink_tuid_tgid_ttime_ttimespectimestruc_tblksize_t&blkcnt_tVstat6stat64size_ttm3wint_toff64_tssize_taA+POSITIONLINENUM!size_tDtm wint_t ,__FILE off64_t ssize_toff_tFILEvHqsize_ttmwint_t|__FILEoff64_t%ssize_tmoff_t FILEfPOSITIONyscrposuifile size_t tm wint_t __FILE\off64_tssize_toff_tFILEfTPOSITIONFsize_titmwint_tQ__FILE off64_t ssize_t Boff_tFILEO%POSITIONSLINENUM}pargPARGscrpossize_t(tmwint_t __FILE ioff64_t ssize_t off_tFILEt%3LWCHARPOSITIONLINENUMsize_ttmwint_t__FILEoff_tFILE'dLINENUM.parg|PARG3POSITION size_ttmIwint_t__FILEoff64_tGssize_toff_t8FILECZioptname(loptionLINENUMparg(PARG size_t 1tm wint_t__FILEroff64_tssize_toff_tFILE\Doptnameloptionsize_tGtmwint_t/__FILEoff64_tssize_t off_tFILE{csigset_ttime_tPOSITIONjmp_bufsize_ttm fwint_t __FILE off64_t dssize_t off_tvFILEjqPOSITION3LINENUMpargPARG size_t tm wint_t u__FILEoff64_tssize_toff_tXFILE=size_tQregex_tregoff_t"regmatch_t !tm wint_t __FILEboff64_tssize_toff_tFILESPOSITION:scrpossize_ttmwint_t__FILE Qoff64_t ssize_t off_tFILEXqPOSITION\LINENUMsize_t|tmwint_td__FILEoff64_tssize_tMoff_tFILE $POSITIONwhilitesize_tregex_tpattern_infoLWCHAR scrposLINENUMtmwint_t__FILE_off64_tssize_toff_t!FILE3size_t tmwint_t__FILE Soff64_t ssize_t off_t pid_tFILE&LINENUMtagQtaglistVtag_resultPOSITION|__FILEFILEmsize_ttm~wint_toff64_t:ssize_toff_tCsize_t tmwint_t__FILEUoff64_tssize_toff_t FILE.save_status](Z~init_doneattrmodecurr_on^save_termsaved_termeenvstbufsbuf.costcountOhardcopy4sc_deinitTsc_initrsc_e_keypadsc_s_keypadsc_backspacesc_visual_bellsc_bl_outsc_bl_in=sc_b_out\sc_b_inzsc_u_outsc_u_insc_s_outsc_s_insc_eos_clearsc_eol_clear:sc_clearYsc_movewsc_returnsc_lower_leftsc_addlinesc_homesc_pad^Q!vch_ungotcharmaxbufstriedthisfilesvbinfmtutfbinfmtbuf"buf comp_table comp_table @comb_table comb_table ubin_table ubin_table :wide_table zwide_table chardefW#2~in_completionicurr_mlistcmd_mbc_buf_index cmd_mbc_buf_lenccmd_mbc_bufcurr_cmdflagstk_tlisttk_trial%tk_ipointEtk_originalgtk_textliteralcmd_offsetcpprompt_colcmd_col;cmdbuf!ungotpshellcmd pipec save_hshift bottompos @optgetname aoptflag optchar fraction number search_type mca 2ungotcmdtablecmdtableedittableFedittablelist_fcmd_tableslist_ecmd_tableslist_var_tablesBlist_sysvar_tables/$uTcurr_altpipeJ93'mcharsis_a_dirnot_reg-aAfirst_time8anchorifilesHt%3linebufattrplast_overstrikembc_buf_lenmbc_buf_indexmbc_posmbc_bufmid_ansi_chars)end_ansi_charsNpendposlpendclmarginis_null_lineoverstrikecolumncurr@cshiftxstartimeloopcountspare pool$freelistCanchor3bsm4marks6CZibuf 2pendopti\DSa_optnamesb_optnameB__optnamec_optnamed_optnamee_optnamef_optname4F__optnameUg_optnameuh_optnamei_optnamej_optnameJ__optnamek_optnameK__optname7L__optnameXm_optnamexn_optnameo_optnameO__optnamep_optnameP__optnameq2_optname;q_optname[r_optname{s_optnameS__optnamet_optnameT__optnameu_optnameV__optname>w_optname^x_optname~X__optnamey_optnamez_optnamequote_optnametilde_optname'query_optnameKpound_optnameokeypad_optnameoldbot_optnamefollow_optnameoptionoptionG{cconsecutive_nullsread_labelyjobreturn_to_continueintr_to_abortCintr_to_abort \obuf;Stabletable_sizeXqs_protos_proto(m_protocm_protoM_protoM_proto"e_proto]e_protoh_protoh_protow_protoWw_protomore_protomore_proto mp Tmessage$hilite_anchorfilter_anchorfilter_infosearch_infois_ucase_patternis_caselessprep_endpos>prep_startposbhide_hiliteg&taglist circular curtag curseq total(Zltget_envltgetflagGltgetnumltgetstr inc_costcount hcost cheaper )tmodes beep clear_eol_boteQ! buffered 2ch_addbuf init_hashtbl ch_delbufssvichardeficharsetilocale\setbinfmtset_charset is_in_table#2cmd_step_commoncmd_step_rightcmd_step_left 2cmd_repaint ]cmd_home cmd_lshift cmd_rshift cmd_right 8cmd_left cmd_icharcmd_erase}cmd_deletecmd_werasecmd_wdelete&cmd_killcmd_updowncmd_edit+cmd_istrdelimit_wordinit_complfnext_complcmd_completehistfile_nameGsave_mlist!cmd_execstart_mcamca_searchmca_opt_toggleeexec_mcamca_charclear_buffersmake_displaypromptmulti_searchkexpand_special_keys]add_cmd_tableadd_var_tablecmd_searchcmd_decodegintold_lesskey Vnew_lesskeyf$uclose_file edit_istep Vedit_inext edit_iprev93'metacharsmetachar+dirfileseek_filesizeareadfd Nshellcmd+aAeof_bellzincr_index7link_ifileunlink_ifilenew_ifilefind_ifilet%3 expand_linebuf,pshiftattr_swidthGattr_ewidthpwidth#backcin_ansi_esc_seq store_char store_tab Nstore_prchar flush_mbc_buf do_appende\calcgapRlongloopmessagelongishabort_long;bgetumarkgetmarkqCZiflip_triplenproptnostringpoptstringnum_error-\D is_optcharXj iprint_intiprint_linenum less_printfA=ycompile_pattern2matchXqap_strap_charap_posap_linenumap_intap_quest%curr_bytecondprotochar skipcond Cwherechar&$7set_patternclear_patternYinit_patternget_cvt_opsis_ucaseprev_patternRis_hilited_range add_hilite Dhilite_line hilite_screen .search_pos search_rangehist_pattern;3wu_interruptstop&maketagentfindctagctagsearchfindgtag -nextgtag vprevgtag gtagsearch getentry.interp.hash.dynsym.dynstr.SUNW_version.rela.got.rela.data.rela.plt.text.init.fini.rodata.rodata1.dynamic.picdata.bss.symtab.strtab.annotate.comment.debug_loc.debug_info.debug_line.debug_abbrev.debug_pubnames.debug_typenames.debug_varnames.debug_funcnames.shstrtabXX xx\ ?"VV&o||`-B}0}0x7B}}BB}}L``( R**X**^**-fX`X`&2~~G D oHH<>`xxxېې5tې [3o@ (hM M Uk&  1V ?a! aF ~T   g x&0707010005a2a1000081ed0000000000000000000000014cad6b4b00005a000000010000010036ffffffffffffffff0000001c00000000root/usr/local/bin/lessechoELF+ @Q@8@! @@X/usr/lib/sparcv9/ld.so.1)'  !"$ #%& `@/7M T[@b{!HSP  H "%F d  x  p * strcmpstrlen$XAoAMiKLtWrMEjz.metachars_lib_version_GLOBAL_OFFSET_TABLE__initfprintfstrchr$XAoAMiKLtWrMEjz.version_edata_exit_environ$XAoAMiKLtWrMEjz.meta_escape__environ_lock_DYNAMIC_PROCEDURE_LINKAGE_TABLE_$XAoAMiKLtWrMEjz.num_metachars_startatexit_get_exit_frame_monitor$XAoAMiKLtWrMEjz.meta_escape_buf__1cG__CrunMdo_exit_code6F_v_$XAoAMiKLtWrMEjz.quote_all_etext__xargvmain_end$XAoAMiKLtWrMEjz.closequote__iob__xargc___Argv_fini$XAoAMiKLtWrMEjz.openquote__fsr_init_valuelibc.so.1SUNW_0.7SUNWprivate_1.1libz.so.1/usr/local/lib =( Nq  $  @` [`+p @ "``+p @ rc`+p @ rcp, @`+p ' \H tH+``+p ) -`-#h `?-#h =--%#h #h#0@j`+p  @c!`*p  Z#x `*p  Z#@O@@k@O@U@A@cw`]!`]@@F A@c$wנw`]\ w_L H_L HH?_ w_L O_ w_L $H%_L H _L H_L _,`_ߠ w_ w_L $H _L H_L O _,``]@@@A@aww`]!`]_@@͔@  w'w 'w_L H_L H_ w_L O_L O_L -H  '_ wH _L +H_ wG H  '_L 0HH  '_ wH 'H _ w_L xOO_L 0H _L 9H_L $ 0'H$_L aH _L fH_L $ W'H_L AH _L FH_L $ 7'HHGGHH _GL@G۠@w_ wO_瀤h_L H_L H_ w_L O_L O__t`G׀H_Ϡ Hw_w_߰A@b w'w 'G$ 'G Hi_ w_\ w_L -HGӀHHXH `]$`HH_ߠ w_L `],`H=_ߠ w_ߠא@ `],`__߀h`]͐H$_ߠ w_` ]@@ H `(]`]t`H_`]t`H_ߠ w_ߠא@ Ô`],``]`]t`__߀h`0]H_ߠ w_L `],`H_ߠ w_ߠא@ `],`__߀h`8]lH`]D 'GϠ `]$`_ߠ w_L G`],@ `]D `],@H`]D 'Gˠ `]$`_ߠ w_ߠא@ TG`],@__߀h`@]' `]D `],@Hu H'_ߠ w_L H 'Hd_`H]@@ H H'_`P]@@ Hz H'`X]``]H:_ߠ w_L `mH#`cH`?H`-OOO`aOO%`c O, < #`_D%`m O, < #`_DG$ 'G OG'G$ 'G'Gˀ H '_\ w_ w_w_L H`]_L @@vh 'H _נ w_L O`]D HGǀH`]\ @^ h`h]`]L _`]L @@2H._w_L H'`]_L @@1h `p]`]\ @@`x]_L @@ _נ w_L OG H `]@H`]@G'G$ 'G'GÀ On 'G< 8<,XPPusage: lessecho [-ox] [-cx] [-pn] [-dn] [-mx] [-nn] [-ex] [-fn] [-a] file ... %s Missing number after -d-Missing number after -fMissing number after -pMissing number after -nversionhelpInvalid option after --Invalid option letter%c%s%c%s%c $Revision: 1.13 $\ 8@H`x0o0o0o0o0o 0o@0o`0o0o  ))xh 8 o2oo  oo""436Xxh       H ; A x5HhVb q|b  P  H   `  h\     8 @ H ` x         $ *|b 4I P`W@r @!HP:  AHH"`   x  p   3lessechocrti.scrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptr__crt_scratchvalues-Xa.cDrodata.rodatalessecho.cBbss.bssDdata.dataDpicdata.picdata.L21pr_usage.L70pr_versionpr_errorlstrtol.L309.L317.L321.L338.L353.L369.L392.L404.L414.L417.L471.L490.L494.L509.L514version.ccrtn.s_END__START_strcmpstrlen$XAoAMiKLtWrMEjz.metachars_GLOBAL_OFFSET_TABLE__initfprintfstrchr$XAoAMiKLtWrMEjz.version_edata_exit_environ$XAoAMiKLtWrMEjz.meta_escape__environ_lock_DYNAMIC_PROCEDURE_LINKAGE_TABLE_$XAoAMiKLtWrMEjz.num_metachars_startatexit_get_exit_frame_monitor$XAoAMiKLtWrMEjz.meta_escape_buf__1cG__CrunMdo_exit_code6F_v_$XAoAMiKLtWrMEjz.quote_all_etext__xargvmain_end$XAoAMiKLtWrMEjz.closequote__iob__xargc___Argv_fini_lib_version$XAoAMiKLtWrMEjz.openquote__fsr_init_valueanotate anotate  h  l  x" # $ anotate @(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03acomp: Sun C 5.10 SunOS_sparc 2009/06/03ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.497Alessecho.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g lessecho.c -W0,-xp\$XAoAMiKLtWrMEjz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKLtWrMEjz.;backend;raw;cd;DBG_GEN 5.2.7char{version intquote_all! openquote{" closequote{# meta_escape$ long{@Y4?metachars<& num_metachars' pr_usage+  nDpr_version2  Hn1p3xbuf14npbuf5`D{ N4 pr_errorC h n sAxD lstrtolM n4+ sIx radixIt +pendIhvN\negOXn4PPD mainln argc| +argvparg`sXno_more_optionsT d 8 8has_metaHD {;4meta_escape_buf%  {astrchrj {unsigned longsize_tstrlen { {strcmpOmkstempvmkstempexit tm$tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst# __wcsftime_xpg5wchar_t __wcstok_xpg5_wint_t__putwchar_xpg5__44__FILE__pad#__putwc_xpg5_ ___getwchar_xpg5___getwc_xpg5_ h__ungetwc_xpg5_ _  __fputws_xpg5   __fputwc_xpg5_ &___fgetws_xpg5 n &__fgetwc_xpg5_ lockf 4 { truncate  44off64_ttell  Kvoid K S4ssize_tpwrite e  \ e Kpread e   elseek  8 ftruncate j4 { jtruncate  s44off_ttell   K pwrite e 4  epread e t  elseek   lockf 4ftruncate4 { {&attropens/ {sopenat| {unsignedcreat  { openJ {J {\attropenSe {openat {creat4 {4opent=ftello tfseeko 4 4fsetpos 4fgetposV FILEVtmpfilee { {freopenee { {fopene2ftello a2fseeko 4 4fsetpos fgetpos   { printfD {Dfprintf M { {freopenee { {fopene6tmpfilee0version.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g version.c -W0,-xp\$XAoAMiKKtWrMEfz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKKtWrMEfz.;backend;raw;cd;DBG_GEN 5.2.7charlongyversion  /var/tmp/less-436/usr/include/sys/usr/include/isolessecho.ctypes.htime_iso.hwctype_iso.hstdio_impl.hstdio_iso.h  ,4  44 ~T&U(  h<  4 ! !!x 4$4$4% $45 )$0 0@ @1 @( 0@ `0p 0-55!@8{9$)9{\)84|)f 9/ /var/tmp/less-436version.c DD%$> I4I : ;  I !I/ . : ; @ D D D I: ;  . : ; @ ID  .?  6 : ; @ ID   &I.? < ' ID II: .? < ' D  :  I8 .? < ' ID  DD%$> I !I/ 4I?  : ; 'M4main*Mversion_Mpr_usagepr_versionNpr_errorlstrtolMsize_ttm_wint_t__FILE off64_t essize_t off_tVFILEMversionquote_allopenquoteclosequotemeta_escapeYmetacharsynum_metachars;meta_escape_buf.interp.hash.dynsym.dynstr.SUNW_version.rela.got.rela.data.rela.plt.text.init.fini.rodata.rodata1.dynamic.picdata.bss.symtab.strtab.annotate.comment.debug_loc.debug_info.debug_line.debug_abbrev.debug_pubnames.debug_funcnames.debug_typenames.debug_varnames.shstrtabXX xxH "hh8o0-B7BBB L  RX^fP2G o<HHx K *Do-.44J4LxNiiNkO= O P&0707010005a2a2000081ed0000000000000000000000014cad6b4b000092500000010000010036ffffffffffffffff0000001b00000000root/usr/local/bin/lesskeyELF+@@P@8@ @@X8888 @==/usr/lib/sparcv9/ld.so.1OL !#$%&(*+-0134569:=ABCDFI  "'),./278;<>?@EGHJK  < '( = &?P5?==D pO<VDbHjDq  Py?8; &@=@; 2x"=;H #(T ,;DxJ";< -P(FDA 2N 2TD_?f ) (Xt !0D D @C8@?HD PDF<D=`<F % |H' #4== [<`!?HbDm 8t?p| (< <@D X +` H< "Xinit_tablesstrncmpfindactionfopen__environ_lockoutfilefwriteparse_argsstrcmpeditsection__xargv_edataskipnspcmdnames_GLOBAL_OFFSET_TABLE__exitfputintperrorfprintf_init_get_exit_frame_monitorerrorsadd_cmd_strparse_lineatexit$XBoAMiKKtWrMEhz.tstr.tstr_control_k_end_PROCEDURE_LINKAGE_TABLE_main_lib_version_finiendsectioninfileparse_cmdlineclean_line$XBoAMiKKtWrMEhz.tstr.bufcurrtable_starteditnames_environcmdsectionusageedittablecmdtable__iobstrlenvarsectionfgetsgetenvlinenumfputbytesskipsp__xargccontrol_line_DYNAMIC__1cG__CrunMdo_exit_code6F_v_strcatfileheader_etext___Argvhomefilecallocstrcpyfiletrailermkpathnameparse_varline__fsr_init_valuetstrvartableadd_cmd_charlibc.so.1SUNW_0.7SUNWprivate_1.1libz.so.1/usr/local/lib =( Nq:0?; ;;;;<1< B<@C<`<<4<< <J== =@=`3= [`+p @ "`Т`+p @ r``+p @ rcp, @`+p ' \H tH+``+p ) -`-#h `?-#h =--%#h #h#0@ `+p   @ "`*p  Z#x `*p  Z#@ w@3@@ w@ }@A@ bwax]!`]@@ n@ \  A@ bDwww_@ a_@ ]@  @ _w__@@ a_`]@@ b__@@ ]_w_ A@ atww`]@ Lw_瀤h_L H __@wHax]!` ]@@ `(]_@w_w_0A@ `w'wa]t G$ 'G H_ w_\ w_L -HH_L  HH_L  -H_L  H G$ '_ wHHn_`0]@ @  H _L  H _ a]t`H_L  =H _ a]t`HH_`8]@@  HH)HE_\  a]t`a]\ L HG$ 'G H_ w_\ a]t`H"`@]a0]@@ @ A H_L  VH -OOO oOOG$ 'G OVG HG H _\ a@]t`H `H]a@]t @A@`wa]ap]t`ap] ap]t`aX]ah]t`ah] ah]t`a]t a] a]t` A@`ww'_\ wH_ߠ wH* /ޠ 'Oޣ, _L $ 0@/_ߠ w_L 0H_L 7H Gנ 'G׀ O__t`GH Oހ Ha(]H|wOaH],` aH],`aH]Hmw_ߠ _t``P]Hdw_ߠ _t` aH],` aH],`aH]HQw_ߠ _t``X]HHw_ߠ _t```]H?w_ߠ _t``h]H6wGHH+ H\/ޠ HY/ޠ HV/ޠ HS/ޠ HP/ޠ HM/ޠ HJ/ޠ HG/ޠ HD/`p]@K_ߠ _t``x]Hw_ߠ w_L hH dH  DO UOOO eOO rH  hO lOO uH rOOO xOO_ߠ _t` aH],`OaH],` aH],` aH],` aH],` aH],` aH],`aH]Hw_ߠ _t`_L aH],` aH],`GHaH]L Ha(]HwaH]Hw_L `bH%`0 O, < #c_ϠD`nH`eH`bOOO`kO+O`rH`nOOO `tOO_ߠ _t`_L  aH],` aH],`aH]L Ha(]H2waH]H-w_L \Oz ^O_ߠ _t`_L aH],` aH],`GHaH]L Ha(]HwaH]w_DDDDDDDD@w_L H_L H_ w_L O_L O_w_@w_L H_L H_L H_ w_L H _L H_L O_w_0w_w '_L H7_GL@ H1_GL@ H+_GL@ #HG뀤 H _G$ < L@ \HHG '_GL@ H_GL@ H_GL@ O _G,@_w_0A@bDw'aP]\ \ aP]\ " h `]@i@9 aP]\  w_\ w_ _t`G_,`@w_L H_L Ð_ w_L O0A@aww_`]`]@ @@/ H ah]aP]t` HR'_`]`]@@@ H ap]aP]t` H7'_`]`]@֐@@ H a]aP]t` H'_`]`]@@@ޔ H G E g H' 'G<  ww'G'G$ 'G'G〤 H__@  @Ȗ_ wG'G$ 'G'Gۀ O0A@b\ww'# Hax]!`]@@O@=  ?/_@  @4 /_@  @0A@atww 'aP]\ \ \ h*aP]\ \ G,0\@_@@J H aP]\ \ G,0@D H'G 'aP]\ \ G,0\@o`]@ d'G< @A@`Dwwax]!`]a]D _@@̖a ]D  a ]$`A@cww 'Ւ wG_@@'G H `]H_j_L H _L H_L O% _zw_L H `]H9_w_w_L /֠ _,`_:'O_,`_Ww_L HGHG _L H @q _L Oސ 0A@awwU w__L H_L H _L =H_L O _w_L '_ wG'G瀤 =H `]H _w_L H@ w__L O 0A@`ww_HH_w_L HHaP]\ a]h_}H_ A@cLw'wG_@a@]\ `]@@Œ Hax]wHa@]\ `]@@ʒw_߀h a@]\ @ǐ a ]$` a]$`_ߐ@$@hרa]D  a]$`u_ߐ$@oa ]D Hax]!`]a ]D @@/@ a]\ h `]@Ia]t a]\ h `]a]t a]\ a]@@Sw_׀h a]\ @P@ _a]@ Y_a`]@ P_ap]\ ap] $@o_ap] ap]\ ap] $@1_a]@ (_ah]\ ah] $@G_ah] ah]\ ah] $@ _a]@ _a]\ a] $@_a] a]\ a] $@_a8]@ _a]@  'G< PPusage: lesskey [-o output] [input] /HOMEcannot find $HOME - using current directory .--output--versionlesskey version %s .lesskey illegal char after \ktoo many commands#line-edit#command#env#stoperror: integer too big (%d > %d) unknown actionline %d: %s command too longmissing actionmissing =-r%d errors; no output produced LESSKEY.lesswbback-bracketback-lineback-line-forceback-screenback-scrollback-searchback-windowdebugdigitdisplay-flagdisplay-optionendexaminefilterfirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-lineforw-line-forceforw-screenforw-screen-forceforw-scrollforw-searchforw-windowgoto-endgoto-linegoto-markhelpindex-fileinvalidleft-scrollnext-filenext-tagnoactionpercentpipeprev-fileprev-tagquitremove-filerepaintrepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markshellstatustoggle-flagtoggle-optionundo-hiliteversionvisualback-completebackspacedeletedownexpandforw-completehomeinsertkill-lineleftliteralrightupword-backspaceword-deleteword-leftword-right=2222333 303H3X3`3h3p3x3333333444(4@4P4`4h4p444?D?HDxDD?DDC8DDFDFDDH0o0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0ow`0oo0og 2x 2x    oN o0o` oo;=4$444445"55 5(585H5P 5X75` 5p 5 5#525 55 5(566!6(686H6X6`&6pf6x)6656e66%66666477 7+7(,7@-7P.7h*7x777/7/7'77 77785H 888 8(6pf808@8H8P8X 8` 8p 88 (FM+GcevxEnd436Xx 0`x @ 2x 2 2 28;=?HDDsJy ?x4?G?hUa 2pzD?Da 2 2( 2 2 20 3 3 3  30 3H 3X 3` 3h 3p 3x 3 3 3 3  3 3 3( 4" 4( 4(. 4@4 4P: 4`@ 4hF 4p M 4T 4[ 4bzDDDa 2l < '(= ?P?= p<DHD  P?8; &@&=@-;5 2x;"=;SHZ #(Tf ,q;xDxJ; -P(D 2 2D? )' (X !0D D# @*C8@4?H=DH PNDXFag<nDy=`<F % |H #= <`5!?HD 8?p (<  <@D X* +`8I NH.<W "Xlesskeycrti.scrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptr__crt_scratchvalues-Xa.cDrodata.rodatalesskey.cBbss.bssDdata.dataDpicdata.picdata.L93.L107.L122.L132.L134.L197.L232.L266.L298.L381.L390.L394.L398.L432.L435.L610.L649.L661.L673.L685.L736.L774.L786.L812.L836.L912.L987.L997.L1032.L1043.L1052.L1058version.ccrtn.s_END__START_init_tablesstrncmpfindactionfopen__environ_lockoutfilefwriteparse_argsstrcmpeditsection__xargv_edataskipnspcmdnames_GLOBAL_OFFSET_TABLE__exitfputintperrorfprintf_init_get_exit_frame_monitorerrorsadd_cmd_strparse_lineatexit$XBoAMiKKtWrMEhz.tstr.tstr_control_k_end_PROCEDURE_LINKAGE_TABLE_main_lib_version_finiendsectioninfileparse_cmdlineclean_line$XBoAMiKKtWrMEhz.tstr.bufcurrtable_starteditnames_environcmdsectionusageedittablecmdtable__iobstrlenvarsectionfgetsgetenvlinenumfputbytesskipsp__xargccontrol_line_DYNAMIC__1cG__CrunMdo_exit_code6F_v_strcatfileheader_etext___Argvhomefilecallocstrcpyfiletrailermkpathnameparse_varline__fsr_init_valuetstrvartableadd_cmd_charanotate anotate  X2 ?x?"@2#D2$L2anotate @(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03acomp: Sun C 5.10 SunOS_sparc 2009/06/03ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.497 lesskey.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g lesskey.c -W0,-xp\$XAoAMiKKtWrMEhz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKKtWrMEhz.;backend;raw;cd;DBG_GEN 5.2.7charyintcmdnamecn_name#cn_action#long9cmdnames^ ?@2editnames C8y{  tablenamesS#pbuffer#buffer\#{currtable D y fileheader D yLfiletrailer/ D ycmdsectiono D yeditsection D y varsection D yJendsection- Dinfile ?outfile ? usage8n DmkpathnameXnQdirnamexfilenameppathname` D homefile(nfilenamexphpathname` Dparse_args n4argc |4argv parg h D init_tablesU`no DtstrglnA4ppdxxlatedtph`chyi_ijXbufAk Dtstr_control_k^l Dx D y ^ y{skipsp $nsx Dskipnsp P nsx Dclean_line!"0ndsxil Dadd_cmd_char"X#nc| Dadd_cmd_str#(#tnsx Dcontrol_line#%`n 7sx DfputbytesA%& n  fd=xbuf=plen=l D ΀ __FILE __pad # FILE fputintP&@'n ^ fdMx ^valMtcyQs D unsignedfindactione'((,n actnamecxifp Derrorr(X(n spx Dparse_cmdline{)*n pyxcmdlen|tactname}haction~dsXcyW Dparse_varline+,`n pxsp Dparse_line,-0n flinexpp Dmain-P2dn argc|4argvpdesc `out Xline w D y errors Hlinenum Fvartable{ Hedittable{ Dcmdtable{ Fy y unsigned longstrncmp,   y, size_tstrlen>u5yustrcpy~yystrcmp y strcatJmkstempqmkstempygetenvexitvoidcalloc,  5tm$tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst# G__wcsftime_xpg5>d,>>wchar_tddxo__wcstok_xpg5oowint_t__putwchar_xpg5 __putwc_xpg5P__getwchar_xpg5__getwc_xpg5__ungetwc_xpg5 __fputws_xpg5!__fputwc_xpg5W __fgetws_xpg5oodW__fgetwc_xpg5lockfytruncateF off64_ttellF||ssize_tpwrite pread* lseekFaFftruncateytruncateoff_ttell  pwrite] pread lseeklockf ftruncate=y=yOattropenFXyopenatycreat' ^y'openg0ygyyattropenpyopenatycreatQ ^yQopenZ ftelloFfseekofsetpos:fgetposs:tmpfile yyfreopen  yyfopen 7 ftellof7fseekoyperrorfsetposfgetpos@:@ fwrite>I>>Rfgetsyprintf y fprintfOyOyafreopen Xj yyfopen tmpfile version.c /var/tmp/less-436 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -L/usr/local/lib -R/usr/local/lib -I. -c -DBINDIR='"/usr/local/bin"' -DSYSDIR='"/usr/local/etc"' -I/usr/local/include -g version.c -W0,-xp\$XAoAMiKKtWrMEfz.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKKtWrMEfz.;backend;raw;cd;DBG_GEN 5.2.7Wcharlongyversion DK /var/tmp/less-436/usr/include/usr/include/iso/usr/include/syslesskey.cstdio_impl.hstdio_iso.htypes.htime_iso.hwctype_iso.h 4 XD (  (H4- )$!! = , -5)-(10^p5-0 (-(-, (\, !! !!!! r4 $ 8 5( ( $ 8  45  PHI !XT~ "XA L #( - #Q(Q(Q(Q %9(}  &@D(( '(8H ~  (XP0 ) $)! !$! + = %} ,$ 4! -P @$ 90} )H(0(0 0@U0@0@009/ /var/tmp/less-436version.c DD%$> I  I8 I !I/ 4I?  : ;  !I/   I  .?  : ; @ D  D D .?  : ; @ ID I: ;  4I : ;  .?  : ;@ D I: ; 4I : ; .?  : ;@ ID  : I: .?  6 : ;@ ID &I.? < ' ID I.? < ' D .? < ' ID  DD%$> I !I/ 4I?  : ; cmdnames2editnamescurrtable fileheaderLfiletrailercmdsectioneditsection varsectionJendsectionlinfileoutfileusagemkpathnameQhomefileparse_args=init_tablesotstr{skipspskipnspclean_linedadd_cmd_charadd_cmd_strcontrol_line 7fputbytes fputint jfindaction error parse_cmdline parse_varline parse_line fmain errors >linenum ]vartable }edittable cmdtable*versioncmdname{table __FILE FILE>size_tGtmwint_tFoff64_tssize_toff_t=buftstr_control_k.interp.hash.dynsym.dynstr.SUNW_version.rela.got.rela.data.rela.plt.text.init.fini.rodata.rodata1.dynamic.picdata.bss.symtab.strtab.annotate.comment.debug_loc.debug_info.debug_line.debug_abbrev.debug_pubnames.debug_typenames.debug_varnames.shstrtabXX xxt  "   o000-B``7BxxBBL@@"8 R2x2xX22^22f22288G;; o==<?H?HSxDDDD@DU SdoXY^^~Y_;I  ;07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!